Diaphorina citri psyllid: psy2768

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90------

MAQYLIFEKMREEGLFAGADEVRLTIELVVPSSQVGRIIGKGGQNVRELQRSTGSMIKLPNSFNEEETNVHIVGSFFSVQETLKGCPNIVDQPSID

cHHHHHHHHHHHcccccccccccEEEEEEEccccccEEEccccHHHHHHHHHHccEEEcccccccccCEEEEEccHHHHHHHHHHHHHHccccccc

MAQYLIFEKMREEGLFAGADEVRLTIELVVPSSQVGRIIGKGGQNVRELQRSTGSMIKL******EETNVHIVGSFFSVQETLKGCPNIVD*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAQYLIFEKMREEGLFAGADEVRLTIELVVPSSQVGRIIGKGGQNVRELQRSTGSMIKLPNSFNEEETNVHIVGSFFSVQETLKGCPNIVDQPSID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0007283 [BP]	spermatogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0051124 [BP]	synaptic growth at neuromuscular junction	probable	GO:0050808, GO:0048589, GO:0030154, GO:0048468, GO:0014706, GO:0022607, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0040007, GO:0048869, GO:0071840, GO:0007519, GO:0016043, GO:0048513, GO:0007416, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0007528, GO:0044707, GO:0007399, GO:0048856, GO:0044085, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0003730 [MF]	mRNA 3'-UTR binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048027 [MF]	mRNA 5'-UTR binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ANR, chain A
Confidence level:very confident
Coverage over the Query: 2-93
View the alignment between query and template
View the model in PyMOL