Query         psy2758
Match_columns 72
No_of_seqs    114 out of 134
Neff          4.2 
Searched_HMMs 46136
Date          Sat Aug 17 00:26:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2758.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2758hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2898|consensus               99.9 4.3E-23 9.3E-28  158.2   5.8   69    4-72    251-319 (354)
  2 PLN02833 glycerol acyltransfer  99.8 1.9E-20 4.2E-25  143.2   7.7   70    3-72    275-344 (376)
  3 cd07991 LPLAT_LPCAT1-like Lyso  99.2 4.3E-11 9.3E-16   82.9   7.2   70    3-72    135-205 (211)
  4 PLN02499 glycerol-3-phosphate   98.1 4.7E-06   1E-10   67.1   4.5   43   27-69    412-458 (498)
  5 PLN02588 glycerol-3-phosphate   98.0   1E-05 2.3E-10   65.5   4.5   43   27-69    452-503 (525)
  6 PLN02177 glycerol-3-phosphate   97.9 1.3E-05 2.7E-10   63.8   4.5   41   29-69    427-471 (497)
  7 KOG4666|consensus               84.5    0.97 2.1E-05   36.2   2.8   54   16-69    128-183 (412)
  8 PHA03324 nuclear egress membra  79.8    0.72 1.6E-05   35.1   0.5   18   19-36     54-71  (274)
  9 PLN02901 1-acyl-sn-glycerol-3-  74.5     5.8 0.00013   27.6   3.9   31   33-66    181-211 (214)
 10 PHA03323 nuclear egress membra  74.0     1.3 2.8E-05   33.9   0.5   20   18-37     59-79  (272)
 11 PF06072 Herpes_US9:  Alphaherp  73.6     2.8 6.1E-05   25.7   1.8   16   43-58      4-19  (60)
 12 PRK15018 1-acyl-sn-glycerol-3-  73.2       6 0.00013   28.6   3.8   33   33-65    195-229 (245)
 13 PF13559 DUF4129:  Domain of un  66.6     7.5 0.00016   21.9   2.6   17   43-59     16-32  (72)
 14 cd07984 LPLAT_LABLAT-like Lyso  63.5      16 0.00035   23.9   4.1   33   34-66    146-178 (192)
 15 smart00545 JmjN Small domain f  60.4     3.4 7.4E-05   23.2   0.3   25   45-70     10-34  (42)
 16 PF02757 YLP:  YLP motif;  Inte  57.8       4 8.7E-05   16.6   0.2    6   37-42      3-8   (9)
 17 PF02824 TGS:  TGS domain;  Int  56.2     8.2 0.00018   22.3   1.5   28   38-65      4-34  (60)
 18 PF03732 Retrotrans_gag:  Retro  55.9      15 0.00033   21.1   2.6   20   46-65     59-78  (96)
 19 cd08061 MPN_NPL4 Mov34/MPN/PAD  54.8      14  0.0003   27.9   2.8   41   31-72     55-98  (274)
 20 COG3052 CitD Citrate lyase, ga  53.9      11 0.00023   25.1   1.9   20   53-72     75-94  (98)
 21 cd03527 RuBisCO_small Ribulose  50.3      17 0.00036   23.8   2.3   21   37-63      7-27  (99)
 22 PTZ00397 macrophage migration   49.9      32 0.00069   21.7   3.6   37   30-69     57-93  (116)
 23 PF08410 DUF1737:  Domain of un  49.4      20 0.00043   21.2   2.4   17   47-63     11-27  (54)
 24 PF00269 SASP:  Small, acid-sol  48.9      18  0.0004   21.5   2.2   21   50-70      8-28  (61)
 25 PRK09438 nudB dihydroneopterin  46.9      28 0.00062   22.2   3.1   32   35-69     31-62  (148)
 26 PF10209 DUF2340:  Uncharacteri  46.1      27 0.00058   23.9   2.9   24   46-69     25-48  (122)
 27 TIGR02883 spore_cwlD N-acetylm  46.1      40 0.00086   23.1   3.8   33   32-69    101-133 (189)
 28 PF08549 SWI-SNF_Ssr4:  Fungal   45.4      17 0.00036   31.1   2.2   23   41-63    353-375 (669)
 29 PF07485 DUF1529:  Domain of Un  45.3      18 0.00038   24.4   1.9   19   44-62    103-121 (123)
 30 PF00183 HSP90:  Hsp90 protein;  44.9      23 0.00051   28.8   2.9   23   47-69    477-499 (531)
 31 TIGR03162 ribazole_cobC alpha-  43.4      29 0.00063   22.6   2.7   18   46-63    113-130 (177)
 32 PF05093 CIAPIN1:  Cytokine-ind  40.8      12 0.00025   24.8   0.5   14    2-15     70-83  (100)
 33 PF03090 Replicase:  Replicase   38.7      52  0.0011   22.3   3.5   33   34-66     63-99  (137)
 34 PF14740 DUF4471:  Domain of un  38.7      26 0.00056   26.7   2.2   44   23-70    240-285 (289)
 35 COG3399 Uncharacterized protei  38.5      17 0.00037   25.6   1.1   30   33-65     24-53  (148)
 36 COG0406 phoE Broad specificity  37.0      50  0.0011   22.2   3.2   18   47-64    122-139 (208)
 37 PRK03352 DNA polymerase IV; Va  36.2      45 0.00097   24.7   3.1   30   35-68    109-138 (346)
 38 smart00646 Ami_3 Ami_3.         36.1      96  0.0021   19.0   4.2   35   33-69     27-61  (113)
 39 PRK14118 gpmA phosphoglyceromu  35.8      42  0.0009   23.6   2.7   19   45-63    146-164 (227)
 40 cd04676 Nudix_Hydrolase_17 Mem  35.6      61  0.0013   19.3   3.1   31   35-68     25-55  (129)
 41 TIGR00824 EIIA-man PTS system,  35.3      49  0.0011   21.2   2.8   20   44-63     35-54  (116)
 42 cd02636 R3H_sperm-antigen R3H   35.1      47   0.001   20.2   2.5   18   52-69     27-44  (61)
 43 PRK03348 DNA polymerase IV; Pr  34.9   1E+02  0.0022   24.2   5.0   34   35-68    106-141 (454)
 44 PF00101 RuBisCO_small:  Ribulo  34.7      33 0.00072   22.3   1.9   20   38-63      7-26  (99)
 45 PF13776 DUF4172:  Domain of un  34.7      34 0.00073   21.6   1.9   13   55-67     70-82  (82)
 46 PF10820 DUF2543:  Protein of u  34.5      37  0.0008   21.8   2.0   21   49-69     45-65  (81)
 47 cd01700 PolY_Pol_V_umuC umuC s  33.6      48   0.001   24.5   2.9   34   35-68     99-132 (344)
 48 PTZ00130 heat shock protein 90  33.3      45 0.00097   29.1   2.9   24   46-69    737-760 (814)
 49 PRK13462 acid phosphatase; Pro  32.5      51  0.0011   22.8   2.7   18   46-63    115-132 (203)
 50 PRK03482 phosphoglycerate muta  32.5      63  0.0014   22.0   3.1   19   45-63    117-135 (215)
 51 PRK09565 hypothetical protein;  31.8     3.8 8.3E-05   34.0  -3.4   36   37-72    166-207 (533)
 52 PRK09184 acyl carrier protein;  31.4      56  0.0012   20.4   2.5   18   51-68      5-22  (89)
 53 cd07992 LPLAT_AAK14816-like Ly  31.0      52  0.0011   22.3   2.5   30   32-61    166-195 (203)
 54 cd07986 LPLAT_ACT14924-like Ly  30.9      46 0.00099   22.9   2.2   30   31-60    176-208 (210)
 55 cd02696 MurNAc-LAA N-acetylmur  30.4 1.2E+02  0.0026   19.8   4.1   32   34-69     88-119 (172)
 56 PRK14115 gpmA phosphoglyceromu  30.4      63  0.0014   23.2   3.0   20   43-62    144-163 (247)
 57 smart00855 PGAM Phosphoglycera  30.3      73  0.0016   20.3   3.0   19   45-63    113-131 (155)
 58 PF04445 SAM_MT:  Putative SAM-  30.1      20 0.00044   26.5   0.4   19   32-50    150-168 (234)
 59 TIGR03848 MSMEG_4193 probable   30.1      60  0.0013   21.9   2.7   18   46-63    115-132 (204)
 60 PRK12276 putative heme peroxid  30.0       2 4.4E-05   32.1  -4.9   37   36-72    155-197 (248)
 61 TIGR01258 pgm_1 phosphoglycera  29.9      72  0.0016   22.9   3.2   18   45-62    146-163 (245)
 62 PF00159 Hormone_3:  Pancreatic  29.8      94   0.002   17.0   2.9   20   39-58      3-22  (36)
 63 PRK10742 putative methyltransf  29.8      35 0.00076   25.6   1.6   19   32-50    163-181 (250)
 64 KOG2848|consensus               29.5      72  0.0016   24.6   3.3   41   25-67    215-257 (276)
 65 PRK14116 gpmA phosphoglyceromu  29.2      79  0.0017   22.2   3.2   19   44-62    146-164 (228)
 66 cd04661 MRP_L46 Mitochondrial   29.1      93   0.002   19.7   3.3   31   35-68     26-56  (132)
 67 PF01864 DUF46:  Putative integ  28.8      52  0.0011   23.4   2.3   20   53-72    156-175 (175)
 68 cd04927 ACT_ACR-like_2 Second   28.6 1.3E+02  0.0028   17.7   4.0   35   31-67     39-73  (76)
 69 PRK01112 phosphoglyceromutase;  28.6      65  0.0014   22.9   2.7   19   45-63    146-164 (228)
 70 cd01701 PolY_Rev1 DNA polymera  28.5      81  0.0018   24.2   3.4   34   35-68    148-183 (404)
 71 PF11058 Ral:  Antirestriction   28.5      47   0.001   20.4   1.7   24   44-67     37-60  (66)
 72 cd04693 Nudix_Hydrolase_34 Mem  28.4      77  0.0017   19.5   2.8   29   36-68     29-58  (127)
 73 PRK03609 umuC DNA polymerase V  28.3      86  0.0019   24.0   3.5   34   35-68    101-134 (422)
 74 smart00838 EFG_C Elongation fa  28.2      30 0.00065   20.6   0.9   29   39-67      2-30  (85)
 75 KOG4020|consensus               28.1      25 0.00054   26.9   0.5   16    1-16    218-233 (257)
 76 PRK15472 nucleoside triphospha  28.1      97  0.0021   19.5   3.3   31   35-68     31-61  (141)
 77 PRK08172 putative acyl carrier  28.0      42  0.0009   20.5   1.5   17   52-68      4-20  (82)
 78 PRK15004 alpha-ribazole phosph  27.5      71  0.0015   21.6   2.7   18   46-63    117-134 (199)
 79 PF01996 F420_ligase:  F420-0:G  27.3      54  0.0012   23.7   2.2   20   48-67    130-149 (228)
 80 TIGR02048 gshA_cyano glutamate  27.1 1.5E+02  0.0032   23.1   4.7   44    9-62    150-193 (376)
 81 COG2093 DNA-directed RNA polym  27.1      37  0.0008   21.0   1.1   11   58-68     44-54  (64)
 82 COG3914 Spy Predicted O-linked  27.1      46   0.001   28.3   2.0   28   39-70    532-559 (620)
 83 PRK14133 DNA polymerase IV; Pr  26.8      88  0.0019   23.2   3.3   32   35-68    103-134 (347)
 84 cd00424 PolY Y-family of DNA p  26.6      89  0.0019   23.1   3.3   34   35-68     99-134 (343)
 85 PRK14119 gpmA phosphoglyceromu  26.5      92   0.002   21.8   3.2   19   45-63    147-165 (228)
 86 cd02640 R3H_NRF R3H domain of   26.3      91   0.002   18.4   2.7   18   52-69     28-45  (60)
 87 cd01514 Elongation_Factor_C El  26.2      38 0.00082   19.7   1.0   28   40-67      1-28  (79)
 88 PF07687 M20_dimer:  Peptidase   25.9 1.4E+02   0.003   17.6   3.5   27   32-64     81-107 (111)
 89 PRK04013 argD acetylornithine/  25.7      61  0.0013   24.7   2.3   30   36-66    334-363 (364)
 90 PF05021 NPL4:  NPL4 family;  I  25.6      69  0.0015   24.6   2.6   40   32-72     21-63  (306)
 91 PTZ00272 heat shock protein 83  25.6      72  0.0016   27.2   2.9   24   46-69    649-672 (701)
 92 PRK02406 DNA polymerase IV; Va  25.5 1.9E+02  0.0042   21.3   4.9   34   35-68     95-129 (343)
 93 COG5636 Uncharacterized conser  25.3      29 0.00063   26.6   0.5   16    1-16    240-255 (284)
 94 PRK00745 4-oxalocrotonate taut  25.3 1.2E+02  0.0027   16.6   3.0   32   34-68      4-35  (62)
 95 PF15201 Rod_cone_degen:  Progr  25.1      17 0.00038   21.6  -0.6   13   51-63     17-29  (54)
 96 PRK14120 gpmA phosphoglyceromu  24.9   1E+02  0.0022   22.3   3.2   18   45-62    148-165 (249)
 97 cd04673 Nudix_Hydrolase_15 Mem  24.7 1.2E+02  0.0026   18.0   3.1   30   36-68     26-55  (122)
 98 PF14528 LAGLIDADG_3:  LAGLIDAD  24.6      84  0.0018   18.0   2.3   20   49-69     29-48  (77)
 99 PF00317 Ribonuc_red_lgN:  Ribo  24.6      81  0.0018   19.0   2.3   19   47-65     25-43  (83)
100 PRK07079 hypothetical protein;  24.6 1.5E+02  0.0032   22.8   4.2   26   33-64    328-353 (469)
101 PF00300 His_Phos_1:  Histidine  24.4      69  0.0015   19.7   2.0   18   46-63    118-135 (158)
102 PF08883 DOPA_dioxygen:  Dopa 4  24.4 1.2E+02  0.0026   19.9   3.3   25   34-66      3-27  (104)
103 cd04696 Nudix_Hydrolase_37 Mem  24.3   1E+02  0.0022   18.9   2.8   31   35-68     26-56  (125)
104 PRK01810 DNA polymerase IV; Va  23.8 1.1E+02  0.0023   23.3   3.3   34   35-68    107-140 (407)
105 PF08002 DUF1697:  Protein of u  23.8      82  0.0018   21.0   2.4   23   46-68     49-71  (137)
106 cd03425 MutT_pyrophosphohydrol  23.7 1.4E+02  0.0029   17.5   3.2   30   36-68     29-58  (124)
107 cd07983 LPLAT_DUF374-like Lyso  23.6 1.7E+02  0.0037   19.3   4.0   31   33-64    156-186 (189)
108 cd04689 Nudix_Hydrolase_30 Mem  23.5 1.4E+02  0.0031   18.2   3.3   30   36-68     24-53  (125)
109 PTZ00123 phosphoglycerate muta  23.3      94   0.002   22.0   2.8   17   45-61    134-150 (236)
110 CHL00124 acpP acyl carrier pro  22.9      95  0.0021   18.1   2.3   19   50-68      3-21  (82)
111 KOG0420|consensus               22.5      70  0.0015   23.4   2.0   16   48-63    157-172 (184)
112 PRK03858 DNA polymerase IV; Va  22.4      87  0.0019   23.5   2.6   34   35-68    100-134 (396)
113 PF13866 zf-SAP30:  SAP30 zinc-  22.3      62  0.0013   20.7   1.5   15   50-64     27-41  (78)
114 COG3480 SdrC Predicted secrete  22.3 1.2E+02  0.0027   24.1   3.4   39   23-61     68-106 (342)
115 cd04667 Nudix_Hydrolase_10 Mem  22.2 1.6E+02  0.0034   17.7   3.3   31   35-68     21-51  (112)
116 cd04682 Nudix_Hydrolase_23 Mem  22.2 1.5E+02  0.0033   18.1   3.3   31   35-68     29-59  (122)
117 PRK13463 phosphatase PhoE; Pro  21.8      99  0.0021   21.1   2.6   18   46-63    119-136 (203)
118 COG3688 Predicted RNA-binding   21.8 1.5E+02  0.0032   21.6   3.5   31   31-61     52-94  (173)
119 cd04680 Nudix_Hydrolase_21 Mem  21.8 1.6E+02  0.0035   17.5   3.3   31   36-69     24-54  (120)
120 PRK10546 pyrimidine (deoxy)nuc  21.7 1.6E+02  0.0035   18.0   3.4   31   35-68     30-60  (135)
121 PF02023 SCAN:  SCAN domain;  I  21.7 1.1E+02  0.0024   19.3   2.6   19   43-61     13-31  (95)
122 PF01520 Amidase_3:  N-acetylmu  21.4      77  0.0017   20.6   1.9   35   32-68     85-119 (175)
123 PF14223 UBN2:  gag-polypeptide  21.4      84  0.0018   19.4   2.0   21   43-63     36-56  (119)
124 cd00673 AlaRS_core Alanyl-tRNA  21.4      49  0.0011   24.8   1.0   25    1-29     85-109 (232)
125 PF02093 Gag_p30:  Gag P30 core  21.3      55  0.0012   24.3   1.3   30   28-63    124-153 (211)
126 CHL00130 rbcS ribulose-1,5-bis  21.3      94   0.002   21.8   2.4   21   37-63      9-29  (138)
127 PF02033 RBFA:  Ribosome-bindin  21.2      93   0.002   19.3   2.2   18   54-71     67-84  (104)
128 PRK02812 ribose-phosphate pyro  21.1      64  0.0014   24.7   1.6   37   27-67      1-43  (330)
129 PF07315 DUF1462:  Protein of u  20.8      61  0.0013   21.4   1.3   26   34-59     38-63  (93)
130 cd04664 Nudix_Hydrolase_7 Memb  20.7 1.2E+02  0.0025   18.7   2.5   31   35-68     28-58  (129)
131 PF03610 EIIA-man:  PTS system   20.5 1.3E+02  0.0029   18.7   2.8   19   45-63     35-53  (116)
132 cd03586 PolY_Pol_IV_kappa DNA   20.5 1.5E+02  0.0033   21.4   3.4   34   35-68     98-132 (334)
133 PF00817 IMS:  impB/mucB/samB f  20.4      92   0.002   20.2   2.1   21   48-68    112-132 (149)
134 cd04691 Nudix_Hydrolase_32 Mem  20.3 1.6E+02  0.0034   18.1   3.0   32   35-69     27-58  (117)
135 PRK09697 protein secretion pro  20.1      94   0.002   21.6   2.1   18   46-63    119-136 (139)
136 PF00679 EFG_C:  Elongation fac  20.1      14  0.0003   22.4  -1.8   29   39-67      3-31  (89)
137 PF01559 Zein:  Zein seed stora  20.1      87  0.0019   23.8   2.1   28   37-64     15-42  (246)

No 1  
>KOG2898|consensus
Probab=99.88  E-value=4.3e-23  Score=158.21  Aligned_cols=69  Identities=59%  Similarity=1.058  Sum_probs=67.5

Q ss_pred             ccccccccccCCChhHHHHHHHHhhcceeEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCccCCC
Q psy2758           4 ICRFGDAFWNSSKYSMTHYLYMMMTSWAIVADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus         4 ~~~fgD~fWns~~~s~~~yl~~lMTsW~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      .++|||+||||+++||.+|++++||||++|||||||||++|.++||+.+||+|||.+||+++|++++.|
T Consensus       251 ~~~~~~~f~~s~~~s~~~~l~~~~ts~~~v~~i~~l~~~~r~~~et~t~~a~~v~~~ig~~~gl~~~~~  319 (354)
T KOG2898|consen  251 DPRFGDAFWNSPELSFTRYLLELMTSWAIVCDIWYLPPMRRDNDETATQFANRVKSLIGKSAGLKDLEW  319 (354)
T ss_pred             CccccccccCCccccHHHHHHHHHhhhheeeeeeecccEEeecccchhHHHHHHHHHHHHhhCCcccCc
Confidence            478999999999999999999999999999999999999999999999999999999999999999987


No 2  
>PLN02833 glycerol acyltransferase family protein
Probab=99.82  E-value=1.9e-20  Score=143.25  Aligned_cols=70  Identities=50%  Similarity=0.825  Sum_probs=67.6

Q ss_pred             CccccccccccCCChhHHHHHHHHhhcceeEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCccCCC
Q psy2758           3 GICRFGDAFWNSSKYSMTHYLYMMMTSWAIVADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus         3 ~~~~fgD~fWns~~~s~~~yl~~lMTsW~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      .++.|+|+|||+.+.||+.|++++|++|+++|+|+||||+.++++|++.+||+|||++||+++|+.++||
T Consensus       275 y~~~~~~~fW~s~~~s~~~~l~~ll~~~~~~v~V~~LpPi~~~~~e~~~efA~rv~~~Ia~~lgi~~~~w  344 (376)
T PLN02833        275 YNKIFVDAFWNSRKQSFTMHLLRLMTSWAVVCDVWYLEPQTLRPGETPIEFAERVRDMIAKRAGLKKVPW  344 (376)
T ss_pred             ecCcccccccCCCCccHHHhHHHHhCCCceEEEEEECCCcCCCCCCCHHHHHHHHHHHHHHhcCCCCCCC
Confidence            4577899999999999999999999999999999999999999999999999999999999999999999


No 3  
>cd07991 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as lysophosphatidylcholine acyltransferase 1 (LPCAT-1),  glycerol-3-phosphate acyltransferase 3 (GPAT3), and similar sequences.
Probab=99.22  E-value=4.3e-11  Score=82.92  Aligned_cols=70  Identities=40%  Similarity=0.607  Sum_probs=64.4

Q ss_pred             CccccccccccCCChhHHHHHHHHhhcceeEEEEEEeCCccC-CCCCCHHHHHHHHHHHHHhhCCCccCCC
Q psy2758           3 GICRFGDAFWNSSKYSMTHYLYMMMTSWAIVADVWYLPPMFQ-GQGENAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus         3 ~~~~fgD~fWns~~~s~~~yl~~lMTsW~~V~dV~yLpp~~r-~~~E~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      |...+...+|++...+++.|+++++..+...++|.||||+.. .++|+..+|+++||++|++.+|+..++|
T Consensus       135 ~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~v~v~~l~pi~~~~~~~~~~~l~~~v~~~i~~~l~~~~~~~  205 (211)
T cd07991         135 YPNKFVDAFWNSSGYSSLMYLFRLLTQPANVLEVEFLPVYTPSEEGEDPKEFANRVRLIMANKLGLPATDW  205 (211)
T ss_pred             ecCccCCcccCCCCccHHHHHHHHhCCcceEEEEEECCCcccccCCCCHHHHHHHHHHHHHHhcCCCccCC
Confidence            455677889999888888999999999999999999999998 7899999999999999999999998876


No 4  
>PLN02499 glycerol-3-phosphate acyltransferase
Probab=98.07  E-value=4.7e-06  Score=67.06  Aligned_cols=43  Identities=19%  Similarity=0.196  Sum_probs=38.6

Q ss_pred             hhcceeEEEEEEeCCccCC----CCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          27 MTSWAIVADVWYLPPMFQG----QGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        27 MTsW~~V~dV~yLpp~~r~----~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +-.-..+|+|.|||++.++    .+++++||||+||.+||+++|.+-
T Consensus       412 ~mnP~p~y~v~fL~~~~~~~t~~~g~s~~evan~vQ~~la~~Lgfec  458 (498)
T PLN02499        412 FMNPRPVYEVTFLNQLPVEATCSSGKSPHDVANYVQRILAATLGFEC  458 (498)
T ss_pred             eecCCceEEEEEcCCCChhhccCCCCChHHHHHHHHHHHHHHhCCcc
Confidence            3366899999999999997    799999999999999999999763


No 5  
>PLN02588 glycerol-3-phosphate acyltransferase
Probab=97.95  E-value=1e-05  Score=65.53  Aligned_cols=43  Identities=21%  Similarity=0.159  Sum_probs=37.2

Q ss_pred             hhcceeEEEEEEeCCccC------CC---CCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          27 MTSWAIVADVWYLPPMFQ------GQ---GENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        27 MTsW~~V~dV~yLpp~~r------~~---~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +-.-.++|||.|||++.+      +.   +|+++||||+||..||+.+|.+-
T Consensus       452 l~nP~p~y~V~fL~~v~~~~e~~~~~p~~g~s~~evAn~VQ~~iA~~LG~e~  503 (525)
T PLN02588        452 LLNPFPSYTVQLLDPVSGSSSSTCQDPDNGKLKFEVANHVQHEIGNALGFEC  503 (525)
T ss_pred             EecCCceEEEEEcCcCCchhhhcccCcccCCChHHHHHHHHHHHHHhhCcee
Confidence            446688999999999997      31   69999999999999999999864


No 6  
>PLN02177 glycerol-3-phosphate acyltransferase
Probab=97.93  E-value=1.3e-05  Score=63.85  Aligned_cols=41  Identities=15%  Similarity=0.225  Sum_probs=37.5

Q ss_pred             cceeEEEEEEeCCccCCC----CCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          29 SWAIVADVWYLPPMFQGQ----GENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        29 sW~~V~dV~yLpp~~r~~----~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      .-..+++|.||||+.+++    ++++.|+||+||++||+++|.+-
T Consensus       427 ~p~~~y~V~fL~~l~~~~~~~~~~~~~evAn~Vq~~i~~~lg~~~  471 (497)
T PLN02177        427 NPRPTYEITFLNQLPKELTCKGGKSPIEVANYIQRVLAGTLGFEC  471 (497)
T ss_pred             CCCceEEEEECCCCChhhcccCCCCHHHHHHHHHHHHHHhhCcee
Confidence            568999999999999985    89999999999999999999764


No 7  
>KOG4666|consensus
Probab=84.51  E-value=0.97  Score=36.16  Aligned_cols=54  Identities=4%  Similarity=0.029  Sum_probs=43.7

Q ss_pred             ChhHHHHHHHHhhcceeEEEEEEeCCccCCCCC--CHHHHHHHHHHHHHhhCCCcc
Q psy2758          16 KYSMTHYLYMMMTSWAIVADVWYLPPMFQGQGE--NAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        16 ~~s~~~yl~~lMTsW~~V~dV~yLpp~~r~~~E--~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      ++.+++.+.-+.-...+++.++|+|...+.++|  ++.-||+.|+..+|.++|+..
T Consensus       128 ~~~~v~~~~~~~~~l~~~~~~~~i~~~~P~~ee~~d~~~~at~v~~~maealg~~v  183 (412)
T KOG4666|consen  128 RTVIVRSGRFLSRVLLFVFGFYWIHESCPDRDSDMDSNPKTTSTEINMAEALGTEV  183 (412)
T ss_pred             cchHHHHHHHHHHHHHhheeEEEEeccCCChhhhcCCcccchhHHHHHHHhhCCCC
Confidence            345666666666678899999999999985554  677899999999999999864


No 8  
>PHA03324 nuclear egress membrane protein UL34; Provisional
Probab=79.84  E-value=0.72  Score=35.06  Aligned_cols=18  Identities=17%  Similarity=0.362  Sum_probs=15.6

Q ss_pred             HHHHHHHHhhcceeEEEE
Q psy2758          19 MTHYLYMMMTSWAIVADV   36 (72)
Q Consensus        19 ~~~yl~~lMTsW~~V~dV   36 (72)
                      -..|++|+|+||+.|+|-
T Consensus        54 P~EYILrlM~swa~v~dp   71 (274)
T PHA03324         54 PAEYILEAMNSFLNIGEA   71 (274)
T ss_pred             cHHHHHHHHHhhhcCCCc
Confidence            378999999999998854


No 9  
>PLN02901 1-acyl-sn-glycerol-3-phosphate acyltransferase
Probab=74.53  E-value=5.8  Score=27.58  Aligned_cols=31  Identities=19%  Similarity=0.263  Sum_probs=26.8

Q ss_pred             EEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCC
Q psy2758          33 VADVWYLPPMFQGQGENAVEFASRVKRAISKQGG   66 (72)
Q Consensus        33 V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~g   66 (72)
                      -+.|.++||...   ++..++++.|++.|.++++
T Consensus       181 ~i~v~~~~pi~~---~~~~~l~~~~~~~i~~~~~  211 (214)
T PLN02901        181 SVKVVIHPPIEG---SDADELCNEARKVIAESLV  211 (214)
T ss_pred             eEEEEECCCcCC---CCHHHHHHHHHHHHHHHhh
Confidence            377999999985   5789999999999998765


No 10 
>PHA03323 nuclear egress membrane protein UL34; Provisional
Probab=74.04  E-value=1.3  Score=33.93  Aligned_cols=20  Identities=30%  Similarity=0.584  Sum_probs=16.5

Q ss_pred             hHHHHHHHHhhcceeE-EEEE
Q psy2758          18 SMTHYLYMMMTSWAIV-ADVW   37 (72)
Q Consensus        18 s~~~yl~~lMTsW~~V-~dV~   37 (72)
                      --+.|++|+|++|+-+ ||=|
T Consensus        59 fP~EYvlr~M~~wa~~~cdpy   79 (272)
T PHA03323         59 FPVEYVLRLMADWADVPCDPY   79 (272)
T ss_pred             ccHHHHHHHHHHHhcCCCCce
Confidence            3589999999999987 6643


No 11 
>PF06072 Herpes_US9:  Alphaherpesvirus tegument protein US9;  InterPro: IPR009278 This family consists of several US9 and related proteins from the Alphaherpesviruses. The function of the US9 protein is unknown although in Bovine herpesvirus 5 Us9 is essential for the anterograde spread of the virus from the olfactory mucosa to the bulb [].; GO: 0019033 viral tegument
Probab=73.58  E-value=2.8  Score=25.66  Aligned_cols=16  Identities=38%  Similarity=0.486  Sum_probs=13.5

Q ss_pred             cCCCCCCHHHHHHHHH
Q psy2758          43 FQGQGENAVEFASRVK   58 (72)
Q Consensus        43 ~r~~~E~~~eFA~RVk   58 (72)
                      +-.+||+|.+|-.||-
T Consensus         4 SESDnETA~~FL~RvG   19 (60)
T PF06072_consen    4 SESDNETATEFLRRVG   19 (60)
T ss_pred             CccccccHHHHHHHHh
Confidence            3468999999999984


No 12 
>PRK15018 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional
Probab=73.24  E-value=6  Score=28.61  Aligned_cols=33  Identities=21%  Similarity=0.293  Sum_probs=27.1

Q ss_pred             EEEEEEeCCccCCC--CCCHHHHHHHHHHHHHhhC
Q psy2758          33 VADVWYLPPMFQGQ--GENAVEFASRVKRAISKQG   65 (72)
Q Consensus        33 V~dV~yLpp~~r~~--~E~~~eFA~RVk~~IA~~~   65 (72)
                      ...|.++||....+  .++..+++++|+++|+++.
T Consensus       195 ~i~v~~~~PI~~~~~~~~~~~~l~~~v~~~i~~~~  229 (245)
T PRK15018        195 LVIVEMLPPIDVSQYGKDQVRELAAHCRSIMEQKI  229 (245)
T ss_pred             eEEEEEcCCCcCCCCChhhHHHHHHHHHHHHHHHH
Confidence            56799999999854  3667899999999999853


No 13 
>PF13559 DUF4129:  Domain of unknown function (DUF4129)
Probab=66.62  E-value=7.5  Score=21.91  Aligned_cols=17  Identities=24%  Similarity=0.350  Sum_probs=14.4

Q ss_pred             cCCCCCCHHHHHHHHHH
Q psy2758          43 FQGQGENAVEFASRVKR   59 (72)
Q Consensus        43 ~r~~~E~~~eFA~RVk~   59 (72)
                      .+.++||+.||+.|+..
T Consensus        16 ~~~~~~T~~E~~~~l~~   32 (72)
T PF13559_consen   16 PRRPSETPREYARRLAQ   32 (72)
T ss_pred             CCCCCcCHHHHHHHHHH
Confidence            45689999999999954


No 14 
>cd07984 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as lipid A biosynthesis lauroyl/myristoyl (LABLAT, HtrB) acyltransferases and similar proteins.
Probab=63.50  E-value=16  Score=23.90  Aligned_cols=33  Identities=18%  Similarity=0.226  Sum_probs=27.8

Q ss_pred             EEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCC
Q psy2758          34 ADVWYLPPMFQGQGENAVEFASRVKRAISKQGG   66 (72)
Q Consensus        34 ~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~g   66 (72)
                      +.|.+.+|....+.++..+.+.++.+.|.+...
T Consensus       146 ~~i~~~~~i~~~~~~~~~~~~~~~~~~lE~~i~  178 (192)
T cd07984         146 YRIEFEPPLENPPSEDVEEDTQRLNDALEAAIR  178 (192)
T ss_pred             EEEEEeCCCCCCCCCCHHHHHHHHHHHHHHHHH
Confidence            788899999887789999999999888876544


No 15 
>smart00545 JmjN Small domain found in the jumonji family of transcription factors. To date, this domain always co-occurs with the JmjC domain (although the reverse is not true).
Probab=60.42  E-value=3.4  Score=23.18  Aligned_cols=25  Identities=8%  Similarity=0.333  Sum_probs=20.9

Q ss_pred             CCCCCHHHHHHHHHHHHHhhCCCccC
Q psy2758          45 GQGENAVEFASRVKRAISKQGGLVDL   70 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~~~gl~~l   70 (72)
                      +|-+|+++|.++|.. +|++.|+..+
T Consensus        10 eEF~Dp~~yi~~i~~-~~~~yGi~KI   34 (42)
T smart00545       10 EEFKDPLAYISKIRP-QAEKYGICKV   34 (42)
T ss_pred             HHHHCHHHHHHHHHH-HHhhCCEEEE
Confidence            456799999999999 6999998754


No 16 
>PF02757 YLP:  YLP motif;  InterPro: IPR004019 The YLP motif is found in one or several copies in various Drosophila proteins. Its function is unknown, however the presence of completely conserved tyrosine residues and its presence in the human Erbb-2 and ErbB-4 receptor protein-tyrosine kinases (2.7.10.1 from EC) may suggest it could be a substrate for tyrosine kinases. ErbBs (1-4) are single-pass transmembrane proteins that activate a wide variety of signalling pathways, including those involved in proliferation, migration, differentiation, survival, and apoptosis; they are frequently misregulated in cancer []. ErbB-2 is an essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. ErbB-4 specifically binds and is activated by neuregulins, NRG-2, NRG-3, heparin-binding EGF-like growth factor, betacellulin and NTAK [].
Probab=57.80  E-value=4  Score=16.58  Aligned_cols=6  Identities=67%  Similarity=1.348  Sum_probs=4.9

Q ss_pred             EEeCCc
Q psy2758          37 WYLPPM   42 (72)
Q Consensus        37 ~yLpp~   42 (72)
                      .||||.
T Consensus         3 eYLpP~    8 (9)
T PF02757_consen    3 EYLPPV    8 (9)
T ss_pred             cccCCC
Confidence            589996


No 17 
>PF02824 TGS:  TGS domain;  InterPro: IPR004095  The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) []. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).  TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role []. ; PDB: 1WXQ_A 1NYR_B 1NYQ_B 2KMM_A 1WWT_A 1TKE_A 1TKG_A 1TJE_A 1QF6_A 1TKY_A ....
Probab=56.19  E-value=8.2  Score=22.28  Aligned_cols=28  Identities=21%  Similarity=0.437  Sum_probs=22.6

Q ss_pred             EeCCccC---CCCCCHHHHHHHHHHHHHhhC
Q psy2758          38 YLPPMFQ---GQGENAVEFASRVKRAISKQG   65 (72)
Q Consensus        38 yLpp~~r---~~~E~~~eFA~RVk~~IA~~~   65 (72)
                      |||+-+.   .++.++.+||..+.+.+|+++
T Consensus         4 ~lpdG~~~~~~~g~T~~d~A~~I~~~l~~~~   34 (60)
T PF02824_consen    4 YLPDGSIKELPEGSTVLDVAYSIHSSLAKRA   34 (60)
T ss_dssp             EETTSCEEEEETTBBHHHHHHHHSHHHHHCE
T ss_pred             ECCCCCeeeCCCCCCHHHHHHHHCHHHHhhe
Confidence            5666554   678999999999999999854


No 18 
>PF03732 Retrotrans_gag:  Retrotransposon gag protein ;  InterPro: IPR005162 Transposable elements (TEs) promote various chromosomal rearrangements more efficiently, and often more specifically, than other cellular processes. Retrotransposons are structurally similar to retroviruses and are bounded by long terminal repeats. This entry represents eukaryotic Gag or capsid-related retrotranspon-related proteins. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved.
Probab=55.86  E-value=15  Score=21.06  Aligned_cols=20  Identities=15%  Similarity=0.307  Sum_probs=17.5

Q ss_pred             CCCCHHHHHHHHHHHHHhhC
Q psy2758          46 QGENAVEFASRVKRAISKQG   65 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~~~   65 (72)
                      ++|+..+|.+|.++++....
T Consensus        59 ~~esv~~y~~rf~~l~~~~~   78 (96)
T PF03732_consen   59 GNESVREYVNRFRELARRAP   78 (96)
T ss_pred             cCCcHHHHHHHHHHHHHHCC
Confidence            79999999999988877655


No 19 
>cd08061 MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain. Npl4p (nuclear protein localization-4) is identical to Hmg-CoA reductase degradation 4 (HRD4) protein and contains a domain that is part of the pfam clan MPN/Mov34-like. Npl4 plays an intermediate role between endoplasmic reticulum-associated degradation (ERAD) substrate ubiquitylation and proteasomal degradation. Npl4p associates with Cdc48p (Cdc48 in yeast and p97 or valosin-containing protein (VCP) in higher eukaryotes), the highly conserved ATPase of the AAA family, via ubiquitin fusion degradation-1 protein (Ufd1p) to form a Cdc48p-Ufd1p-Npl4p complex which then functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation. This family of eukaryotic MPN-like domains lacks the key residues that coordinate a metal ion and therefore does not show catalytic isopeptidase activity.
Probab=54.80  E-value=14  Score=27.86  Aligned_cols=41  Identities=27%  Similarity=0.289  Sum_probs=27.7

Q ss_pred             eeEEEEEEeCCccCCCCC---CHHHHHHHHHHHHHhhCCCccCCC
Q psy2758          31 AIVADVWYLPPMFQGQGE---NAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus        31 ~~V~dV~yLpp~~r~~~E---~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      -.+++--|-|||.-.++.   .+.++.+.| ..||+.+||..+=|
T Consensus        55 ka~VeaIYEPPQ~~~~d~~~~l~d~~~~~v-d~iA~~lGL~~VG~   98 (274)
T cd08061          55 KAVVEAIYEPPQEGTPDGFELLEDPNADTV-DAIAAALGLERVGW   98 (274)
T ss_pred             EEEEEEEECCCccCCCCCeEEccchhhhHH-HHHHHHcCCeEEEE
Confidence            478899999999543211   012444555 78999999987644


No 20 
>COG3052 CitD Citrate lyase, gamma subunit [Energy production and conversion]
Probab=53.91  E-value=11  Score=25.08  Aligned_cols=20  Identities=30%  Similarity=0.732  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHhhCCCccCCC
Q psy2758          53 FASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus        53 FA~RVk~~IA~~~gl~~l~W   72 (72)
                      .-.||+.+.++.+|..+++|
T Consensus        75 l~AR~~Aav~RA~~~~~~~w   94 (98)
T COG3052          75 LRARVEAAVARAAGIPALPW   94 (98)
T ss_pred             HHHHHHHHHHHHccCCCCCh
Confidence            34689999999999999998


No 21 
>cd03527 RuBisCO_small Ribulose bisphosphate carboxylase/oxygenase (Rubisco), small subunit. Rubisco is a bifunctional enzyme catalyzes the initial steps of two opposing metabolic pathways: photosynthetic carbon fixation and the competing process of photorespiration. Rubisco Form I, present in plants and green algae, is composed of eight large and eight small subunits. The nearly identical small subunits are encoded by a family of nuclear genes. After translation, the small subunits are translocated across the chloroplast membrane, where an N-terminal signal peptide is cleaved off. While the large subunits contain the catalytic activities, it has been shown that the small subunits are important for catalysis by enhancing the catalytic rate through inducing conformational changes in the large subunits.
Probab=50.26  E-value=17  Score=23.84  Aligned_cols=21  Identities=33%  Similarity=0.584  Sum_probs=17.5

Q ss_pred             EEeCCccCCCCCCHHHHHHHHHHHHHh
Q psy2758          37 WYLPPMFQGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        37 ~yLpp~~r~~~E~~~eFA~RVk~~IA~   63 (72)
                      -||||++      ..|-++-|+.+|++
T Consensus         7 sylp~lt------~~~i~~QI~yll~q   27 (99)
T cd03527           7 SYLPPLT------DEQIAKQIDYIISN   27 (99)
T ss_pred             ccCCCCC------HHHHHHHHHHHHhC
Confidence            4899997      66788889998886


No 22 
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional
Probab=49.87  E-value=32  Score=21.74  Aligned_cols=37  Identities=8%  Similarity=0.037  Sum_probs=29.6

Q ss_pred             ceeEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          30 WAIVADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        30 W~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      =+.+++|......+   .|...+|+.++=+.+++++|+..
T Consensus        57 p~a~v~i~~~g~~~---~e~k~~l~~~i~~~l~~~lgi~~   93 (116)
T PTZ00397         57 GCCFVRVTSIGGIS---RSNNSSIAAAITKILASHLKVKS   93 (116)
T ss_pred             ceEEEEEEEecCCC---HHHHHHHHHHHHHHHHHHhCcCc
Confidence            46677888775543   57788999999999999999864


No 23 
>PF08410 DUF1737:  Domain of unknown function (DUF1737);  InterPro: IPR013619 This domain of unknown function is found at the N terminus of bacterial and viral hypothetical proteins. 
Probab=49.45  E-value=20  Score=21.25  Aligned_cols=17  Identities=29%  Similarity=0.593  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHHHHHHh
Q psy2758          47 GENAVEFASRVKRAISK   63 (72)
Q Consensus        47 ~E~~~eFA~RVk~~IA~   63 (72)
                      +.+..+|.+||-++|++
T Consensus        11 ~~d~~~fc~rVt~aL~~   27 (54)
T PF08410_consen   11 GPDDSAFCHRVTEALNE   27 (54)
T ss_pred             CCChHHHHHHHHHHHHc
Confidence            67888999999999987


No 24 
>PF00269 SASP:  Small, acid-soluble spore proteins, alpha/beta type;  InterPro: IPR001448 Small, acid-soluble spore proteins (SASP or ASSP) are proteins bound to the spore DNA of bacteria of the genera Bacillus, Thermoactynomycetes, and Clostridium [, ]. They are double-stranded DNA-binding proteins that cause DNA to change to an A-like conformation. They protect the DNA backbone from chemical and enzymatic cleavage and are thus involved in dormant spore's high resistance to UV light. SASP are degraded in the first minutes of spore germination and provide amino acids for both new protein synthesis and metabolism.  There are two distinct families of SASP: the alpha/beta type and the gamma- type. Alpha/beta SASP are small proteins of about sixty to seventy amino acid residues that are generally coded by a multigene family. The N terminus of alpha/beta SASP contains the site which is cleaved by a SASP- specific protease that acts during germination while the C terminus and is probably involved in DNA-binding.; GO: 0003690 double-stranded DNA binding, 0006265 DNA topological change; PDB: 2Z3X_B.
Probab=48.93  E-value=18  Score=21.47  Aligned_cols=21  Identities=29%  Similarity=0.332  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHhhCCCccC
Q psy2758          50 AVEFASRVKRAISKQGGLVDL   70 (72)
Q Consensus        50 ~~eFA~RVk~~IA~~~gl~~l   70 (72)
                      +.+--++.|-+||+++||.+.
T Consensus         8 a~~~Ld~lK~EiA~ElGv~~~   28 (61)
T PF00269_consen    8 AREALDQLKYEIAKELGVDNV   28 (61)
T ss_dssp             GHHHHHHHHHHHHHHHT---S
T ss_pred             HHHHHHHHHHHHHHHhCCCcc
Confidence            456678899999999998543


No 25 
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional
Probab=46.88  E-value=28  Score=22.22  Aligned_cols=32  Identities=22%  Similarity=0.324  Sum_probs=25.7

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +.|.+|.=..++||++.+=|.   .++.++.||..
T Consensus        31 ~~W~lPgG~ve~gEs~~~aa~---REl~EEtGl~~   62 (148)
T PRK09438         31 DFWQSVTGSLEEGETPAQTAI---REVKEETGIDV   62 (148)
T ss_pred             CcEeCCcccCCCCCCHHHHHH---HHHHHHhCcCc
Confidence            468899999999999887555   67888888764


No 26 
>PF10209 DUF2340:  Uncharacterized conserved protein (DUF2340);  InterPro: IPR018794  This entry consists of small proteins of approximately 150 amino acids whose function is unknown. 
Probab=46.14  E-value=27  Score=23.91  Aligned_cols=24  Identities=21%  Similarity=0.368  Sum_probs=21.9

Q ss_pred             CCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          46 QGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      .+.++.||..+|++.|..++|+.+
T Consensus        25 ~~~Tv~~l~~~v~~~I~t~~~~~P   48 (122)
T PF10209_consen   25 KDTTVKDLKEQVKQDIKTRPGLPP   48 (122)
T ss_pred             ccCcHHHHHHHHHHHHhcCCCCCC
Confidence            388999999999999999999965


No 27 
>TIGR02883 spore_cwlD N-acetylmuramoyl-L-alanine amidase CwlD. Members of this protein family are the CwlD family of N-acetylmuramoyl-L-alanine amidase. This family has been called the germination-specific N-acetylmuramoyl-L-alanine amidase. CwlD is required, along with the putative deactylase PdaA, to make muramic delta-lactam, a novel peptidoglycan constituent found only in spores. CwlD mutants show a germination defect.
Probab=46.07  E-value=40  Score=23.09  Aligned_cols=33  Identities=12%  Similarity=0.189  Sum_probs=25.2

Q ss_pred             eEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          32 IVADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      .-++|+|.+     ..+.+.++|+.++..|.+.++..+
T Consensus       101 ~G~ev~~~~-----~~~~s~~lA~~i~~~l~~~~~~~~  133 (189)
T TIGR02883       101 SGAQTFYYG-----NSEENKRLAKFIQDELRRNLDNTN  133 (189)
T ss_pred             CeEEEEEeC-----CCHHHHHHHHHHHHHHHHhcCcCC
Confidence            356788866     245778999999999998877643


No 28 
>PF08549 SWI-SNF_Ssr4:  Fungal domain of unknown function (DUF1750);  InterPro: IPR013859  This is a fungal protein of unknown function. 
Probab=45.40  E-value=17  Score=31.11  Aligned_cols=23  Identities=26%  Similarity=0.232  Sum_probs=19.4

Q ss_pred             CccCCCCCCHHHHHHHHHHHHHh
Q psy2758          41 PMFQGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        41 p~~r~~~E~~~eFA~RVk~~IA~   63 (72)
                      ...|.+-|-++||++||.+-||.
T Consensus       353 ~~gkLdp~~aeeF~kRV~~~ia~  375 (669)
T PF08549_consen  353 YVGKLDPGKAEEFRKRVAKKIAD  375 (669)
T ss_pred             cccCCCHHHHHHHHHHHHHHHHH
Confidence            35677888999999999998876


No 29 
>PF07485 DUF1529:  Domain of Unknown Function (DUF1259);  InterPro: IPR011094 This family is the lppY/lpqO homologue family. They are related to 'probable conserved lipoproteins' LppY and LpqO from Mycobacterium bovis. 
Probab=45.30  E-value=18  Score=24.38  Aligned_cols=19  Identities=16%  Similarity=0.193  Sum_probs=16.1

Q ss_pred             CCCCCCHHHHHHHHHHHHH
Q psy2758          44 QGQGENAVEFASRVKRAIS   62 (72)
Q Consensus        44 r~~~E~~~eFA~RVk~~IA   62 (72)
                      -...++|..||++||+++.
T Consensus       103 ~~~~gdp~~lA~~vr~Ald  121 (123)
T PF07485_consen  103 IWGVGDPAKLARKVRAALD  121 (123)
T ss_pred             EEecCCHHHHHHHHHHHHh
Confidence            3457899999999999875


No 30 
>PF00183 HSP90:  Hsp90 protein;  InterPro: IPR001404 Molecular chaperones, or heat shock proteins (Hsps) are ubiquitous proteins that act to maintain proper protein folding within the cell []. They assist in the folding of nascent polypeptide chains, and are also involved in the re-folding of denatured proteins following proteotoxic stress. As their name implies, the heat shock proteins were first identified as proteins that were up-regulated under conditions of elevated temperature. However, subsequent studies have shown that increased Hsp expression is induced by a variety of cellular stresses, including oxidative stress and inflammation. Five major Hsp families have been determined, and are categorized according to their molecular size (Hsp100, Hsp90, Hsp70, Hsp60, and the small Hsps). Hsps are involved in a variety of cellular processes that are ATP-dependent. These include: prevention of protein aggregation, protein degradation, protein trafficking, and maintenance of signalling proteins in a conformation that permits activation. Hsp90 chaperones are unique in their ability to regulate a specific subset of cellular signalling proteins that have been implicated in disease processes, including intracellular protein kinases, steroid hormone receptors, and growth factor receptors [].; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding, 0006950 response to stress; PDB: 3K99_D 2H55_A 3RLP_A 1OSF_A 3R4M_A 1YES_A 1UY9_A 3FT8_A 2YE2_A 2QF6_A ....
Probab=44.92  E-value=23  Score=28.82  Aligned_cols=23  Identities=26%  Similarity=0.410  Sum_probs=18.5

Q ss_pred             CCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          47 GENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        47 ~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      -+++..||+||-.+|...+|+..
T Consensus       477 l~dp~~F~~Ri~~lL~~~l~~~~  499 (531)
T PF00183_consen  477 LEDPAAFAKRINKLLEKSLGVDP  499 (531)
T ss_dssp             -SSHHHHHHHHHHHHHHTTC--S
T ss_pred             cccHHHHHHHHHHHHHHhcCCCc
Confidence            46899999999999999999853


No 31 
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase. Members of this protein family include the known CobC protein of Salmonella and Eschichia coli species, and homologous proteins found in cobalamin biosynthesis regions in other bacteria. This protein is alpha-ribazole phosphatase (EC 3.1.3.73) and, like many phosphatases, can be closely related in sequence to other phosphatases with different functions. Close homologs excluded from this model include proteins with duplications, so this model is built in -g mode to suppress hits to those proteins.
Probab=43.37  E-value=29  Score=22.58  Aligned_cols=18  Identities=28%  Similarity=0.484  Sum_probs=15.9

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      .+|+..+|.+||++.+.+
T Consensus       113 ~gEs~~~~~~R~~~~~~~  130 (177)
T TIGR03162       113 GGESFADFYQRVSEFLEE  130 (177)
T ss_pred             CCCCHHHHHHHHHHHHHH
Confidence            589999999999988765


No 32 
>PF05093 CIAPIN1:  Cytokine-induced anti-apoptosis inhibitor 1, Fe-S biogenesis;  InterPro: IPR007785 Anamorsin, subsequently named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1, in humans is the homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis. It is found in both the cytoplasm and in the mitochondrial intermembrane space (IMS) []. CIAPIN1 is found to be up-regulated in hepatocellular cancer, is considered to be a downstream effector of the receptor tyrosine kinase-Ras signalling pathway, and is essential in mouse definitive haematopoiesis [].  In addition, it has also anti-apoptotic effects in the cell. It is involved in negative control of cell death upon cytokine withdrawal and promotes development of hematopoietic cells []. 
Probab=40.83  E-value=12  Score=24.80  Aligned_cols=14  Identities=50%  Similarity=1.113  Sum_probs=12.0

Q ss_pred             CCccccccccccCC
Q psy2758           2 CGICRFGDAFWNSS   15 (72)
Q Consensus         2 ~~~~~fgD~fWns~   15 (72)
                      ||+-.+||||==++
T Consensus        70 CGsC~LGDAFRCa~   83 (100)
T PF05093_consen   70 CGSCYLGDAFRCAG   83 (100)
T ss_pred             cccccccccceecC
Confidence            99999999996554


No 33 
>PF03090 Replicase:  Replicase family;  InterPro: IPR004322 This is a family of bacterial plasmid DNA replication initiator proteins. These RepA proteins exist as monomers and dimers in equilibrium: monomers bind directly to repeated DNA sequences and thus activate replication; dimers repress repA transcription by binding an inversely repeated DNA operator. Dimer dissociation can occur spontaneously or may be mediated by Hsp70 chaperones. A similar RepA family of proteins found mainly in Escherichia coli is involved in plasmid replication (see IPR000525 from INTERPRO).
Probab=38.69  E-value=52  Score=22.32  Aligned_cols=33  Identities=24%  Similarity=0.528  Sum_probs=25.3

Q ss_pred             EEEEE-eC-CccCCC--CCCHHHHHHHHHHHHHhhCC
Q psy2758          34 ADVWY-LP-PMFQGQ--GENAVEFASRVKRAISKQGG   66 (72)
Q Consensus        34 ~dV~y-Lp-p~~r~~--~E~~~eFA~RVk~~IA~~~g   66 (72)
                      |.+.| |. |+.+.+  ..-|++++.+|++.+.+++|
T Consensus        63 aHl~y~L~~PV~~t~~ar~kpl~ylaav~~~L~~~L~   99 (137)
T PF03090_consen   63 AHLIYALDAPVCTTENARSKPLRYLAAVERALTRKLG   99 (137)
T ss_pred             EEEEEEECCcEeeCccccchHHHHHHHHHHHHHHHhC
Confidence            44444 77 887744  45689999999999999887


No 34 
>PF14740 DUF4471:  Domain of unknown function (DUF4471)
Probab=38.69  E-value=26  Score=26.75  Aligned_cols=44  Identities=23%  Similarity=0.420  Sum_probs=31.1

Q ss_pred             HHHHhhcce-eEEEE-EEeCCccCCCCCCHHHHHHHHHHHHHhhCCCccC
Q psy2758          23 LYMMMTSWA-IVADV-WYLPPMFQGQGENAVEFASRVKRAISKQGGLVDL   70 (72)
Q Consensus        23 l~~lMTsW~-~V~dV-~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~l   70 (72)
                      |..+|..=+ +|++- .||-+.+   .|.-.+|+++|++ +|+++|++..
T Consensus       240 l~~~~a~~A~LvvEtaKfmvdLr---KEq~~~F~~kv~e-LA~~aG~~p~  285 (289)
T PF14740_consen  240 LFQALAPDAVLVVETAKFMVDLR---KEQLQEFVKKVKE-LAKAAGFKPV  285 (289)
T ss_pred             HHHHhCCCCEEEEEcchhheeCC---HHHHHHHHHHHHH-HHHHCCCccc
Confidence            344444443 45565 5887777   6778999999975 6889998764


No 35 
>COG3399 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.46  E-value=17  Score=25.57  Aligned_cols=30  Identities=27%  Similarity=0.287  Sum_probs=24.3

Q ss_pred             EEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhC
Q psy2758          33 VADVWYLPPMFQGQGENAVEFASRVKRAISKQG   65 (72)
Q Consensus        33 V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~   65 (72)
                      ..||--||.+++.-+   +||+|.+++.|+.++
T Consensus        24 Ffdv~vl~vvkk~~~---~e~~n~~~~~~s~ra   53 (148)
T COG3399          24 FFDVLVLSVVKKGRV---EEARNEVEKAMSYRA   53 (148)
T ss_pred             HHheeehhhhhhcch---hhhhhHHHhhhhhhh
Confidence            479999999998755   688888888888764


No 36 
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only]
Probab=36.97  E-value=50  Score=22.17  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=16.5

Q ss_pred             CCCHHHHHHHHHHHHHhh
Q psy2758          47 GENAVEFASRVKRAISKQ   64 (72)
Q Consensus        47 ~E~~~eFA~RVk~~IA~~   64 (72)
                      +|+..+|+.||...|++-
T Consensus       122 gEs~~~~~~R~~~~~~~~  139 (208)
T COG0406         122 GESLADVSKRVVAALAEL  139 (208)
T ss_pred             CCCHHHHHHHHHHHHHHH
Confidence            899999999999998874


No 37 
>PRK03352 DNA polymerase IV; Validated
Probab=36.24  E-value=45  Score=24.66  Aligned_cols=30  Identities=20%  Similarity=0.310  Sum_probs=23.1

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||..-.    .++.++|+++|+.|+++.|+.
T Consensus       109 De~~ld~t~----~~~~~la~~ir~~i~~~~gl~  138 (346)
T PRK03352        109 DEAFLGVDT----DDPEALAEEIRAAVLERTGLS  138 (346)
T ss_pred             ccEEEeCCC----CCHHHHHHHHHHHHHHHHCCC
Confidence            445554442    388999999999999998875


No 38 
>smart00646 Ami_3 Ami_3.
Probab=36.14  E-value=96  Score=19.01  Aligned_cols=35  Identities=23%  Similarity=0.303  Sum_probs=25.7

Q ss_pred             EEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          33 VADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        33 V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      -.+|+|.++-..  .....++|+.++..+.+..|+.+
T Consensus        27 G~~v~~~~~~~~--~~~~~~la~~i~~~l~~~~~~~~   61 (113)
T smart00646       27 GFEVYYYSDKGA--IRESRALASIIQKSLVKNTGLRD   61 (113)
T ss_pred             EEEEEEECCCCC--chHHHHHHHHHHHHHHHhcCCCC
Confidence            577888655421  24577899999999999887654


No 39 
>PRK14118 gpmA phosphoglyceromutase; Provisional
Probab=35.76  E-value=42  Score=23.60  Aligned_cols=19  Identities=21%  Similarity=0.018  Sum_probs=16.0

Q ss_pred             CCCCCHHHHHHHHHHHHHh
Q psy2758          45 GQGENAVEFASRVKRAISK   63 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~   63 (72)
                      ..+|+..+|.+||++.|.+
T Consensus       146 p~GEs~~~~~~Rv~~~l~~  164 (227)
T PRK14118        146 PDAENLKVTLERVLPFWED  164 (227)
T ss_pred             CCCCCHHHHHHHHHHHHHH
Confidence            3699999999999987754


No 40 
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=35.60  E-value=61  Score=19.30  Aligned_cols=31  Identities=29%  Similarity=0.489  Sum_probs=22.3

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      +.|.||--...++|++++=|   +.++.++.|+.
T Consensus        25 ~~w~lPgG~v~~~E~~~~aa---~REl~EE~Gl~   55 (129)
T cd04676          25 GLWALPGGAVEPGESPADTA---VREVREETGLD   55 (129)
T ss_pred             CcEECCeeccCCCCCHHHHH---HHHHHHHhCce
Confidence            56888887889999987444   45666666653


No 41 
>TIGR00824 EIIA-man PTS system, mannose/fructose/sorbose family, IIA component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains.The Man family is unique in several respects among PTS permease families It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine, N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the IIA components.
Probab=35.29  E-value=49  Score=21.20  Aligned_cols=20  Identities=25%  Similarity=0.317  Sum_probs=17.5

Q ss_pred             CCCCCCHHHHHHHHHHHHHh
Q psy2758          44 QGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        44 r~~~E~~~eFA~RVk~~IA~   63 (72)
                      -.+++++.+|.+|++++|.+
T Consensus        35 ~~~~~~~~~~~~~l~~~i~~   54 (116)
T TIGR00824        35 FVPGENAETLQEKYNAALAD   54 (116)
T ss_pred             cCCCcCHHHHHHHHHHHHHh
Confidence            45589999999999999986


No 42 
>cd02636 R3H_sperm-antigen R3H domain of a group of metazoan proteins that is related to the sperm-associated antigen 7. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=35.13  E-value=47  Score=20.19  Aligned_cols=18  Identities=11%  Similarity=0.337  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHhhCCCcc
Q psy2758          52 EFASRVKRAISKQGGLVD   69 (72)
Q Consensus        52 eFA~RVk~~IA~~~gl~~   69 (72)
                      .|-.+|-.-+|+.+||.+
T Consensus        27 ~~eRkivHDv~~~~Gl~S   44 (61)
T cd02636          27 KVERSIVHDVAEVAGLTS   44 (61)
T ss_pred             HHHHHHHHHHHHhcCcee
Confidence            678899999999999975


No 43 
>PRK03348 DNA polymerase IV; Provisional
Probab=34.89  E-value=1e+02  Score=24.22  Aligned_cols=34  Identities=24%  Similarity=0.413  Sum_probs=26.5

Q ss_pred             EEEEeCCccCC--CCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQG--QGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~--~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||.+....  ..+++.++|.++|+.|.++.||.
T Consensus       106 DE~flD~~~l~~~~~~~~~~~a~~lr~~I~~~~Gl~  141 (454)
T PRK03348        106 DEAFVEPAELAGASAEEVEAFAERLRARVREETGLP  141 (454)
T ss_pred             CeEEEEccccccccCCCHHHHHHHHHHHHHHHHCCC
Confidence            66677755442  34588999999999999999985


No 44 
>PF00101 RuBisCO_small:  Ribulose bisphosphate carboxylase, small chain;  InterPro: IPR000894 RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) is a bifunctional enzyme that catalyses both the carboxylation and oxygenation of ribulose-1,5-bisphosphate (RuBP) [], thus fixing carbon dioxide as the first step of the Calvin cycle. RuBisCO is the major protein in the stroma of chloroplasts, and in higher plants exists as a complex of 8 large and 8 small subunits. The function of the small subunit is unknown []. While the large subunit is coded for by a single gene, the small subunit is coded for by several different genes, which are distributed in a tissue specific manner. They are transcriptionally regulated by light receptor phytochrome [], which results in RuBisCO being more abundant during the day when it is required. The RuBisCo small subunit consists of a central four-stranded beta-sheet, with two helices packed against it [].; PDB: 1BWV_W 1IWA_P 3AXM_X 1WDD_S 3AXK_T 1IR2_K 1RBL_N 1UZH_J 1RSC_P 1UW9_C ....
Probab=34.71  E-value=33  Score=22.29  Aligned_cols=20  Identities=40%  Similarity=0.727  Sum_probs=15.1

Q ss_pred             EeCCccCCCCCCHHHHHHHHHHHHHh
Q psy2758          38 YLPPMFQGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        38 yLpp~~r~~~E~~~eFA~RVk~~IA~   63 (72)
                      ||||++      ..|.++.|+.+|++
T Consensus         7 ~lP~l~------~~~i~~Qv~~ll~q   26 (99)
T PF00101_consen    7 YLPPLT------DEEIAKQVRYLLSQ   26 (99)
T ss_dssp             TSS---------HHHHHHHHHHHHHT
T ss_pred             cCCCCC------HHHHHHHHHhhhhc
Confidence            788886      78899999999987


No 45 
>PF13776 DUF4172:  Domain of unknown function (DUF4172)
Probab=34.68  E-value=34  Score=21.60  Aligned_cols=13  Identities=31%  Similarity=0.585  Sum_probs=11.0

Q ss_pred             HHHHHHHHhhCCC
Q psy2758          55 SRVKRAISKQGGL   67 (72)
Q Consensus        55 ~RVk~~IA~~~gl   67 (72)
                      .-|++-||+++||
T Consensus        70 ~sVrSSiarrLGl   82 (82)
T PF13776_consen   70 DSVRSSIARRLGL   82 (82)
T ss_pred             HHHHHHHHHHcCC
Confidence            3499999999996


No 46 
>PF10820 DUF2543:  Protein of unknown function (DUF2543);  InterPro: IPR020251 This entry contains proteins with no known function.
Probab=34.45  E-value=37  Score=21.76  Aligned_cols=21  Identities=14%  Similarity=0.416  Sum_probs=16.9

Q ss_pred             CHHHHHHHHHHHHHhhCCCcc
Q psy2758          49 NAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        49 ~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +.+|-+.--|+.+|.++|+..
T Consensus        45 nneeIsEeaQ~EMA~eAgi~~   65 (81)
T PF10820_consen   45 NNEEISEEAQQEMASEAGIDE   65 (81)
T ss_pred             ccHhhhHHHHHHHHHHcCCcH
Confidence            356677788999999999864


No 47 
>cd01700 PolY_Pol_V_umuC umuC subunit of DNA Polymerase V. umuC subunit of Pol V.   Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits.  Translesion synthesis is a process that allows the bypass of a variety of DNA lesions.  TLS polymerases lack proofreading activity and have low fidelity and low processivity.  They use damaged DNA as templates and insert nucleotides opposite the lesions.  Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.
Probab=33.62  E-value=48  Score=24.47  Aligned_cols=34  Identities=21%  Similarity=0.219  Sum_probs=26.4

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||+.-.-....++.++|+++|+.|.++.|+.
T Consensus        99 De~~ldvt~~~~~~~~~~la~~i~~~i~~~~gl~  132 (344)
T cd01700          99 DESFLDLTGSLRFGDLEELARKIRRRILQETGIP  132 (344)
T ss_pred             chhhccCcCCCCCCCHHHHHHHHHHHHHHHhCCc
Confidence            4457776544336789999999999999999875


No 48 
>PTZ00130 heat shock protein 90; Provisional
Probab=33.31  E-value=45  Score=29.10  Aligned_cols=24  Identities=21%  Similarity=0.270  Sum_probs=19.9

Q ss_pred             CCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          46 QGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      .-|+|.+||+|+..+|+..+|+..
T Consensus       737 ~l~DP~~fa~ri~~ll~~~l~~~~  760 (814)
T PTZ00130        737 DLEDTADLAQIVYDHINQKLGVDN  760 (814)
T ss_pred             CCCCHHHHHHHHHHHHHHhcCCCc
Confidence            357889999999999998888753


No 49 
>PRK13462 acid phosphatase; Provisional
Probab=32.55  E-value=51  Score=22.83  Aligned_cols=18  Identities=28%  Similarity=0.492  Sum_probs=16.1

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      .+|+..+|..||++.+..
T Consensus       115 ~gES~~~~~~Rv~~~l~~  132 (203)
T PRK13462        115 GGESVAQVNERADRAVAL  132 (203)
T ss_pred             CCccHHHHHHHHHHHHHH
Confidence            699999999999888765


No 50 
>PRK03482 phosphoglycerate mutase; Provisional
Probab=32.53  E-value=63  Score=22.02  Aligned_cols=19  Identities=26%  Similarity=0.492  Sum_probs=16.1

Q ss_pred             CCCCCHHHHHHHHHHHHHh
Q psy2758          45 GQGENAVEFASRVKRAISK   63 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~   63 (72)
                      ..+|+-.+|.+||+..+.+
T Consensus       117 p~gEs~~~~~~Rv~~~l~~  135 (215)
T PRK03482        117 PEGESMQELSDRMHAALES  135 (215)
T ss_pred             CCCccHHHHHHHHHHHHHH
Confidence            4589999999999987754


No 51 
>PRK09565 hypothetical protein; Reviewed
Probab=31.79  E-value=3.8  Score=33.99  Aligned_cols=36  Identities=31%  Similarity=0.641  Sum_probs=27.5

Q ss_pred             EE-eCCccCC-----CCCCHHHHHHHHHHHHHhhCCCccCCC
Q psy2758          37 WY-LPPMFQG-----QGENAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus        37 ~y-Lpp~~r~-----~~E~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      || ||+..|+     =++...+||.+|++.|+-.-||.+-.|
T Consensus       166 WYlLp~eERr~mM~eHG~iGR~YagkV~q~ItgSfGLDDyEW  207 (533)
T PRK09565        166 WYDLPFDERAEHMSSHGDIGRQYAGKVTQIIAGSIGFDDWEW  207 (533)
T ss_pred             cccCCHHHHHHHHHHHHHHhccCcchhhhheeccccccceeE
Confidence            67 5555542     256777899999999999999988776


No 52 
>PRK09184 acyl carrier protein; Provisional
Probab=31.45  E-value=56  Score=20.42  Aligned_cols=18  Identities=11%  Similarity=0.128  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHhhCCCc
Q psy2758          51 VEFASRVKRAISKQGGLV   68 (72)
Q Consensus        51 ~eFA~RVk~~IA~~~gl~   68 (72)
                      .+.-.+||++||+++|+.
T Consensus         5 ~~l~~~l~~~I~e~l~~~   22 (89)
T PRK09184          5 TALERELAELIVEELNLE   22 (89)
T ss_pred             HHHHHHHHHHHHHHHCCC
Confidence            456789999999999974


No 53 
>cd07992 LPLAT_AAK14816-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are uncharacterized glycerol-3-phosphate acyltransferases such as the Plasmodium falciparum locus AAK14816 putative acyltransferase, and similar proteins.
Probab=31.00  E-value=52  Score=22.28  Aligned_cols=30  Identities=20%  Similarity=-0.006  Sum_probs=24.2

Q ss_pred             eEEEEEEeCCccCCCCCCHHHHHHHHHHHH
Q psy2758          32 IVADVWYLPPMFQGQGENAVEFASRVKRAI   61 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E~~~eFA~RVk~~I   61 (72)
                      .-+.|.+.+|+...+.+++++.-.+++.++
T Consensus       166 ~~i~i~~g~pi~~~~~~~~~~~~~~~~~~~  195 (203)
T cd07992         166 SRVLVEFGKPISVSAFEEAEASRDVEKKLI  195 (203)
T ss_pred             CeEEEEECCCcccccccccccchhHHHHHH
Confidence            457899999999999998887777777655


No 54 
>cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are uncharacterized phospholipid/glycerol acyltransferases such as the Pectobacterium carotovorum subsp. carotovorum PC1 locus ACT14924 putative acyltransferase, and similar proteins.
Probab=30.92  E-value=46  Score=22.88  Aligned_cols=30  Identities=17%  Similarity=0.083  Sum_probs=24.1

Q ss_pred             eeEEEEEEeCCccCCC---CCCHHHHHHHHHHH
Q psy2758          31 AIVADVWYLPPMFQGQ---GENAVEFASRVKRA   60 (72)
Q Consensus        31 ~~V~dV~yLpp~~r~~---~E~~~eFA~RVk~~   60 (72)
                      ...+.|.++||+...+   .|+..|+++.||+.
T Consensus       176 ~~~v~v~~g~pI~~~~~~~~~~~~~l~~~~~~~  208 (210)
T cd07986         176 GKTIRIRVGRPIPPEELARFEDAEELADFLRLH  208 (210)
T ss_pred             CCEEEEEeCCcCCHHHHhcCCCHHHHHHHHHHh
Confidence            3568999999997633   67899999999873


No 55 
>cd02696 MurNAc-LAA N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs
Probab=30.41  E-value=1.2e+02  Score=19.79  Aligned_cols=32  Identities=25%  Similarity=0.470  Sum_probs=23.5

Q ss_pred             EEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          34 ADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        34 ~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +.|+|-+.-    .+.+.++|+++...+++.+++.+
T Consensus        88 ~~v~~~~~~----~~~s~~lA~~l~~~l~~~~~~~~  119 (172)
T cd02696          88 AEVYYYSGS----SEESKRLAEAIQKELVKALGLRN  119 (172)
T ss_pred             EEEEEECCC----chHHHHHHHHHHHHHHHhcCCCC
Confidence            456555432    36788999999999999986543


No 56 
>PRK14115 gpmA phosphoglyceromutase; Provisional
Probab=30.36  E-value=63  Score=23.24  Aligned_cols=20  Identities=15%  Similarity=-0.087  Sum_probs=16.3

Q ss_pred             cCCCCCCHHHHHHHHHHHHH
Q psy2758          43 FQGQGENAVEFASRVKRAIS   62 (72)
Q Consensus        43 ~r~~~E~~~eFA~RVk~~IA   62 (72)
                      ....+|+-.+|..||.+.|-
T Consensus       144 ~~p~GES~~~~~~Rv~~~l~  163 (247)
T PRK14115        144 ELPLTESLKDTIARVLPYWN  163 (247)
T ss_pred             CCCCCCcHHHHHHHHHHHHH
Confidence            34569999999999988663


No 57 
>smart00855 PGAM Phosphoglycerate mutase family. Phosphoglycerate mutase (PGAM) and bisphosphoglycerate mutase (BPGM) are structurally related enzymes that catalyse reactions involving the transfer of phospho groups between the three carbon atoms of phosphoglycerate PUBMED:2847721, PUBMED:2831102, PUBMED:10958932. Both enzymes can catalyse three different reactions with different specificities, the isomerization of 2-phosphoglycerate (2-PGA) to 3-phosphoglycerate (3-PGA) with 2,3-diphosphoglycerate (2,3-DPG) as the primer of the reaction, the synthesis of 2,3-DPG from 1,3-DPG with 3-PGA as a primer and the degradation of 2,3-DPG to 3-PGA (phosphatase activity). In mammals, PGAM is a dimeric protein with two isoforms, the M (muscle) and B (brain) forms. In yeast, PGAM is a tetrameric protein.
Probab=30.29  E-value=73  Score=20.26  Aligned_cols=19  Identities=26%  Similarity=0.468  Sum_probs=16.3

Q ss_pred             CCCCCHHHHHHHHHHHHHh
Q psy2758          45 GQGENAVEFASRVKRAISK   63 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~   63 (72)
                      ..+|+..+|..||++.+..
T Consensus       113 ~~gEs~~~~~~Rv~~~~~~  131 (155)
T smart00855      113 PGGESLADVVERLVRALEE  131 (155)
T ss_pred             cCCCCHHHHHHHHHHHHHH
Confidence            3599999999999888765


No 58 
>PF04445 SAM_MT:  Putative SAM-dependent methyltransferase;  InterPro: IPR007536 This family of proteins is functionally uncharacterised.; PDB: 2PGX_A 2OYR_A 2R6Z_A 2PKW_A.
Probab=30.10  E-value=20  Score=26.53  Aligned_cols=19  Identities=37%  Similarity=0.550  Sum_probs=8.3

Q ss_pred             eEEEEEEeCCccCCCCCCH
Q psy2758          32 IVADVWYLPPMFQGQGENA   50 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E~~   50 (72)
                      ..+||-||.||.+...+++
T Consensus       150 ~s~DVVY~DPMFp~~~ksa  168 (234)
T PF04445_consen  150 NSFDVVYFDPMFPERKKSA  168 (234)
T ss_dssp             S--SEEEE--S-----TTT
T ss_pred             CCCCEEEECCCCCCccccc
Confidence            5789999999999877665


No 59 
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family. A three-gene system broadly conserved among the Actinobacteria includes MSMEG_4193 and homologs, a subgroup among the larger phosphoglycerate mutase family protein (pfam00300). Another member of the trio is a probable kinase, related to phosphatidylinositol kinases; that context supports the hypothesis that this protein acts as a phosphomutase.
Probab=30.07  E-value=60  Score=21.94  Aligned_cols=18  Identities=22%  Similarity=0.385  Sum_probs=15.4

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      .+|+-.+|..||...|.+
T Consensus       115 ~gEs~~~~~~R~~~~l~~  132 (204)
T TIGR03848       115 GGESLAQVQARAVAAVRE  132 (204)
T ss_pred             CCCCHHHHHHHHHHHHHH
Confidence            599999999998887654


No 60 
>PRK12276 putative heme peroxidase; Provisional
Probab=29.96  E-value=2  Score=32.09  Aligned_cols=37  Identities=32%  Similarity=0.608  Sum_probs=26.7

Q ss_pred             EEE-eCCccCC-----CCCCHHHHHHHHHHHHHhhCCCccCCC
Q psy2758          36 VWY-LPPMFQG-----QGENAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus        36 V~y-Lpp~~r~-----~~E~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      =|| ||+..|+     =++.+.+|+.+|++.|...-||.|-.|
T Consensus       155 nWYlLp~eeR~~mM~eHg~~gr~y~~~V~q~tt~SfGldD~EW  197 (248)
T PRK12276        155 NWYMLPMEERQKLMYSHGMIGRKYAGKVKQIITGSVGFDDWEW  197 (248)
T ss_pred             CcccCCHHHHHHHHHHHHHHhhhCCCceeeeeeecccccceeE
Confidence            456 5555552     245677899889999999989888666


No 61 
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1. Most members of this family are phosphoglycerate mutase (EC 5.4.2.1). This enzyme interconverts 2-phosphoglycerate and 3-phosphoglycerate. The enzyme is transiently phosphorylated on an active site histidine by 2,3-diphosphoglyerate, which is both substrate and product. Some members of this family have are phosphoglycerate mutase as a minor activity and act primarily as a bisphoglycerate mutase, interconverting 2,3-diphosphoglycerate and 1,3-diphosphoglycerate (EC 5.4.2.4). This model is designated as a subfamily for this reason. The second and third paralogs in S. cerevisiae are somewhat divergent and apparently inactive (see PUBMED:9544241) but are also part of this subfamily phylogenetically.
Probab=29.85  E-value=72  Score=22.91  Aligned_cols=18  Identities=17%  Similarity=0.004  Sum_probs=15.5

Q ss_pred             CCCCCHHHHHHHHHHHHH
Q psy2758          45 GQGENAVEFASRVKRAIS   62 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA   62 (72)
                      ..+|+-.+|.+||.+.|.
T Consensus       146 p~GES~~~~~~Rv~~~l~  163 (245)
T TIGR01258       146 PLTESLKDTIARVLPYWN  163 (245)
T ss_pred             CCCCCHHHHHHHHHHHHH
Confidence            369999999999998764


No 62 
>PF00159 Hormone_3:  Pancreatic hormone peptide;  InterPro: IPR001955 Pancreatic hormone (PP) [] is a peptide synthesized in pancreatic islets of Langherhans, which acts as a regulator of pancreatic and gastrointestinal functions. The hormone is produced as a larger propeptide, which is enzymatically cleaved to yield the mature active peptide: this is 36 amino acids in length [] and has an amidated C terminus []. The hormone has a globular structure, residues 2-8 forming a left-handed poly-proline-II-like helix, residues 9-13 a beta turn, and 14-32 an alpha-helix,held close to the first helix by hydrophobic interactions []. Unlike glucagon, another peptide hormone, the structure of pancreatic peptide is preserved in aqueous solution []. Both N and C termini are required for activity: receptor binding and activation functions may reside in the N and C termini respectively []. Pancreatic hormone is part of a wider family of active peptides that includes:  Neuropeptide Y (NPY) [], one of the most abundant peptides in the mammalian nervous system. NPY is implicated in the control of feeding and the secretion of the gonadotrophin-releasing hormone. Peptide YY (PYY) []. PPY is a gut peptide that inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibits jejunal and colonic mobility. Various NPY and PYY-like polypeptides from fish and amphibians [, ]. Neuropeptide F (NPF) from invertebrates such as worms and snail. Skin peptide Tyr-Tyr (SPYY) from the frog Phyllomedusa bicolor. SPYY shows a large spectra of antibacterial and antifungal activity.  All these peptides are 36 to 39 amino acids long. Like most active peptides, their C-terminal is amidated and they are synthesized as larger protein precursors.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1LJV_A 1BBA_A 1V1D_A 1PPT_A 2H3T_A 2H4B_A 2BF9_A 2H3S_B 1K8V_A 2DF0_A ....
Probab=29.83  E-value=94  Score=16.98  Aligned_cols=20  Identities=20%  Similarity=0.102  Sum_probs=16.0

Q ss_pred             eCCccCCCCCCHHHHHHHHH
Q psy2758          39 LPPMFQGQGENAVEFASRVK   58 (72)
Q Consensus        39 Lpp~~r~~~E~~~eFA~RVk   58 (72)
                      ++|....++.+++|.++=..
T Consensus         3 ~~P~~P~~~aspeel~~Y~~   22 (36)
T PF00159_consen    3 SKPERPGDFASPEELAQYYA   22 (36)
T ss_dssp             SSSSSSSTTSSHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHH
Confidence            47888899999999886543


No 63 
>PRK10742 putative methyltransferase; Provisional
Probab=29.76  E-value=35  Score=25.63  Aligned_cols=19  Identities=37%  Similarity=0.541  Sum_probs=16.2

Q ss_pred             eEEEEEEeCCccCCCCCCH
Q psy2758          32 IVADVWYLPPMFQGQGENA   50 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E~~   50 (72)
                      .-+||-||.||.+...+++
T Consensus       163 ~~fDVVYlDPMfp~~~ksa  181 (250)
T PRK10742        163 PRPQVVYLDPMFPHKQKSA  181 (250)
T ss_pred             CCCcEEEECCCCCCCcccc
Confidence            3589999999999888776


No 64 
>KOG2848|consensus
Probab=29.47  E-value=72  Score=24.65  Aligned_cols=41  Identities=15%  Similarity=0.103  Sum_probs=30.8

Q ss_pred             HHhhcceeEEEEEEeCCccCC--CCCCHHHHHHHHHHHHHhhCCC
Q psy2758          25 MMMTSWAIVADVWYLPPMFQG--QGENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        25 ~lMTsW~~V~dV~yLpp~~r~--~~E~~~eFA~RVk~~IA~~~gl   67 (72)
                      +.+||  =-|-|.-|||..-+  .-++-.++++++++.|.+....
T Consensus       215 k~f~s--G~v~V~vL~pI~TeglT~ddv~~L~~~~R~~M~~~~~e  257 (276)
T KOG2848|consen  215 KVFNS--GNVIVRVLPPIPTEGLTKDDVDVLSDECRSAMLETFKE  257 (276)
T ss_pred             ceeec--ceEEEEEcCCCCccCCCcccHHHHHHHHHHHHHHHHHH
Confidence            45667  45668889999865  4566689999999999875543


No 65 
>PRK14116 gpmA phosphoglyceromutase; Provisional
Probab=29.24  E-value=79  Score=22.20  Aligned_cols=19  Identities=26%  Similarity=0.050  Sum_probs=15.8

Q ss_pred             CCCCCCHHHHHHHHHHHHH
Q psy2758          44 QGQGENAVEFASRVKRAIS   62 (72)
Q Consensus        44 r~~~E~~~eFA~RVk~~IA   62 (72)
                      ...+|+..+|.+||+..+.
T Consensus       146 ~pgGEs~~~~~~Rv~~~l~  164 (228)
T PRK14116        146 IPGGENLKVTLERVIPFWE  164 (228)
T ss_pred             CCCCCCHHHHHHHHHHHHH
Confidence            3569999999999988654


No 66 
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily. MRPs are thought to be involved in the maintenance of the mitochondrial DNA. In general, members of the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for activity and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. MRP L46 appears to contain a modified nudix motif.
Probab=29.05  E-value=93  Score=19.72  Aligned_cols=31  Identities=26%  Similarity=0.404  Sum_probs=25.1

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      ..|=||--+.+++|++.+=|.   .++.++.|+.
T Consensus        26 g~W~fPgG~ve~gEt~~eaa~---REl~EEtGl~   56 (132)
T cd04661          26 NHWILPQGKREEGETLRQTAE---RTLKELCGNN   56 (132)
T ss_pred             CeeECCcccccCCCCHHHHHH---HHHHHhhCCC
Confidence            368899999999999999887   4677777774


No 67 
>PF01864 DUF46:  Putative integral membrane protein DUF46;  InterPro: IPR002726 This archaebacterial protein has no known function. It contains several predicted transmembrane regions, suggesting it is an integral membrane protein.
Probab=28.82  E-value=52  Score=23.37  Aligned_cols=20  Identities=20%  Similarity=0.298  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHhhCCCccCCC
Q psy2758          53 FASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus        53 FA~RVk~~IA~~~gl~~l~W   72 (72)
                      +.+++-+.||-++|++++||
T Consensus       156 ~lH~~~N~i~Y~LglK~vpw  175 (175)
T PF01864_consen  156 LLHLGTNIIAYKLGLKKVPW  175 (175)
T ss_pred             HHHHHHHHHHHHHcCCCCCC
Confidence            45788899999999999999


No 68 
>cd04927 ACT_ACR-like_2 Second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana  predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=28.59  E-value=1.3e+02  Score=17.67  Aligned_cols=35  Identities=9%  Similarity=0.009  Sum_probs=23.8

Q ss_pred             eeEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCC
Q psy2758          31 AIVADVWYLPPMFQGQGENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        31 ~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl   67 (72)
                      -.+.|+.|+.....+  ..+.+--.++++.|.+.+|-
T Consensus        39 ~~v~D~F~V~d~~~~--~~~~~~~~~l~~~L~~~L~~   73 (76)
T cd04927          39 GRVLDLFFITDAREL--LHTKKRREETYDYLRAVLGD   73 (76)
T ss_pred             CEEEEEEEEeCCCCC--CCCHHHHHHHHHHHHHHHch
Confidence            458899998433222  23445667899999988884


No 69 
>PRK01112 phosphoglyceromutase; Provisional
Probab=28.58  E-value=65  Score=22.85  Aligned_cols=19  Identities=21%  Similarity=0.209  Sum_probs=16.2

Q ss_pred             CCCCCHHHHHHHHHHHHHh
Q psy2758          45 GQGENAVEFASRVKRAISK   63 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~   63 (72)
                      ..+|+-.+|.+||+..+.+
T Consensus       146 p~GES~~d~~~Rv~~~l~~  164 (228)
T PRK01112        146 PQGESLEDTGQRTLPYFQN  164 (228)
T ss_pred             CCCCCHHHHHHHHHHHHHH
Confidence            3699999999999988764


No 70 
>cd01701 PolY_Rev1 DNA polymerase Rev1. Rev1 is a translesion synthesis (TLS) polymerase found in eukaryotes.  Translesion synthesis is a process that allows the bypass of a variety of DNA lesions.  TLS polymerases lack proofreading activity and have low fidelity and low processivity.  They use damaged DNA as templates and insert nucleotides opposite the lesions.  Rev1 has both structural and enzymatic roles.  Structurally, it is believed to interact with other nonclassical polymerases and replication machinery to act as a scaffold.  Enzymatically, it catalyzes the specific insertion of dCMP opposite abasic sites.  Rev1 interacts with the Rev7 subunit of the B-family TLS polymerase Pol zeta (Rev3/Rev7).  Rev1 is known to actively promote the introduction of mutations, potentially making it a significant target for cancer treatment.
Probab=28.54  E-value=81  Score=24.21  Aligned_cols=34  Identities=18%  Similarity=0.061  Sum_probs=27.1

Q ss_pred             EEEEeCCccCC--CCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQG--QGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~--~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||..-.-.  ..+++.++|.++|+.|.++.||.
T Consensus       148 DE~~lDvt~~~~~~~~~~~~la~~ir~~I~~~~gl~  183 (404)
T cd01701         148 DEALIDITSLLEETYELPEELAEAIRNEIRETTGCS  183 (404)
T ss_pred             ceEEEEcccccccccCCHHHHHHHHHHHHHHHHCCC
Confidence            66777765543  35789999999999999999985


No 71 
>PF11058 Ral:  Antirestriction protein Ral ;  InterPro: IPR022759  Ral alleviates restriction and enhances modification by the E.coli restriction and modification system []. 
Probab=28.46  E-value=47  Score=20.38  Aligned_cols=24  Identities=21%  Similarity=0.296  Sum_probs=20.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHhhCCC
Q psy2758          44 QGQGENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        44 r~~~E~~~eFA~RVk~~IA~~~gl   67 (72)
                      ++++.--...|-|.-.+||+++|-
T Consensus        37 ~edgk~vdkwairttamiarelgk   60 (66)
T PF11058_consen   37 MEDGKYVDKWAIRTTAMIARELGK   60 (66)
T ss_pred             cccCchhhhHHHHHHHHHHHHHHh
Confidence            356777788999999999999884


No 72 
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=28.43  E-value=77  Score=19.51  Aligned_cols=29  Identities=24%  Similarity=0.424  Sum_probs=20.1

Q ss_pred             EEEeCC-ccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          36 VWYLPP-MFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        36 V~yLpp-~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      -|-+|| -+.+.+|++ +   =++.++.++.|+.
T Consensus        29 ~w~~p~GG~ve~gE~~-~---aa~REl~EEtGl~   58 (127)
T cd04693          29 MWDLSVGGHVQAGETS-T---AAEREVKEELGLE   58 (127)
T ss_pred             cccccCCCcCCCCCCH-H---HHHHHHHHHhCCC
Confidence            566886 467889998 4   3446777777765


No 73 
>PRK03609 umuC DNA polymerase V subunit UmuC; Reviewed
Probab=28.29  E-value=86  Score=24.05  Aligned_cols=34  Identities=9%  Similarity=0.132  Sum_probs=26.0

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||..-.-....++.++|.++|+.|.++.||.
T Consensus       101 DE~~lDvt~~~~l~~~~~~a~~i~~~I~~~~gl~  134 (422)
T PRK03609        101 DEAFCDLTGVRNCRDLTDFGREIRATVLQRTHLT  134 (422)
T ss_pred             ccceecCCCCcCCCCHHHHHHHHHHHHHHHHCCc
Confidence            5567776544333578999999999999999985


No 74 
>smart00838 EFG_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Probab=28.20  E-value=30  Score=20.60  Aligned_cols=29  Identities=17%  Similarity=0.287  Sum_probs=24.2

Q ss_pred             eCCccCCCCCCHHHHHHHHHHHHHhhCCC
Q psy2758          39 LPPMFQGQGENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        39 Lpp~~r~~~E~~~eFA~RVk~~IA~~~gl   67 (72)
                      |+|+..-+=+.|.++..+|-+.|+++-|.
T Consensus         2 lEPi~~~~I~~p~~~~g~v~~~l~~rrG~   30 (85)
T smart00838        2 LEPIMKVEVTVPEEYMGDVIGDLNSRRGK   30 (85)
T ss_pred             cCCEEEEEEEeCHHHHHHHHHHHHHcCCE
Confidence            57777777788999999999999987764


No 75 
>KOG4020|consensus
Probab=28.14  E-value=25  Score=26.89  Aligned_cols=16  Identities=50%  Similarity=0.904  Sum_probs=13.5

Q ss_pred             CCCccccccccccCCC
Q psy2758           1 MCGICRFGDAFWNSSK   16 (72)
Q Consensus         1 ~~~~~~fgD~fWns~~   16 (72)
                      -|||-..||||=-|.-
T Consensus       218 ~CGnCylGdaFrCs~C  233 (257)
T KOG4020|consen  218 ACGNCYLGDAFRCSGC  233 (257)
T ss_pred             ccCcccccccceecCC
Confidence            3999999999977664


No 76 
>PRK15472 nucleoside triphosphatase NudI; Provisional
Probab=28.13  E-value=97  Score=19.53  Aligned_cols=31  Identities=26%  Similarity=0.208  Sum_probs=23.6

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      ..|-+|--..++||++.+=|.   .++.++.||.
T Consensus        31 g~W~lPgG~ve~gEs~~~aa~---REl~EEtGl~   61 (141)
T PRK15472         31 GQWALSGGGVEPGERIEEALR---REIREELGEQ   61 (141)
T ss_pred             CceeCCcccCCCCCCHHHHHH---HHHHHHHCCc
Confidence            457788878899999998776   4667777763


No 77 
>PRK08172 putative acyl carrier protein IacP; Validated
Probab=28.05  E-value=42  Score=20.53  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHhhCCCc
Q psy2758          52 EFASRVKRAISKQGGLV   68 (72)
Q Consensus        52 eFA~RVk~~IA~~~gl~   68 (72)
                      +--+||+++||+++|+.
T Consensus         4 ~i~~~v~~iiae~l~v~   20 (82)
T PRK08172          4 DIEARVKKVITSCIAVD   20 (82)
T ss_pred             cHHHHHHHHHHHHHCCC
Confidence            45689999999999875


No 78 
>PRK15004 alpha-ribazole phosphatase; Provisional
Probab=27.54  E-value=71  Score=21.56  Aligned_cols=18  Identities=39%  Similarity=0.654  Sum_probs=15.5

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      .+|+-.+|.+||++.+.+
T Consensus       117 ~gEs~~~~~~Rv~~~l~~  134 (199)
T PRK15004        117 NGEGFQAFSQRVERFIAR  134 (199)
T ss_pred             CCcCHHHHHHHHHHHHHH
Confidence            599999999999887654


No 79 
>PF01996 F420_ligase:  F420-0:Gamma-glutamyl ligase;  InterPro: IPR002847 This entry contains F420-0:gamma-glutamyl ligase and related proteins. F420-0:gamma-glutamyl ligase catalyzes the GTP-dependent successive addition of multiple gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8-didemethyl-8-hydroxy-5-deazariboflavin (F420-0) to form polyglutamated F420 derivatives [, , , ].; PDB: 2G9I_A 2PHN_A.
Probab=27.29  E-value=54  Score=23.75  Aligned_cols=20  Identities=20%  Similarity=0.376  Sum_probs=16.6

Q ss_pred             CCHHHHHHHHHHHHHhhCCC
Q psy2758          48 ENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        48 E~~~eFA~RVk~~IA~~~gl   67 (72)
                      ++|.++|+|+++.|.++.|.
T Consensus       130 ~dPd~sA~~i~~~l~~~~g~  149 (228)
T PF01996_consen  130 EDPDASARRIREELKERTGK  149 (228)
T ss_dssp             S-HHHHHHHHHHHHHHHHS-
T ss_pred             CCHHHHHHHHHHHHHHHHCC
Confidence            68999999999999988775


No 80 
>TIGR02048 gshA_cyano glutamate--cysteine ligase, cyanobacterial, putative. This family consists of proteins believed (see Copley SD, Dhillon JK, 2002) to be the glutamate--cysteine ligases of several cyanobacteria, which are known to make glutathione.
Probab=27.13  E-value=1.5e+02  Score=23.13  Aligned_cols=44  Identities=9%  Similarity=0.135  Sum_probs=38.2

Q ss_pred             cccccCCChhHHHHHHHHhhcceeEEEEEEeCCccCCCCCCHHHHHHHHHHHHH
Q psy2758           9 DAFWNSSKYSMTHYLYMMMTSWAIVADVWYLPPMFQGQGENAVEFASRVKRAIS   62 (72)
Q Consensus         9 D~fWns~~~s~~~yl~~lMTsW~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA   62 (72)
                      -|||+-..-+|..|=..+..+|-.      +||.    -++.++|..-|+.+|+
T Consensus       150 SPf~~G~dTG~aS~R~~~~~~~P~------~pP~----f~~~~~y~~~~~~li~  193 (376)
T TIGR02048       150 SPFLDGQVTGYHSTRWQMFPKTPQ------EVPL----FTSHAHFIEWTEEQLT  193 (376)
T ss_pred             CccccCCCcchhhHHHHHHHhCCC------CCCC----cCCHHHHHHHHHHHHH
Confidence            489999999999999999999987      6664    5788899999999998


No 81 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=27.12  E-value=37  Score=21.00  Aligned_cols=11  Identities=36%  Similarity=0.489  Sum_probs=9.0

Q ss_pred             HHHHHhhCCCc
Q psy2758          58 KRAISKQGGLV   68 (72)
Q Consensus        58 k~~IA~~~gl~   68 (72)
                      ++.||+++|+.
T Consensus        44 ~SeIAkrlgi~   54 (64)
T COG2093          44 KSEIAKRLGIK   54 (64)
T ss_pred             HHHHHHHhCCC
Confidence            47899999975


No 82 
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]
Probab=27.11  E-value=46  Score=28.32  Aligned_cols=28  Identities=29%  Similarity=0.488  Sum_probs=22.2

Q ss_pred             eCCccCCCCCCHHHHHHHHHHHHHhhCCCccC
Q psy2758          39 LPPMFQGQGENAVEFASRVKRAISKQGGLVDL   70 (72)
Q Consensus        39 Lpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~l   70 (72)
                      +|+.++.    ..+||.|+-..|+..+|+..+
T Consensus       532 vPVlT~~----G~~FasR~~~si~~~agi~e~  559 (620)
T COG3914         532 VPVLTRV----GEQFASRNGASIATNAGIPEL  559 (620)
T ss_pred             Cceeeec----cHHHHHhhhHHHHHhcCCchh
Confidence            4555543    457999999999999999875


No 83 
>PRK14133 DNA polymerase IV; Provisional
Probab=26.77  E-value=88  Score=23.17  Aligned_cols=32  Identities=28%  Similarity=0.397  Sum_probs=24.7

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||+.-.-.  +++.++|+++++.|.++.|+.
T Consensus       103 De~~ldv~~~~--~~~~~la~~i~~~i~~~~gl~  134 (347)
T PRK14133        103 DEAYLDITNIK--EEPIKIAKYIKKKVKKETGLT  134 (347)
T ss_pred             CeEEEEccCCC--CCHHHHHHHHHHHHHHHHCCc
Confidence            45566654433  688999999999999988875


No 84 
>cd00424 PolY Y-family of DNA polymerases. Y-family DNA polymerases are a specialized subset of polymerases that facilitate translesion synthesis (TLS), a process that allows the bypass of a variety of DNA lesions.  Unlike replicative polymerases, TLS polymerases lack proofreading activity and have low fidelity and low processivity.  They use damaged DNA as templates and insert nucleotides opposite the lesions. The active sites of TLS polymerases are large and flexible to allow the accomodation of distorted bases.  Most TLS polymerases are members of the Y-family, including Pol eta, Pol kappa/IV, Pol iota, Rev1, and Pol V, which is found exclusively in bacteria.  In eukaryotes, the B-family polymerase Pol zeta also functions as a TLS polymerase. Expression of Y-family polymerases is often induced by DNA damage and is believed to be highly regulated. TLS is likely induced by the monoubiquitination of the replication clamp PCNA, which provides a scaffold for TLS polymerases to bind in ord
Probab=26.60  E-value=89  Score=23.10  Aligned_cols=34  Identities=29%  Similarity=0.254  Sum_probs=25.2

Q ss_pred             EEEEeCCccCC-CCCCHHHHHHHHHHHHHhhCC-Cc
Q psy2758          35 DVWYLPPMFQG-QGENAVEFASRVKRAISKQGG-LV   68 (72)
Q Consensus        35 dV~yLpp~~r~-~~E~~~eFA~RVk~~IA~~~g-l~   68 (72)
                      |--||..-... ..+++.++|+++|+.|.++.| +.
T Consensus        99 DE~~ldvt~~~~~~~~~~~la~~i~~~i~~~~ggl~  134 (343)
T cd00424          99 DELFLDLTGSARLLGLGSEVALRIKRHIAEQLGGIT  134 (343)
T ss_pred             CEEEEECCCchhccCCHHHHHHHHHHHHHHHhCCce
Confidence            45666655442 235789999999999999887 74


No 85 
>PRK14119 gpmA phosphoglyceromutase; Provisional
Probab=26.55  E-value=92  Score=21.76  Aligned_cols=19  Identities=16%  Similarity=0.003  Sum_probs=15.8

Q ss_pred             CCCCCHHHHHHHHHHHHHh
Q psy2758          45 GQGENAVEFASRVKRAISK   63 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~   63 (72)
                      ..+||-.+|.+||.+.+.+
T Consensus       147 p~GES~~~~~~Rv~~~l~~  165 (228)
T PRK14119        147 PYSESLKDTLVRVIPFWTD  165 (228)
T ss_pred             CCCCCHHHHHHHHHHHHHH
Confidence            4699999999999987543


No 86 
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF). NRF is a nuclear inhibitor of NF-kappaB proteins that can silence the IFNbeta promoter via binding to a negative regulatory element (NRE). Beside R3H NRF also contains a G-patch domain. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=26.27  E-value=91  Score=18.36  Aligned_cols=18  Identities=17%  Similarity=0.189  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHhhCCCcc
Q psy2758          52 EFASRVKRAISKQGGLVD   69 (72)
Q Consensus        52 eFA~RVk~~IA~~~gl~~   69 (72)
                      .+-.++=..||+++||..
T Consensus        28 ~~eR~~vH~~a~~~gL~s   45 (60)
T cd02640          28 KEERALIHQIAQKYGLKS   45 (60)
T ss_pred             HHHHHHHHHHHHHcCCce
Confidence            345788899999999975


No 87 
>cd01514 Elongation_Factor_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of elongation factors (EFs) bacterial EF-G, eukaryotic and archeal EF-2 and eukaryotic mitochondrial mtEFG1s and mtEFG2s. This group also includes proteins similar to the ribosomal protection proteins Tet(M) and Tet(O), BipA, LepA and, spliceosomal proteins: human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and yeast counterpart Snu114p.  This domain adopts a ferredoxin-like fold consisting of an alpha-beta sandwich with anti-parallel beta-sheets, resembling the topology of domain III found in the elongation factors EF-G and eukaryotic EF-2, with which it forms the C-terminal block. The two domains however are not superimposable and domain III lacks some of the characteristics of this domain.  EF-2/EF-G in complex with GTP, promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the
Probab=26.24  E-value=38  Score=19.71  Aligned_cols=28  Identities=21%  Similarity=0.270  Sum_probs=21.4

Q ss_pred             CCccCCCCCCHHHHHHHHHHHHHhhCCC
Q psy2758          40 PPMFQGQGENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        40 pp~~r~~~E~~~eFA~RVk~~IA~~~gl   67 (72)
                      +|+.+-+=+.|.++..+|-+.|+++.|-
T Consensus         1 EPi~~~~I~~p~~~~g~v~~~l~~rrg~   28 (79)
T cd01514           1 EPIMKVEITVPEEYLGAVIGDLSKRRGE   28 (79)
T ss_pred             CCEEEEEEEcCHHHHHHHHHHHHhcCCe
Confidence            3555555677889999999999987764


No 88 
>PF07687 M20_dimer:  Peptidase dimerisation domain This family only corresponds to M20 family;  InterPro: IPR011650 This domain consists of 4 beta strands and two alpha helices which make up the dimerisation surface of members of the MEROPS peptidase family M20 []. This family includes a range of zinc exopeptidases: carboxypeptidases, dipeptidases and specialised aminopeptidases [].; GO: 0016787 hydrolase activity; PDB: 3GB0_A 2F7V_A 1R3N_C 2VL1_D 2V8V_C 1R43_B 2V8G_B 2V8H_D 2V8D_A 3PFE_A ....
Probab=25.93  E-value=1.4e+02  Score=17.60  Aligned_cols=27  Identities=22%  Similarity=0.340  Sum_probs=19.2

Q ss_pred             eEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhh
Q psy2758          32 IVADVWYLPPMFQGQGENAVEFASRVKRAISKQ   64 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~   64 (72)
                      +.+|++++|++.      ..+.-+.+++.+.+.
T Consensus        81 ~~~~~R~~p~~~------~~~i~~~i~~~~~~~  107 (111)
T PF07687_consen   81 LTVDIRYPPGED------LEEIKAEIEAAVEKI  107 (111)
T ss_dssp             EEEEEEESTCHH------HHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCcch------HHHHHHHHHHHHHHh
Confidence            567888887654      677777777777653


No 89 
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional
Probab=25.67  E-value=61  Score=24.65  Aligned_cols=30  Identities=23%  Similarity=0.380  Sum_probs=25.4

Q ss_pred             EEEeCCccCCCCCCHHHHHHHHHHHHHhhCC
Q psy2758          36 VWYLPPMFQGQGENAVEFASRVKRAISKQGG   66 (72)
Q Consensus        36 V~yLpp~~r~~~E~~~eFA~RVk~~IA~~~g   66 (72)
                      +...||.... +|...++.+|+++.|.+-+|
T Consensus       334 lr~~Ppl~it-~~~i~~~~~~l~~~l~~~~~  363 (364)
T PRK04013        334 IRLLPPLIIS-KDTMEEAKSAIEGVINDILG  363 (364)
T ss_pred             EEEeCCcccC-HHHHHHHHHHHHHHHHHHhc
Confidence            6899999887 57778899999999987665


No 90 
>PF05021 NPL4:  NPL4 family;  InterPro: IPR007717 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterised step in ER-associated degradation following ubiquitination of target proteins but preceding their recognition by the 26S proteasome []. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing [].
Probab=25.64  E-value=69  Score=24.55  Aligned_cols=40  Identities=30%  Similarity=0.361  Sum_probs=26.6

Q ss_pred             eEEEEEEeCCccCCCCC---CHHHHHHHHHHHHHhhCCCccCCC
Q psy2758          32 IVADVWYLPPMFQGQGE---NAVEFASRVKRAISKQGGLVDLMW   72 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E---~~~eFA~RVk~~IA~~~gl~~l~W   72 (72)
                      .+++.-|-|||.-.++-   .+.+...+| ..||+++||..+=|
T Consensus        21 a~VeaIYEPpQ~~~~d~~~l~~d~~~~~v-d~iA~~lGL~rVG~   63 (306)
T PF05021_consen   21 AVVEAIYEPPQEGEPDGFTLLPDENEERV-DAIASALGLERVGW   63 (306)
T ss_pred             EEEEEEECCCcCCCCCCEEEcCCccHHHH-HHHHHHCCCEEEEE
Confidence            57888999999743221   112345666 46899999986644


No 91 
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional
Probab=25.58  E-value=72  Score=27.16  Aligned_cols=24  Identities=29%  Similarity=0.344  Sum_probs=19.3

Q ss_pred             CCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          46 QGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      .-|+|.+|++|+.++|...+|+..
T Consensus       649 ~leDp~~f~~Ri~~lL~~~l~~~~  672 (701)
T PTZ00272        649 QLEDPTGYAERINRMIKLGLSLDE  672 (701)
T ss_pred             CccCHHHHHHHHHHHHHHhcCCCc
Confidence            467888999999999976677653


No 92 
>PRK02406 DNA polymerase IV; Validated
Probab=25.47  E-value=1.9e+02  Score=21.26  Aligned_cols=34  Identities=24%  Similarity=0.137  Sum_probs=25.0

Q ss_pred             EEEEeCCccC-CCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQ-GQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r-~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||..-.- +...++.++|+++|+.|.++.|+.
T Consensus        95 De~~ldvt~~~~~~~~~~~la~~i~~~i~~~~gl~  129 (343)
T PRK02406         95 DEAYLDVTDNKLCIGSATLIAQEIRQDIFEELGLT  129 (343)
T ss_pred             CeEEEeccCccccCCCHHHHHHHHHHHHHHHHCCC
Confidence            5556654432 334578899999999999988875


No 93 
>COG5636 Uncharacterized conserved protein, contains Zn-ribbon-like motif [Function unknown]
Probab=25.35  E-value=29  Score=26.60  Aligned_cols=16  Identities=50%  Similarity=0.904  Sum_probs=13.3

Q ss_pred             CCCccccccccccCCC
Q psy2758           1 MCGICRFGDAFWNSSK   16 (72)
Q Consensus         1 ~~~~~~fgD~fWns~~   16 (72)
                      -|||...||||=-|--
T Consensus       240 ~CGnCylGDAFRCSGC  255 (284)
T COG5636         240 ACGNCYLGDAFRCSGC  255 (284)
T ss_pred             ccccccccccceecCC
Confidence            3999999999976654


No 94 
>PRK00745 4-oxalocrotonate tautomerase; Provisional
Probab=25.29  E-value=1.2e+02  Score=16.61  Aligned_cols=32  Identities=9%  Similarity=0.052  Sum_probs=25.0

Q ss_pred             EEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          34 ADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        34 ~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      ..|...+.   +..|.-.+++.++-.++++.+|+.
T Consensus         4 i~I~~~~g---rs~eqk~~l~~~it~~l~~~~~~p   35 (62)
T PRK00745          4 FHIELFEG---RTVEQKRKLVEEITRVTVETLGCP   35 (62)
T ss_pred             EEEEEcCC---CCHHHHHHHHHHHHHHHHHHcCCC
Confidence            45666654   357888899999999999999875


No 95 
>PF15201 Rod_cone_degen:  Progressive rod-cone degeneration
Probab=25.14  E-value=17  Score=21.64  Aligned_cols=13  Identities=38%  Similarity=0.409  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHh
Q psy2758          51 VEFASRVKRAISK   63 (72)
Q Consensus        51 ~eFA~RVk~~IA~   63 (72)
                      ..||||||.+=+.
T Consensus        17 rrfanrvqpeps~   29 (54)
T PF15201_consen   17 RRFANRVQPEPSG   29 (54)
T ss_pred             HHHhccCCCCCCC
Confidence            3699999876544


No 96 
>PRK14120 gpmA phosphoglyceromutase; Provisional
Probab=24.87  E-value=1e+02  Score=22.29  Aligned_cols=18  Identities=11%  Similarity=-0.003  Sum_probs=15.5

Q ss_pred             CCCCCHHHHHHHHHHHHH
Q psy2758          45 GQGENAVEFASRVKRAIS   62 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA   62 (72)
                      ..+|+..+|.+||.+.|.
T Consensus       148 p~GES~~~~~~Rv~~~l~  165 (249)
T PRK14120        148 PRTECLKDVVARFLPYWE  165 (249)
T ss_pred             CCCCCHHHHHHHHHHHHH
Confidence            468999999999998754


No 97 
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=24.66  E-value=1.2e+02  Score=18.03  Aligned_cols=30  Identities=27%  Similarity=0.386  Sum_probs=23.2

Q ss_pred             EEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          36 VWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        36 V~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      .|-+|--..+.+|++.+=|.   .++.++.|+.
T Consensus        26 ~w~~PgG~ie~gE~~~~aa~---RE~~EEtGl~   55 (122)
T cd04673          26 LWSFPGGKVELGETLEQAAL---RELLEETGLE   55 (122)
T ss_pred             eEECCCcccCCCCCHHHHHH---HHHHHhhCcE
Confidence            46788888899999988777   4666777765


No 98 
>PF14528 LAGLIDADG_3:  LAGLIDADG-like domain; PDB: 2CW7_A 2CW8_A 2VS8_F 2VS7_G 1B24_A 1DQ3_A 2DCH_X.
Probab=24.60  E-value=84  Score=17.96  Aligned_cols=20  Identities=15%  Similarity=0.270  Sum_probs=14.3

Q ss_pred             CHHHHHHHHHHHHHhhCCCcc
Q psy2758          49 NAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        49 ~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +..+|++.||.++. ++|+..
T Consensus        29 ~s~~ll~~v~~lL~-~lGi~~   48 (77)
T PF14528_consen   29 KSKELLEDVQKLLL-RLGIKA   48 (77)
T ss_dssp             S-HHHHHHHHHHHH-HTT--E
T ss_pred             CCHHHHHHHHHHHH-HCCCee
Confidence            67799999999886 688764


No 99 
>PF00317 Ribonuc_red_lgN:  Ribonucleotide reductase, all-alpha domain;  InterPro: IPR013509 Ribonucleotide reductase (1.17.4.1 from EC) [, ] catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs divide into three classes on the basis of their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, bacteriophage and viruses, use a diiron-tyrosyl radical, Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in anaerobic bacteria and bacteriophage, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes.  Ribonucleotide reductase is an oligomeric enzyme composed of a large subunit (700 to 1000 residues) and a small subunit (300 to 400 residues) - class II RNRs are less complex, using the small molecule B12 in place of the small chain [].  The reduction of ribonucleotides to deoxyribonucleotides involves the transfer of free radicals, the function of each metallocofactor is to generate an active site thiyl radical. This thiyl radical then initiates the nucleotide reduction process by hydrogen atom abstraction from the ribonucleotide []. The radical-based reaction involves five cysteines: two of these are located at adjacent anti-parallel strands in a new type of ten-stranded alpha/beta-barrel; two others reside at the carboxyl end in a flexible arm; and the fifth, in a loop in the centre of the barrel, is positioned to initiate the radical reaction []. There are several regions of similarity in the sequence of the large chain of prokaryotes, eukaryotes and viruses spread across 3 domains: an N-terminal domain common to the mammalian and bacterial enzymes; a C-terminal domain common to the mammalian and viral ribonucleotide reductases; and a central domain common to all three [].; GO: 0004748 ribonucleoside-diphosphate reductase activity, 0005524 ATP binding, 0006260 DNA replication, 0055114 oxidation-reduction process; PDB: 1PEM_A 2BQ1_E 1PEU_A 1PEQ_A 1PEO_A 1XJN_A 1XJK_A 3O0O_B 1XJF_A 3O0Q_A ....
Probab=24.56  E-value=81  Score=18.97  Aligned_cols=19  Identities=26%  Similarity=0.200  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHHHHHHhhC
Q psy2758          47 GENAVEFASRVKRAISKQG   65 (72)
Q Consensus        47 ~E~~~eFA~RVk~~IA~~~   65 (72)
                      .|+|+++..||=..||..-
T Consensus        25 ~Etpq~~~~RVA~~la~~e   43 (83)
T PF00317_consen   25 IETPQEMFMRVAMALASAE   43 (83)
T ss_dssp             --SHHHHHHHHHHHHHTCC
T ss_pred             eeCHHHHHHHHHHHHHHHc
Confidence            4999999999999999743


No 100
>PRK07079 hypothetical protein; Provisional
Probab=24.55  E-value=1.5e+02  Score=22.84  Aligned_cols=26  Identities=12%  Similarity=0.345  Sum_probs=20.5

Q ss_pred             EEEEEEeCCccCCCCCCHHHHHHHHHHHHHhh
Q psy2758          33 VADVWYLPPMFQGQGENAVEFASRVKRAISKQ   64 (72)
Q Consensus        33 V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~   64 (72)
                      .+|++++|      ++++.+..+++++.|++.
T Consensus       328 ~vdiR~~P------~~~~e~v~~~l~~~i~~~  353 (469)
T PRK07079        328 VCQLRFVV------GTDWENLAPHLRAHLDAH  353 (469)
T ss_pred             EEEEEcCC------CCCHHHHHHHHHHHHHhc
Confidence            35777765      678889999999999874


No 101
>PF00300 His_Phos_1:  Histidine phosphatase superfamily (branch 1);  InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The relationship between the two branches is not evident by (PSI-)BLAST but is clear from more sensitive sequence searches and structural comparisons []. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members. Phosphoglycerate mutase (5.4.2.1 from EC) (PGAM) and bisphosphoglycerate mutase (5.4.2.4 from EC) (BPGM) are structurally related enzymes that catalyse reactions involving the transfer of phospho groups between the three carbon atoms of phosphoglycerate [, , ]. Both enzymes can catalyse three different reactions with different specificities, the isomerization of 2-phosphoglycerate (2-PGA) to 3-phosphoglycerate (3-PGA) with 2,3-diphosphoglycerate (2,3-DPG) as the primer of the reaction, the synthesis of 2,3-DPG from 1,3-DPG with 3-PGA as a primer and the degradation of 2,3-DPG to 3-PGA (phosphatase 3.1.3.13 from EC activity). In mammals, PGAM is a dimeric protein with two isoforms, the M (muscle) and B (brain) forms. In yeast, PGAM is a tetrameric protein. BPGM is a dimeric protein and is found mainly in erythrocytes where it plays a major role in regulating haemoglobin oxygen affinity as a consequence of controlling 2,3-DPG concentration. The catalytic mechanism of both PGAM and BPGM involves the formation of a phosphohistidine intermediate [].  A number of other proteins including, the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase [] that catalyses both the synthesis and the degradation of fructose-2,6-bisphosphate and bacterial alpha-ribazole-5'-phosphate phosphatase, which is involved in cobalamin biosynthesis, contain this domain [].; PDB: 1C80_A 1C7Z_B 1TIP_B 1C81_A 1FBT_A 1RII_B 3OI7_B 3LL4_A 3LG2_B 3F3K_B ....
Probab=24.43  E-value=69  Score=19.70  Aligned_cols=18  Identities=33%  Similarity=0.543  Sum_probs=15.6

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      .+|+..+|..||++.+.+
T Consensus       118 ~~Es~~~~~~R~~~~~~~  135 (158)
T PF00300_consen  118 GGESWEDFQQRVKQFLDE  135 (158)
T ss_dssp             TSHHHHHHHHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHH
Confidence            689999999999987754


No 102
>PF08883 DOPA_dioxygen:  Dopa 4,5-dioxygenase family;  InterPro: IPR014980 This family of proteins is related to P87064 from SWISSPROT a DOPA 4,5-dioxygenase that is involved in synthesis of betalain. DOPA-dioxygenase is the key enzyme involved in betalain biosynthesis. It converts 3,4-dihydroxyphenylalanine to betalamic acid, a yellow chromophore. ; PDB: 2NYH_A 2P8I_C.
Probab=24.39  E-value=1.2e+02  Score=19.88  Aligned_cols=25  Identities=24%  Similarity=0.396  Sum_probs=20.1

Q ss_pred             EEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCC
Q psy2758          34 ADVWYLPPMFQGQGENAVEFASRVKRAISKQGG   66 (72)
Q Consensus        34 ~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~g   66 (72)
                      +.|+|        +++..++|..+++.|+++-+
T Consensus         3 aHvYf--------d~~~~~~A~~Lre~i~~~f~   27 (104)
T PF08883_consen    3 AHVYF--------DAAEREFARALRERIREEFP   27 (104)
T ss_dssp             EEEEE---------GGGHHHHHHHHHHHHHHTT
T ss_pred             EEEEc--------CHHHHHHHHHHHHHHHHHhh
Confidence            45777        57788999999999998876


No 103
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=24.32  E-value=1e+02  Score=18.89  Aligned_cols=31  Identities=26%  Similarity=0.347  Sum_probs=23.5

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      +.|.||==..+.+||+.+=|.   .++.++.|+.
T Consensus        26 ~~w~lPGG~ve~gEs~~~aa~---REl~EEtGl~   56 (125)
T cd04696          26 GLWGVPGGKVEWGETLEEALK---REFREETGLK   56 (125)
T ss_pred             CcEeCCceeccCCCCHHHHHH---HHHHHHhCCc
Confidence            468888888899999776555   5777777774


No 104
>PRK01810 DNA polymerase IV; Validated
Probab=23.80  E-value=1.1e+02  Score=23.28  Aligned_cols=34  Identities=18%  Similarity=0.038  Sum_probs=25.6

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||..-......++.++|.++|+.|.++.|+.
T Consensus       107 De~~ldvt~~~~~~~~~~~a~~i~~~i~~~~gl~  140 (407)
T PRK01810        107 DEGYLDITDCYALGSPLEIAKMIQQRLLTELQLP  140 (407)
T ss_pred             CeEEEeccCccccCCHHHHHHHHHHHHHHHHCCc
Confidence            4556665544444578999999999999988875


No 105
>PF08002 DUF1697:  Protein of unknown function (DUF1697);  InterPro: IPR012545 This family contains many hypothetical bacterial proteins.; PDB: 2HIY_B.
Probab=23.78  E-value=82  Score=20.95  Aligned_cols=23  Identities=17%  Similarity=0.446  Sum_probs=18.5

Q ss_pred             CCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          46 QGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      .++++.+++.++.++|.++.|+.
T Consensus        49 ~~~~~~~l~~~ie~~l~~~fG~~   71 (137)
T PF08002_consen   49 SDRDPAELAAKIEKALEERFGFD   71 (137)
T ss_dssp             ESS-HHHHHHHHHHHHHHH-TT-
T ss_pred             cCCChHHHHHHHHHHHHHhcCCC
Confidence            47899999999999999999974


No 106
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi). This enzyme requires two divalent cations for activity; one coordinates the phosphoryl groups of the NTP/dNTP substrate, and the other coordinates to the enzyme. It also contains the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as metal binding and catalytic site. MutT pyrophosphohydrolase is important in preventing errors in DNA replication by hydrolyzing mutagenic nucleotides such as 8-oxo-dGTP (a product of oxidative damage), which can mispair with template adenine during DNA replication, to guanine nucleotides.
Probab=23.72  E-value=1.4e+02  Score=17.48  Aligned_cols=30  Identities=20%  Similarity=0.352  Sum_probs=20.5

Q ss_pred             EEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          36 VWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        36 V~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      .|=+|--...++|++.+-|.|   ++.++.|+.
T Consensus        29 ~w~~p~G~~~~~e~~~~~a~R---e~~EE~g~~   58 (124)
T cd03425          29 LWEFPGGKVEPGETPEQALVR---ELREELGIE   58 (124)
T ss_pred             eEeCCCcccCCCCCHHHHHHH---HHHHhhCcE
Confidence            344665566789999887764   566777764


No 107
>cd07983 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are the uncharacterized DUF374 phospholipid/glycerol acyltransferases and similar proteins.
Probab=23.60  E-value=1.7e+02  Score=19.26  Aligned_cols=31  Identities=6%  Similarity=0.044  Sum_probs=20.4

Q ss_pred             EEEEEEeCCccCCCCCCHHHHHHHHHHHHHhh
Q psy2758          33 VADVWYLPPMFQGQGENAVEFASRVKRAISKQ   64 (72)
Q Consensus        33 V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~   64 (72)
                      -+.|.+.||....++++ .+..+++.+.+-+.
T Consensus       156 ~~~v~~~~pi~~~~~~~-~~~~~~~~~~~~~~  186 (189)
T cd07983         156 RVVIVFGEPIHVPPDAD-EEELEEYRLELEAA  186 (189)
T ss_pred             ceEEEEeCCEeeCCCCC-HHHHHHHHHHHHHH
Confidence            37788999998766655 55555555555443


No 108
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate sp
Probab=23.49  E-value=1.4e+02  Score=18.18  Aligned_cols=30  Identities=23%  Similarity=0.381  Sum_probs=23.0

Q ss_pred             EEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          36 VWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        36 V~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      -|.+|==..+.+|++.+=|.   .++.++.|+.
T Consensus        24 ~~~lPGG~ve~gEt~~~aa~---REl~EEtGl~   53 (125)
T cd04689          24 HYFLPGGHVEPGETAENALR---RELQEELGVA   53 (125)
T ss_pred             CEECCCCcCCCCCCHHHHHH---HHHHHHhCce
Confidence            36688888899999888776   5677777764


No 109
>PTZ00123 phosphoglycerate mutase like-protein; Provisional
Probab=23.33  E-value=94  Score=22.00  Aligned_cols=17  Identities=18%  Similarity=-0.021  Sum_probs=14.7

Q ss_pred             CCCCCHHHHHHHHHHHH
Q psy2758          45 GQGENAVEFASRVKRAI   61 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~I   61 (72)
                      ..+|+..+|..||.+.|
T Consensus       134 p~gES~~~~~~Rv~~~l  150 (236)
T PTZ00123        134 PNTECLKDTVERVLPYW  150 (236)
T ss_pred             CCCCCHHHHHHHHHHHH
Confidence            45999999999999864


No 110
>CHL00124 acpP acyl carrier protein; Validated
Probab=22.90  E-value=95  Score=18.14  Aligned_cols=19  Identities=16%  Similarity=0.296  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHhhCCCc
Q psy2758          50 AVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        50 ~~eFA~RVk~~IA~~~gl~   68 (72)
                      ..+...+|+++||+.+|+.
T Consensus         3 ~~~i~~~l~~ii~~~~~~~   21 (82)
T CHL00124          3 KNDIFEKVQSIVAEQLGIE   21 (82)
T ss_pred             HHHHHHHHHHHHHHHHCCC
Confidence            3567889999999998874


No 111
>KOG0420|consensus
Probab=22.48  E-value=70  Score=23.39  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=13.2

Q ss_pred             CCHHHHHHHHHHHHHh
Q psy2758          48 ENAVEFASRVKRAISK   63 (72)
Q Consensus        48 E~~~eFA~RVk~~IA~   63 (72)
                      ++..+|+++|+..|..
T Consensus       157 ~n~e~F~~~Vr~~m~g  172 (184)
T KOG0420|consen  157 SNREGFENNVRRAMSG  172 (184)
T ss_pred             hCHHHHHHHHHHHHhc
Confidence            5678899999998864


No 112
>PRK03858 DNA polymerase IV; Validated
Probab=22.44  E-value=87  Score=23.52  Aligned_cols=34  Identities=24%  Similarity=0.268  Sum_probs=25.3

Q ss_pred             EEEEeCCccC-CCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQ-GQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r-~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||..-.. +...++.++|.++|+.|+++.|+.
T Consensus       100 De~~ldvt~~~~~~~~~~~la~~ir~~i~~~~gl~  134 (396)
T PRK03858        100 DEAFLDVGGLRRISGTPVQIAARLRRRVREEVGLP  134 (396)
T ss_pred             CeEEEEccccccccCCHHHHHHHHHHHHHHHHCCC
Confidence            5566665543 223578999999999999988875


No 113
>PF13866 zf-SAP30:  SAP30 zinc-finger; PDB: 2KDP_A 2LD7_A.
Probab=22.31  E-value=62  Score=20.68  Aligned_cols=15  Identities=7%  Similarity=0.581  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHhh
Q psy2758          50 AVEFASRVKRAISKQ   64 (72)
Q Consensus        50 ~~eFA~RVk~~IA~~   64 (72)
                      ..-|++|+|+.||++
T Consensus        27 nas~SKRiqktv~Qk   41 (78)
T PF13866_consen   27 NASYSKRIQKTVAQK   41 (78)
T ss_dssp             S----HHHHHHHHHH
T ss_pred             ChhHHHHHHHHHHHh
Confidence            345999999999985


No 114
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]
Probab=22.29  E-value=1.2e+02  Score=24.06  Aligned_cols=39  Identities=15%  Similarity=0.204  Sum_probs=29.1

Q ss_pred             HHHHhhcceeEEEEEEeCCccCCCCCCHHHHHHHHHHHH
Q psy2758          23 LYMMMTSWAIVADVWYLPPMFQGQGENAVEFASRVKRAI   61 (72)
Q Consensus        23 l~~lMTsW~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~I   61 (72)
                      |..+++.|...++=-+=.-+...+||+.+||-+|=+..+
T Consensus        68 l~~~l~a~l~~~~ei~p~e~i~~~G~sdee~~~~n~~~m  106 (342)
T COG3480          68 LITYLYAWLSPQEEIVPREQVTPPGESDEEYERRNQFYM  106 (342)
T ss_pred             HHHHHHhhhCCceeecchhhcCCCCCcHHHHHHHHHHHH
Confidence            556777888888766655566677999999988865543


No 115
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=22.24  E-value=1.6e+02  Score=17.72  Aligned_cols=31  Identities=29%  Similarity=0.472  Sum_probs=23.7

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      +-|-+|--..+++|++.+=|.   .++.++.|+.
T Consensus        21 ~~w~~PgG~ve~gE~~~~aa~---REl~EEtGl~   51 (112)
T cd04667          21 SRWALPGGKIEPGETPLQAAR---RELQEETGLQ   51 (112)
T ss_pred             CcEeCCCCcCCCCCCHHHHHH---HHHHHHhCCc
Confidence            456788888899999886655   5777888875


No 116
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=22.20  E-value=1.5e+02  Score=18.05  Aligned_cols=31  Identities=29%  Similarity=0.470  Sum_probs=23.6

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      +.|-+|--..+.+|++.+=|.   .++.+++|+.
T Consensus        29 g~w~~PgG~ve~gE~~~~aa~---RE~~EE~Gl~   59 (122)
T cd04682          29 GHWDLPGGHREGGETPLECVL---RELLEEIGLT   59 (122)
T ss_pred             CcEeCCCccccCCCCHHHHHH---HHHHHHhCCc
Confidence            467888888899999988555   5666777765


No 117
>PRK13463 phosphatase PhoE; Provisional
Probab=21.83  E-value=99  Score=21.09  Aligned_cols=18  Identities=28%  Similarity=0.314  Sum_probs=15.3

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      .+|+..+|+.||+..+..
T Consensus       119 ~gEs~~~~~~R~~~~l~~  136 (203)
T PRK13463        119 SGENFEAVHKRVIEGMQL  136 (203)
T ss_pred             CCeEHHHHHHHHHHHHHH
Confidence            689999999999886643


No 118
>COG3688 Predicted RNA-binding protein containing a PIN domain [General function prediction only]
Probab=21.83  E-value=1.5e+02  Score=21.55  Aligned_cols=31  Identities=29%  Similarity=0.457  Sum_probs=23.9

Q ss_pred             eeEEEEEEeCCccC------------CCCCCHHHHHHHHHHHH
Q psy2758          31 AIVADVWYLPPMFQ------------GQGENAVEFASRVKRAI   61 (72)
Q Consensus        31 ~~V~dV~yLpp~~r------------~~~E~~~eFA~RVk~~I   61 (72)
                      .+|+|-.|.|-..+            +++|||.+|-+|.-..+
T Consensus        52 ivVFDA~~v~g~~~~~~~~~vsvvyT~~~ETADs~IEr~~~el   94 (173)
T COG3688          52 IVVFDAHYVPGVGREYKNHRVSVVYTKEGETADSFIERYVAEL   94 (173)
T ss_pred             EEEEEccccccccccccccceEEEEecCCccHHHHHHHHHHHH
Confidence            46888888886544            68999999999865444


No 119
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=21.76  E-value=1.6e+02  Score=17.49  Aligned_cols=31  Identities=32%  Similarity=0.414  Sum_probs=22.7

Q ss_pred             EEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          36 VWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        36 V~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      .|-+|--..+.+|++.+=|.   .++.++.|+..
T Consensus        24 ~w~~PgG~ve~gEt~~~aa~---REl~EEtG~~~   54 (120)
T cd04680          24 GWYLPGGGLERGETFAEAAR---RELLEELGIRL   54 (120)
T ss_pred             cEeCCCCcCCCCCCHHHHHH---HHHHHHHCCcc
Confidence            46688778899999877665   56777777654


No 120
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional
Probab=21.73  E-value=1.6e+02  Score=18.03  Aligned_cols=31  Identities=16%  Similarity=0.303  Sum_probs=21.1

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      ..|-+|=-..+++|++.+   -++.++.++.|+.
T Consensus        30 g~w~~PgG~ve~gE~~~~---a~~RE~~EE~Gl~   60 (135)
T PRK10546         30 GLWEFAGGKVEPGESQPQ---ALIRELREELGIE   60 (135)
T ss_pred             CcEECCcccCCCCCCHHH---HHHHHHHHHHCCc
Confidence            356777666688999985   2446666666765


No 121
>PF02023 SCAN:  SCAN domain;  InterPro: IPR003309 A number of C2H2-zinc finger proteins contain a highly conserved N-terminal motif termed the SCAN domain. The SCAN domain may play an important role in the assembly and function of this newly defined subclass of transcriptional regulators [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3LHR_B 4E6S_A 2FI2_A 1Y7Q_A.
Probab=21.71  E-value=1.1e+02  Score=19.27  Aligned_cols=19  Identities=32%  Similarity=0.426  Sum_probs=15.5

Q ss_pred             cCCCCCCHHHHHHHHHHHH
Q psy2758          43 FQGQGENAVEFASRVKRAI   61 (72)
Q Consensus        43 ~r~~~E~~~eFA~RVk~~I   61 (72)
                      ..+++++|.+|+.|.+..-
T Consensus        13 ~~~~~~~p~e~~~rL~~l~   31 (95)
T PF02023_consen   13 QYQEGEGPREFLSRLRELC   31 (95)
T ss_dssp             -CCTTTSHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHH
Confidence            4678999999999988764


No 122
>PF01520 Amidase_3:  N-acetylmuramoyl-L-alanine amidase;  InterPro: IPR002508 The cell wall envelope of Gram-positive bacteria is a macromolecular, exoskeletal organelle that is assembled and turned over at designated sites. The cell wall also functions as a surface organelle that allows Gram-positive pathogens to interact with their environment, in particular the tissues of the infected host. All of these functions require that surface proteins and enzymes be properly targeted to the cell wall envelope. Two basic mechanisms, cell wall sorting and targeting, have been identified. Cell well sorting is the covalent attachment of surface proteins to the peptidoglycan via a C-terminal sorting signal that contains a consensus LPXTG sequence. More than 100 proteins that possess cell wall-sorting signals, including the M proteins of Streptococcus pyogenes, protein A of Staphylococcus aureus, and several internalins of Listeria monocytogenes, have been identified. Cell wall targeting involves the noncovalent attachment of proteins to the cell surface via specialised binding domains. Several of these wall-binding domains appear to interact with secondary wall polymers that are associated with the peptidoglycan, for example teichoic acids and polysaccharides. Proteins that are targeted to the cell surface include muralytic enzymes such as autolysins, lysostaphin, and phage lytic enzymes. Other examples for targeted proteins are the surface S-layer proteins of bacilli and clostridia, as well as virulence factors required for the pathogenesis of L. monocytogenes (internalin B) and Streptococcus pneumoniae (PspA) infections []. Autolysin 3.5.1.28 from EC hydrolyses the link between N-acetylmuramoyl residues and L-amino acid residues in certain bacterial cell wall glycopeptides.; GO: 0008745 N-acetylmuramoyl-L-alanine amidase activity, 0009253 peptidoglycan catabolic process; PDB: 3QAY_A 3CZX_A 1JWQ_A 1XOV_A 3NE8_A.
Probab=21.36  E-value=77  Score=20.63  Aligned_cols=35  Identities=20%  Similarity=0.372  Sum_probs=24.5

Q ss_pred             eEEEEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          32 IVADVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        32 ~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      .-++|+|.++  ......+.+||++++..+.+..|+.
T Consensus        85 ~G~ev~~~~~--~~~~~~s~~lA~~i~~~l~~~~~~~  119 (175)
T PF01520_consen   85 RGTEVYYSYN--SSNSAKSKKLAKSIQKELSKRTGLP  119 (175)
T ss_dssp             -SEEEEEHHH--CCCCHHHHHHHHHHHHHHHHCHTTE
T ss_pred             CceEEEEecc--cccchhhHHHHHHHHHHHhhhhccc
Confidence            3456666222  2345778899999999999988864


No 123
>PF14223 UBN2:  gag-polypeptide of LTR copia-type
Probab=21.36  E-value=84  Score=19.41  Aligned_cols=21  Identities=29%  Similarity=0.445  Sum_probs=17.7

Q ss_pred             cCCCCCCHHHHHHHHHHHHHh
Q psy2758          43 FQGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        43 ~r~~~E~~~eFA~RVk~~IA~   63 (72)
                      +..++|+-.+|.+|++.++.+
T Consensus        36 k~~~~~sv~~y~~~~~~i~~~   56 (119)
T PF14223_consen   36 KMKDGESVDEYISRLKEIVDE   56 (119)
T ss_pred             HhcccccHHHHHHHHHHhhhh
Confidence            347899999999999987765


No 124
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain. AlaRS is a homodimer. It is responsible for the attachment of alanine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its predicted structure and the presence of three characteristic sequence motifs.
Probab=21.35  E-value=49  Score=24.75  Aligned_cols=25  Identities=24%  Similarity=0.618  Sum_probs=19.4

Q ss_pred             CCCccccccccccCCChhHHHHHHHHhhc
Q psy2758           1 MCGICRFGDAFWNSSKYSMTHYLYMMMTS   29 (72)
Q Consensus         1 ~~~~~~fgD~fWns~~~s~~~yl~~lMTs   29 (72)
                      |.||-.||| ||-...   +.|-..++|+
T Consensus        85 MLGNfSFgd-YFK~ea---I~~awe~LT~  109 (232)
T cd00673          85 MLGNFSFGD-YFKEEA---IAFAWELLTE  109 (232)
T ss_pred             hhcccchhh-hhHHHH---HHHHHHHHHh
Confidence            789999999 776554   6777777886


No 125
>PF02093 Gag_p30:  Gag P30 core shell protein;  InterPro: IPR003036 P30 is essential for viral assembly []. Cleavage of P70 in vitro can be accompanied by a shift from a concentrically coiled internal strand ("immature") to a collapsed ("mature") form of the virus core [].; GO: 0019068 virion assembly; PDB: 3BP9_U 1U7K_D 2Y4Z_A 1BM4_A.
Probab=21.32  E-value=55  Score=24.28  Aligned_cols=30  Identities=30%  Similarity=0.448  Sum_probs=19.6

Q ss_pred             hcceeEEEEEEeCCccCCCCCCHHHHHHHHHHHHHh
Q psy2758          28 TSWAIVADVWYLPPMFQGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        28 TsW~~V~dV~yLpp~~r~~~E~~~eFA~RVk~~IA~   63 (72)
                      |.|+-|.+      +....+|+|..|-+|.+++.-+
T Consensus       124 ~NlsKv~~------v~Qg~~EsPs~FLeRL~ea~r~  153 (211)
T PF02093_consen  124 TNLSKVRE------VTQGPNESPSAFLERLREAYRK  153 (211)
T ss_dssp             ----S--T------TTTTGGGHHHHHHHHHHHHHHH
T ss_pred             ccHHHHHH------HHhCCCCCHHHHHHHHHHHHHh
Confidence            44555444      3678899999999999988644


No 126
>CHL00130 rbcS ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit; Reviewed
Probab=21.30  E-value=94  Score=21.77  Aligned_cols=21  Identities=29%  Similarity=0.483  Sum_probs=16.9

Q ss_pred             EEeCCccCCCCCCHHHHHHHHHHHHHh
Q psy2758          37 WYLPPMFQGQGENAVEFASRVKRAISK   63 (72)
Q Consensus        37 ~yLpp~~r~~~E~~~eFA~RVk~~IA~   63 (72)
                      -||||++      .+|-++-|+-+|++
T Consensus         9 SyLPpLT------deqI~kQI~Y~i~~   29 (138)
T CHL00130          9 SFLPDLT------DQQIEKQIQYAISK   29 (138)
T ss_pred             ccCCCCC------HHHHHHHHHHHHhc
Confidence            5899996      66788888888876


No 127
>PF02033 RBFA:  Ribosome-binding factor A;  InterPro: IPR000238 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosome-binding factor A [] (gene rbfA) is a bacterial protein that associates with free 30S ribosomal subunits. It does not associate with 30S subunits that are part of 70S ribosomes or polysomes. It is essential for efficient processing of 16S rRNA. Ribosome-binding factor A is a protein of from 13 to 15 Kd which is found in most bacteria. A putative chloroplastic form seems to exist in plants.; GO: 0006364 rRNA processing; PDB: 2R1C_A 2DYJ_B 2KZF_A 2E7G_A 1JOS_A 1KKG_A 1PA4_A.
Probab=21.24  E-value=93  Score=19.29  Aligned_cols=18  Identities=17%  Similarity=0.218  Sum_probs=14.2

Q ss_pred             HHHHHHHHHhhCCCccCC
Q psy2758          54 ASRVKRAISKQGGLVDLM   71 (72)
Q Consensus        54 A~RVk~~IA~~~gl~~l~   71 (72)
                      +..++..||+++++.-+|
T Consensus        67 ~~~iR~~l~~~l~lr~~P   84 (104)
T PF02033_consen   67 AGFIRHELAKRLNLRRVP   84 (104)
T ss_dssp             HHHHHHHHHHHTTSSSG-
T ss_pred             HHHHHHHHHhhcCCCcCC
Confidence            556899999999987665


No 128
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional
Probab=21.07  E-value=64  Score=24.70  Aligned_cols=37  Identities=27%  Similarity=0.321  Sum_probs=28.5

Q ss_pred             hhcceeEEEEEEeCCccCCCC------CCHHHHHHHHHHHHHhhCCC
Q psy2758          27 MTSWAIVADVWYLPPMFQGQG------ENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        27 MTsW~~V~dV~yLpp~~r~~~------E~~~eFA~RVk~~IA~~~gl   67 (72)
                      |||+++...-.-||-.+.+.+      .+..+||++|    |+++|+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~i~~g~~~~~la~~i----a~~lg~   43 (330)
T PRK02812          1 MTSFATAARAEQLPLLSDNNRLRLFSGSSNPALAQEV----ARYLGM   43 (330)
T ss_pred             CCcccccccCCCCccccCCCCEEEEECCCCHHHHHHH----HHHhCC
Confidence            799999999999998777544      6788999865    555554


No 129
>PF07315 DUF1462:  Protein of unknown function (DUF1462);  InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues. A crystal structure of Q7A6J8 from SWISSPROT revealed a thioredoxin-like fold, its core consisting of three layers alpha/beta/alpha.; PDB: 1XG8_A.
Probab=20.85  E-value=61  Score=21.36  Aligned_cols=26  Identities=15%  Similarity=0.245  Sum_probs=17.0

Q ss_pred             EEEEEeCCccCCCCCCHHHHHHHHHH
Q psy2758          34 ADVWYLPPMFQGQGENAVEFASRVKR   59 (72)
Q Consensus        34 ~dV~yLpp~~r~~~E~~~eFA~RVk~   59 (72)
                      +++.|..=....+++...+||+|++.
T Consensus        38 f~~~YiDi~~p~~~~~~~~~a~~I~e   63 (93)
T PF07315_consen   38 FEFTYIDIENPPENDHDQQFAERILE   63 (93)
T ss_dssp             EEEEEEETTT----HHHHHHHHHHHT
T ss_pred             eEEEEEecCCCCccHHHHHHHHHHHh
Confidence            56777776777667778899999864


No 130
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate s
Probab=20.71  E-value=1.2e+02  Score=18.65  Aligned_cols=31  Identities=26%  Similarity=0.343  Sum_probs=23.3

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      +.|.+|-=....+|++.+=|.   .++-+++||.
T Consensus        28 ~~w~~PgG~ve~~Es~~~aa~---RE~~EE~Gl~   58 (129)
T cd04664          28 GFWQSVTGGIEDGESPAEAAR---REVAEETGLD   58 (129)
T ss_pred             CcccccCcccCCCCCHHHHHH---HHHHHHHCCC
Confidence            467788888899999876555   5666777775


No 131
>PF03610 EIIA-man:  PTS system fructose IIA component;  InterPro: IPR004701 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ].  The Man family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein.  It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue.  Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars.  The mannose permease of Escherichia coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine, N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine.  This family is specific for IIA and IIB components.; GO: 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0016021 integral to membrane; PDB: 3GDW_B 2JZN_A 1VSQ_A 2JZO_B 1VRC_A 1PDO_A 3GX1_A 3B48_B 3BED_B 3IPR_C ....
Probab=20.50  E-value=1.3e+02  Score=18.66  Aligned_cols=19  Identities=21%  Similarity=0.379  Sum_probs=16.2

Q ss_pred             CCCCCHHHHHHHHHHHHHh
Q psy2758          45 GQGENAVEFASRVKRAISK   63 (72)
Q Consensus        45 ~~~E~~~eFA~RVk~~IA~   63 (72)
                      .++++..+|.+++++.|.+
T Consensus        35 ~~~~~~~~~~~~l~~~i~~   53 (116)
T PF03610_consen   35 YPDESIEDFEEKLEEAIEE   53 (116)
T ss_dssp             TTTSCHHHHHHHHHHHHHH
T ss_pred             cCCCCHHHHHHHHHHHHHh
Confidence            4578999999999999954


No 132
>cd03586 PolY_Pol_IV_kappa DNA Polymerase IV/Kappa. Pol IV, also known as Pol kappa, DinB, and Dpo4, is a translesion synthesis (TLS) polymerase.  Translesion synthesis is a process that allows the bypass of a variety of DNA lesions.  TLS polymerases lack proofreading activity and have low fidelity and low processivity.  They use damaged DNA as templates and insert nucleotides opposite the lesions.  Known primarily as Pol IV in prokaryotes and Pol kappa in eukaryotes, this polymerase has a propensity for generating frameshift mutations.  The eukaryotic Pol kappa differs from Pol IV and Dpo4 by an N-terminal extension of ~75 residues known as the "N-clasp" region.  The structure of Pol kappa shows DNA that is almost totally encircled by Pol kappa, with the N-clasp region augmenting the interactions between DNA and the polymerase. Pol kappa is more resistant than Pol eta and Pol iota to bulky guanine adducts and is efficient at catalyzing the incorporation of dCTP.  Bacterial pol IV has a
Probab=20.45  E-value=1.5e+02  Score=21.42  Aligned_cols=34  Identities=26%  Similarity=0.244  Sum_probs=24.6

Q ss_pred             EEEEeCCccC-CCCCCHHHHHHHHHHHHHhhCCCc
Q psy2758          35 DVWYLPPMFQ-GQGENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        35 dV~yLpp~~r-~~~E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      |--||+.-.- ....++.++|+++++.|.++.|+.
T Consensus        98 De~~ldv~~~~~~~~~~~~la~~ir~~i~~~~g~~  132 (334)
T cd03586          98 DEAYLDVTDYVRLFGSATEIAKEIRARIREETGLT  132 (334)
T ss_pred             cceeEccccccccCCCHHHHHHHHHHHHHHHHCCc
Confidence            3445554432 345688999999999999988874


No 133
>PF00817 IMS:  impB/mucB/samB family;  InterPro: IPR001126 In Escherichia coli, UV and many chemicals appear to cause mutagenesis by a process of translesion synthesis that requires DNA polymerase III and the SOS-regulated proteins UmuD, UmuC and RecA. This machinery allows the replication to continue through DNA lesion, and therefore avoid lethal interruption of DNA replication after DNA damage []. UmuC is a well conserved protein in prokaryotes, with a homologue in yeast species. Proteins currently known to belong to this family are listed below:  E. coli MucB protein. Plasmid-born analogue of the UmuC protein.  Saccharomyces cerevisiae (Baker's yeast) Rev1 protein. Homologue of UmuC also required for normal induction of mutations by physical and chemical agents.   Salmonella typhimurium ImpB protein. Plasmid-born analogue of the UmuC protein. Bacterial UmuC protein. E. coli DNA-damage-inducible protein P (DinP). S. typhimurium SamB homologue of UmuC plasmid associated.  ; GO: 0003684 damaged DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006281 DNA repair; PDB: 3BJY_A 2AQ4_A 3OSP_A 4DL7_A 4DL6_A 3TQ1_A 3MR2_A 4EEY_A 3MR3_A 4DL4_A ....
Probab=20.42  E-value=92  Score=20.19  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=16.6

Q ss_pred             CCHHHHHHHHHHHHHhhCCCc
Q psy2758          48 ENAVEFASRVKRAISKQGGLV   68 (72)
Q Consensus        48 E~~~eFA~RVk~~IA~~~gl~   68 (72)
                      ++..+++.++++.|.+++|+.
T Consensus       112 ~~~~~~~~~l~~~i~~~~gl~  132 (149)
T PF00817_consen  112 GGEEALARRLRQAIAEETGLT  132 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHHS--
T ss_pred             chHHHHHHHHHHHHHHHhCCE
Confidence            345789999999999999875


No 134
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=20.29  E-value=1.6e+02  Score=18.10  Aligned_cols=32  Identities=19%  Similarity=0.178  Sum_probs=24.5

Q ss_pred             EEEEeCCccCCCCCCHHHHHHHHHHHHHhhCCCcc
Q psy2758          35 DVWYLPPMFQGQGENAVEFASRVKRAISKQGGLVD   69 (72)
Q Consensus        35 dV~yLpp~~r~~~E~~~eFA~RVk~~IA~~~gl~~   69 (72)
                      +.|-||-=..+++|++.+=|.   .++.++.|+..
T Consensus        27 g~w~lPgG~ve~gE~~~~aa~---REl~EEtGl~~   58 (117)
T cd04691          27 GKLNIPGGHIEAGESQEEALL---REVQEELGVDP   58 (117)
T ss_pred             CeEECcceeecCCCCHHHHHH---HHHHHHHCCCc
Confidence            457788888899999887666   57778888763


No 135
>PRK09697 protein secretion protein GspB; Provisional
Probab=20.14  E-value=94  Score=21.62  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=13.5

Q ss_pred             CCCCHHHHHHHHHHHHHh
Q psy2758          46 QGENAVEFASRVKRAISK   63 (72)
Q Consensus        46 ~~E~~~eFA~RVk~~IA~   63 (72)
                      |+++..+.-+|||.++++
T Consensus       119 E~D~~A~Lr~RVK~A~~E  136 (139)
T PRK09697        119 ESDEKAGLRERVKNALNE  136 (139)
T ss_pred             ccccchHHHHHHHHHHHH
Confidence            344456789999999985


No 136
>PF00679 EFG_C:  Elongation factor G C-terminus;  InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF2 (EF-G) is a G-protein. It brings about the translocation of peptidyl-tRNA and mRNA through a ratchet-like mechanism: the binding of GTP-EF2 to the ribosome causes a counter-clockwise rotation in the small ribosomal subunit; the hydrolysis of GTP to GDP by EF2 and the subsequent release of EF2 causes a clockwise rotation of the small subunit back to the starting position [, ]. This twisting action destabilises tRNA-ribosome interactions, freeing the tRNA to translocate along the ribosome upon GTP-hydrolysis by EF2. EF2 binding also affects the entry and exit channel openings for the mRNA, widening it when bound to enable the mRNA to translocate along the ribosome. This entry represents the C-terminal domain found in EF2 (or EF-G) of both prokaryotes and eukaryotes (also known as eEF2), as well as in some tetracycline-resistance proteins. This domain adopts a ferredoxin-like fold consisting of an alpha/beta sandwich with anti-parallel beta-sheets. It resembles the topology of domain III found in these elongation factors, with which it forms the C-terminal block, but these two domains cannot be superimposed []. This domain is often found associated with (IPR000795 from INTERPRO), which contains the signatures for the N terminus of the proteins. More information about these proteins can be found at Protein of the Month: Elongation Factors [].; GO: 0005525 GTP binding; PDB: 1WDT_A 2DY1_A 3CB4_F 3DEG_C 2EFG_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y ....
Probab=20.13  E-value=14  Score=22.42  Aligned_cols=29  Identities=24%  Similarity=0.342  Sum_probs=22.8

Q ss_pred             eCCccCCCCCCHHHHHHHHHHHHHhhCCC
Q psy2758          39 LPPMFQGQGENAVEFASRVKRAISKQGGL   67 (72)
Q Consensus        39 Lpp~~r~~~E~~~eFA~RVk~~IA~~~gl   67 (72)
                      |+|+.+-+=+.|.++..+|-+.|+++.|.
T Consensus         3 lEP~~~~~I~~p~~~~g~v~~~l~~r~g~   31 (89)
T PF00679_consen    3 LEPIMSVEISVPEEYLGKVISDLSKRRGE   31 (89)
T ss_dssp             EEEEEEEEEEEEGGGHHHHHHHHHHTT-E
T ss_pred             ECCEEEEEEEECHHHHHHHHHHhcccccE
Confidence            56776666777889999999999998774


No 137
>PF01559 Zein:  Zein seed storage protein;  InterPro: IPR002530 Alpha-prolamins are the major seed storage proteins of species of the grass tribe Andropogonea. They are unusually rich in glutamine, proline, alanine, and leucine residues and their sequences show a series of tandem repeats presumed to be the result of multiple intragenic duplication []. In Zea mays (Maize), the 22 kDa and 19 kDa zeins are encoded by a large multigene family and are the major seed storage proteins accounting for 70% of the total zein fraction. Structurally the 22 kDa and 19 kDa zeins are composed of nine adjacent, topologically antiparallel helices clustered within a distorted cylinder. The 22 kDa alpha-zeins are encoded by 23 genes []; twenty-two of the members are found in a roughly tandem array forming a dense gene cluster. The expressed genes in the cluster are interspersed with nonexpressed genes. Interestingly, some of the expressed genes differ in their transcriptional regulation. Gene amplification appears to be in blocks of genes explaining the rapid and compact expansion of the cluster during the evolution of maize.; GO: 0045735 nutrient reservoir activity
Probab=20.10  E-value=87  Score=23.83  Aligned_cols=28  Identities=25%  Similarity=0.394  Sum_probs=25.7

Q ss_pred             EEeCCccCCCCCCHHHHHHHHHHHHHhh
Q psy2758          37 WYLPPMFQGQGENAVEFASRVKRAISKQ   64 (72)
Q Consensus        37 ~yLpp~~r~~~E~~~eFA~RVk~~IA~~   64 (72)
                      -||||++-.--|.|+-=+-|.+.+||..
T Consensus        15 q~lp~vta~~~EhP~vQ~YrLqQalaas   42 (246)
T PF01559_consen   15 QFLPPVTASGYEHPAVQAYRLQQALAAS   42 (246)
T ss_pred             ccccchhhhhccchhHHHHHHHHHHHHH
Confidence            5899999999999999999999999864


Done!