Diaphorina citri psyllid: psy2777


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MDSEKCTCSIVNASDPSAPPKGFTFDGVYDAKSTTEQIYNEIAYPLIETSFYRDGLIDRAVYSEKCTCSIVNASDPSAPPKGFTFDGVYDAKSTTEQIYNEIAYPLIE
ccccccEEEEEccccccccccEEEccCEEcccccHHHHHHHHHHHHHHHHccccEEEEEcccccccEEEEEccccccccccEEEEcCEEECcccHHHHHccccccccc
****KCT***************FTFDGVYDAKSTTEQIYNEIAYPLIETSFYRDGLIDRAVYSEKCTCSIVNA********GFTFDGVYDAKSTTEQIYNEIAYPLIE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSEKCTCSIVNASDPSAPPKGFTFDGVYDAKSTTEQIYNEIAYPLIETSFYRDGLIDRAVYSEKCTCSIVNASDPSAPPKGFTFDGVYDAKSTTEQIYNEIAYPLIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinesin-like protein KIF17 Transports vesicles containing N-methyl-D-aspartate (NMDA) receptor 2B along microtubules.confidentQ9P2E2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005930 [CC]axonemeprobableGO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422
GO:0005932 [CC]microtubule basal bodyprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0005871 [CC]kinesin complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OWM, chain A
Confidence level:very confident
Coverage over the Query: 2-108
View the alignment between query and template
View the model in PyMOL