Query         psy2779
Match_columns 101
No_of_seqs    106 out of 291
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:39:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2779.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2779hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1942|consensus              100.0 6.8E-30 1.5E-34  212.6   2.3   83    1-91      2-98  (456)
  2 COG1224 TIP49 DNA helicase TIP  99.9 2.4E-28 5.1E-33  204.9   3.2   74   10-91     12-99  (450)
  3 PF06068 TIP49:  TIP49 C-termin  99.9 1.6E-28 3.4E-33  204.3   1.0   70   14-91      1-84  (398)
  4 KOG2680|consensus               99.9 3.5E-26 7.5E-31  190.7   2.7   81    3-91      6-100 (454)
  5 COG1223 Predicted ATPase (AAA+  97.1 0.00012 2.6E-09   61.3   0.3   44   35-85    119-165 (368)
  6 COG0606 Predicted ATPase with   96.6 0.00091   2E-08   58.1   1.4   36   36-86    178-213 (490)
  7 PF01078 Mg_chelatase:  Magnesi  96.4 0.00095 2.1E-08   51.8   0.5   34   37-85      3-36  (206)
  8 TIGR00635 ruvB Holliday juncti  96.4 0.00072 1.6E-08   51.3  -0.4   45   36-88      3-47  (305)
  9 PRK05342 clpX ATP-dependent pr  96.0  0.0015 3.3E-08   54.3  -0.2   45   38-85     72-122 (412)
 10 PRK00080 ruvB Holliday junctio  95.9   0.002 4.4E-08   50.3   0.1   44   35-86     23-66  (328)
 11 TIGR02881 spore_V_K stage V sp  95.9   0.001 2.2E-08   50.4  -1.5   53   37-89      6-60  (261)
 12 PF05496 RuvB_N:  Holliday junc  95.9  0.0019 4.2E-08   51.4  -0.1   48   30-86     18-65  (233)
 13 PRK13342 recombination factor   95.6  0.0032 6.9E-08   51.1   0.0   41   36-86     11-51  (413)
 14 TIGR00390 hslU ATP-dependent p  95.6   0.004 8.8E-08   53.4   0.6   48   36-86     11-62  (441)
 15 PF13191 AAA_16:  AAA ATPase do  95.5  0.0039 8.4E-08   42.7   0.0   41   39-89      2-42  (185)
 16 TIGR00382 clpX endopeptidase C  95.3  0.0072 1.6E-07   50.8   1.1   49   36-85     76-130 (413)
 17 PRK06893 DNA replication initi  95.3   0.009 1.9E-07   44.8   1.4   51   26-87      5-55  (229)
 18 cd00009 AAA The AAA+ (ATPases   95.2   0.009 1.9E-07   37.7   1.1   26   70-95     18-43  (151)
 19 PF13086 AAA_11:  AAA domain; P  95.2  0.0053 1.1E-07   42.8   0.1   13   73-85     19-31  (236)
 20 COG0467 RAD55 RecA-superfamily  95.2  0.0065 1.4E-07   45.8   0.4   25   65-89     17-41  (260)
 21 CHL00081 chlI Mg-protoporyphyr  94.9    0.01 2.2E-07   49.0   0.9   51   28-91      8-58  (350)
 22 PRK13407 bchI magnesium chelat  94.9   0.011 2.4E-07   48.2   1.0   37   36-85      7-43  (334)
 23 PRK14961 DNA polymerase III su  94.7   0.011 2.4E-07   47.3   0.6   39   36-86     15-53  (363)
 24 PF13245 AAA_19:  Part of AAA d  94.7   0.015 3.3E-07   37.8   1.1   16   70-85      9-24  (76)
 25 PRK14962 DNA polymerase III su  94.6  0.0097 2.1E-07   50.4  -0.0   40   36-87     13-52  (472)
 26 PRK14955 DNA polymerase III su  94.5   0.011 2.4E-07   48.0   0.3   39   36-86     15-53  (397)
 27 smart00763 AAA_PrkA PrkA AAA d  94.4   0.014   3E-07   48.8   0.6   42   38-87     52-94  (361)
 28 PRK12402 replication factor C   94.3   0.018 3.9E-07   43.7   1.0   38   36-86     14-51  (337)
 29 PTZ00454 26S protease regulato  94.3   0.012 2.5E-07   48.8  -0.1   67   19-87    129-195 (398)
 30 PRK14956 DNA polymerase III su  94.2   0.018   4E-07   49.7   0.8   39   36-86     17-55  (484)
 31 TIGR02880 cbbX_cfxQ probable R  94.0  0.0095 2.1E-07   46.6  -1.1   52   37-88     22-75  (284)
 32 PRK04195 replication factor C   93.8   0.019 4.2E-07   47.6   0.4   46   31-86      9-54  (482)
 33 TIGR02237 recomb_radB DNA repa  93.8    0.03 6.5E-07   40.3   1.3   23   66-88      7-29  (209)
 34 PRK05201 hslU ATP-dependent pr  93.8   0.019 4.1E-07   49.5   0.2   50   36-86     14-65  (443)
 35 PF03215 Rad17:  Rad17 cell cyc  93.8   0.025 5.4E-07   48.8   0.9   17   70-86     44-60  (519)
 36 TIGR03877 thermo_KaiC_1 KaiC d  93.7   0.022 4.7E-07   42.8   0.3   25   65-89     15-39  (237)
 37 PF13654 AAA_32:  AAA domain; P  93.7   0.019 4.1E-07   49.3   0.0   47   36-94      7-53  (509)
 38 PLN03025 replication factor C   93.6   0.027 5.8E-07   44.0   0.7   37   36-85     12-48  (319)
 39 TIGR01241 FtsH_fam ATP-depende  93.5    0.02 4.4E-07   47.6  -0.2   51   32-85     50-102 (495)
 40 TIGR02928 orc1/cdc6 family rep  93.4   0.039 8.5E-07   42.7   1.3   49   31-88      9-57  (365)
 41 TIGR03878 thermo_KaiC_2 KaiC d  93.4   0.041 8.9E-07   42.3   1.4   28   65-92     30-57  (259)
 42 PF13401 AAA_22:  AAA domain; P  93.4    0.02 4.3E-07   37.5  -0.3   18   70-87      3-20  (131)
 43 COG1219 ClpX ATP-dependent pro  93.3    0.03 6.5E-07   48.0   0.7   46   37-85     61-111 (408)
 44 cd01394 radB RadB. The archaea  93.2   0.044 9.6E-07   39.8   1.3   25   66-90     14-38  (218)
 45 TIGR00764 lon_rel lon-related   93.2   0.032   7E-07   48.5   0.7   41   32-87     13-53  (608)
 46 KOG0734|consensus               93.2   0.036 7.8E-07   50.3   1.0   57   22-85    285-351 (752)
 47 TIGR00763 lon ATP-dependent pr  93.1   0.029 6.2E-07   49.6   0.3   43   37-86    320-362 (775)
 48 PHA02544 44 clamp loader, smal  93.1   0.031 6.6E-07   42.7   0.3   41   35-87     19-59  (316)
 49 KOG0744|consensus               93.0   0.049 1.1E-06   46.8   1.5   19   68-86    174-192 (423)
 50 KOG1970|consensus               92.9   0.055 1.2E-06   48.6   1.8   21   66-86    105-125 (634)
 51 TIGR02397 dnaX_nterm DNA polym  92.9   0.035 7.6E-07   42.7   0.4   40   36-87     13-52  (355)
 52 PRK14949 DNA polymerase III su  92.8   0.038 8.3E-07   51.4   0.6   39   36-86     15-53  (944)
 53 PF06745 KaiC:  KaiC;  InterPro  92.7   0.038 8.3E-07   40.4   0.4   23   66-88     14-36  (226)
 54 TIGR02442 Cob-chelat-sub cobal  92.7   0.046   1E-06   47.4   0.9   37   37-86      4-40  (633)
 55 COG2256 MGS1 ATPase related to  92.7   0.036 7.9E-07   47.9   0.3   52   27-89     15-66  (436)
 56 TIGR00368 Mg chelatase-related  92.7   0.061 1.3E-06   46.0   1.6   38   36-88    191-228 (499)
 57 TIGR03881 KaiC_arch_4 KaiC dom  92.6   0.041 8.9E-07   40.2   0.4   25   66-90     15-39  (229)
 58 PRK13531 regulatory ATPase Rav  92.6   0.041 8.9E-07   47.9   0.4   40   34-88     17-56  (498)
 59 COG0465 HflB ATP-dependent Zn   92.5   0.045 9.8E-07   48.5   0.6   53   37-97    150-221 (596)
 60 TIGR02640 gas_vesic_GvpN gas v  92.5   0.053 1.1E-06   41.6   0.9   16   70-85     20-35  (262)
 61 PRK14969 DNA polymerase III su  92.5   0.044 9.6E-07   46.8   0.5   38   36-85     15-52  (527)
 62 PRK05973 replicative DNA helic  92.4   0.059 1.3E-06   42.2   1.0   25   66-90     59-83  (237)
 63 PRK11034 clpA ATP-dependent Cl  92.3    0.05 1.1E-06   48.9   0.7   45   36-86    457-503 (758)
 64 PRK14952 DNA polymerase III su  92.1   0.061 1.3E-06   47.1   0.9   38   36-85     12-49  (584)
 65 cd00984 DnaB_C DnaB helicase C  92.1   0.072 1.6E-06   38.9   1.1   26   67-92      9-34  (242)
 66 CHL00181 cbbX CbbX; Provisiona  92.0   0.034 7.4E-07   43.8  -0.7   19   71-89     59-77  (287)
 67 PRK13341 recombination factor   91.9   0.052 1.1E-06   48.5   0.3   52   24-86     16-67  (725)
 68 PRK14963 DNA polymerase III su  91.9    0.06 1.3E-06   46.0   0.6   39   36-86     13-51  (504)
 69 PRK07940 DNA polymerase III su  91.8   0.063 1.4E-06   44.6   0.6   49   36-87      4-52  (394)
 70 PRK14958 DNA polymerase III su  91.8   0.061 1.3E-06   46.0   0.5   39   36-86     15-53  (509)
 71 PF06414 Zeta_toxin:  Zeta toxi  91.8   0.075 1.6E-06   38.7   0.9   22   71-92     15-36  (199)
 72 PRK07994 DNA polymerase III su  91.7   0.059 1.3E-06   47.9   0.4   40   35-86     14-53  (647)
 73 PRK08903 DnaA regulatory inact  91.5   0.079 1.7E-06   38.8   0.8   20   70-89     41-60  (227)
 74 PRK14950 DNA polymerase III su  91.5   0.068 1.5E-06   45.9   0.5   40   36-87     15-54  (585)
 75 PRK08084 DNA replication initi  91.4    0.12 2.6E-06   39.0   1.8   16   71-86     45-60  (235)
 76 PRK06067 flagellar accessory p  91.4   0.071 1.5E-06   39.4   0.5   27   66-92     20-46  (234)
 77 cd01393 recA_like RecA is a  b  91.4    0.13 2.8E-06   37.2   1.9   27   66-92     14-40  (226)
 78 KOG0731|consensus               91.3   0.064 1.4E-06   49.0   0.3   59   36-97    310-382 (774)
 79 PRK14957 DNA polymerase III su  91.3   0.076 1.6E-06   46.2   0.7   41   35-87     14-54  (546)
 80 PRK14737 gmk guanylate kinase;  91.3   0.092   2E-06   38.8   1.0   18   69-86      2-19  (186)
 81 PRK14954 DNA polymerase III su  91.2    0.08 1.7E-06   46.7   0.7   39   36-86     15-53  (620)
 82 TIGR03880 KaiC_arch_3 KaiC dom  91.2    0.11 2.3E-06   38.1   1.3   23   66-88     11-33  (224)
 83 PRK14960 DNA polymerase III su  91.2   0.085 1.8E-06   47.8   0.9   40   35-86     13-52  (702)
 84 PF07088 GvpD:  GvpD gas vesicl  91.2    0.11 2.3E-06   45.6   1.5   26   70-95      9-34  (484)
 85 COG2255 RuvB Holliday junction  91.2   0.068 1.5E-06   44.9   0.3   43   35-88     24-69  (332)
 86 cd01123 Rad51_DMC1_radA Rad51_  91.2    0.11 2.4E-06   37.8   1.3   26   66-91     14-39  (235)
 87 PRK04328 hypothetical protein;  91.2    0.11 2.3E-06   39.7   1.3   23   67-89     19-41  (249)
 88 PRK06526 transposase; Provisio  91.1   0.094   2E-06   40.9   0.9   17   71-87     98-114 (254)
 89 PRK06645 DNA polymerase III su  91.1   0.085 1.8E-06   45.4   0.7   39   36-86     20-58  (507)
 90 CHL00195 ycf46 Ycf46; Provisio  91.0   0.064 1.4E-06   45.9  -0.0   56   28-86    219-274 (489)
 91 PRK00300 gmk guanylate kinase;  91.0    0.11 2.4E-06   37.1   1.2   23   70-92      4-26  (205)
 92 PRK03992 proteasome-activating  91.0     0.1 2.3E-06   42.5   1.1   17   71-87    165-181 (389)
 93 PRK05642 DNA replication initi  90.9    0.11 2.4E-06   39.3   1.2   56   24-87      6-61  (234)
 94 TIGR03689 pup_AAA proteasome A  90.9   0.053 1.2E-06   46.9  -0.7   50   37-86    182-231 (512)
 95 KOG0733|consensus               90.9   0.089 1.9E-06   48.2   0.7   15   71-85    545-559 (802)
 96 PRK00131 aroK shikimate kinase  90.8    0.12 2.6E-06   35.1   1.2   17   71-87      4-20  (175)
 97 TIGR01243 CDC48 AAA family ATP  90.8   0.074 1.6E-06   46.5   0.1   49   37-86    453-502 (733)
 98 TIGR03420 DnaA_homol_Hda DnaA   90.8    0.12 2.6E-06   37.2   1.1   18   71-88     38-55  (226)
 99 TIGR02655 circ_KaiC circadian   90.8    0.12 2.5E-06   43.4   1.2   25   66-90     16-40  (484)
100 PF00437 T2SE:  Type II/IV secr  90.7   0.075 1.6E-06   40.0   0.1   19   70-88    126-144 (270)
101 PRK07471 DNA polymerase III su  90.6    0.15 3.3E-06   41.8   1.8   40   35-86     17-56  (365)
102 CHL00095 clpC Clp protease ATP  90.6   0.092   2E-06   46.8   0.5   44   36-85    508-553 (821)
103 PRK06647 DNA polymerase III su  90.5     0.1 2.2E-06   45.3   0.7   39   36-86     15-53  (563)
104 PRK05896 DNA polymerase III su  90.5   0.092   2E-06   46.6   0.4   40   36-87     15-54  (605)
105 COG0714 MoxR-like ATPases [Gen  90.4    0.11 2.3E-06   40.8   0.7   35   36-85     23-57  (329)
106 PRK12323 DNA polymerase III su  90.4   0.089 1.9E-06   47.7   0.3   39   36-86     15-53  (700)
107 PRK09361 radB DNA repair and r  90.3    0.15 3.2E-06   37.3   1.3   23   66-88     18-40  (225)
108 PRK00440 rfc replication facto  90.3     0.1 2.3E-06   39.1   0.6   44   30-87     11-54  (319)
109 PRK13765 ATP-dependent proteas  90.3     0.1 2.3E-06   46.2   0.6   40   33-87     27-66  (637)
110 PRK14964 DNA polymerase III su  90.3    0.11 2.4E-06   44.7   0.7   40   35-86     11-50  (491)
111 TIGR01242 26Sp45 26S proteasom  90.3    0.12 2.7E-06   41.0   1.0   62   21-87    108-172 (364)
112 cd01130 VirB11-like_ATPase Typ  90.1    0.14 2.9E-06   37.1   1.0   18   70-87     24-41  (186)
113 TIGR03015 pepcterm_ATPase puta  90.1    0.14 2.9E-06   37.8   1.0   43   33-86     16-58  (269)
114 TIGR02236 recomb_radA DNA repa  90.0    0.16 3.4E-06   39.4   1.3   24   66-89     90-113 (310)
115 PRK05563 DNA polymerase III su  90.0    0.12 2.6E-06   44.5   0.7   40   36-87     15-54  (559)
116 PRK14738 gmk guanylate kinase;  90.0    0.15 3.2E-06   37.7   1.1   19   69-87     11-29  (206)
117 TIGR02030 BchI-ChlI magnesium   89.9    0.18 3.9E-06   41.2   1.6   46   36-95      3-49  (337)
118 PRK09112 DNA polymerase III su  89.9    0.12 2.6E-06   42.1   0.6   40   36-87     22-61  (351)
119 TIGR02639 ClpA ATP-dependent C  89.9     0.1 2.2E-06   45.9   0.2   45   35-85    452-498 (731)
120 COG0464 SpoVK ATPases of the A  89.7    0.12 2.6E-06   42.5   0.5   16   70-85    275-290 (494)
121 PRK04301 radA DNA repair and r  89.5    0.21 4.6E-06   39.2   1.7   24   66-89     97-120 (317)
122 PRK07764 DNA polymerase III su  89.5    0.14 2.9E-06   46.6   0.7   38   36-85     14-51  (824)
123 PRK12377 putative replication   89.4    0.12 2.6E-06   40.4   0.3   35   41-86     82-116 (248)
124 PRK14970 DNA polymerase III su  89.4    0.15 3.3E-06   40.2   0.8   38   36-85     16-53  (367)
125 PRK06305 DNA polymerase III su  89.1    0.15 3.4E-06   42.7   0.7   40   35-86     15-54  (451)
126 PTZ00361 26 proteosome regulat  89.0     0.1 2.2E-06   44.2  -0.5   20   68-87    214-233 (438)
127 PRK14527 adenylate kinase; Pro  89.0    0.19 4.2E-06   36.1   1.1   20   70-89      5-24  (191)
128 TIGR00602 rad24 checkpoint pro  89.0    0.15 3.3E-06   45.3   0.6   47   36-90     83-129 (637)
129 TIGR01420 pilT_fam pilus retra  89.0    0.18 3.9E-06   40.4   1.0   21   70-90    121-141 (343)
130 PRK08691 DNA polymerase III su  89.0    0.16 3.6E-06   45.9   0.8   39   36-86     15-53  (709)
131 PF06309 Torsin:  Torsin;  Inte  88.9   0.046   1E-06   40.0  -2.2   51   35-94     23-76  (127)
132 KOG0727|consensus               88.9    0.28   6E-06   41.7   2.1   63   19-86    139-204 (408)
133 PLN00020 ribulose bisphosphate  88.8    0.16 3.6E-06   43.7   0.7   17   71-87    148-164 (413)
134 PRK14953 DNA polymerase III su  88.6    0.16 3.4E-06   43.2   0.5   38   36-85     15-52  (486)
135 PRK14951 DNA polymerase III su  88.6    0.14 2.9E-06   45.4   0.0   40   35-86     14-53  (618)
136 PRK06620 hypothetical protein;  88.5    0.19 4.1E-06   37.9   0.8   16   72-87     45-60  (214)
137 TIGR03345 VI_ClpV1 type VI sec  88.4    0.17 3.6E-06   45.9   0.5   47   35-88    564-613 (852)
138 KOG2028|consensus               88.4    0.12 2.7E-06   45.4  -0.3   56   21-87    123-178 (554)
139 CHL00176 ftsH cell division pr  88.2    0.16 3.4E-06   44.9   0.2   45   35-86    181-231 (638)
140 TIGR02903 spore_lon_C ATP-depe  88.1    0.18 3.9E-06   43.9   0.5   41   35-88    152-192 (615)
141 PF12775 AAA_7:  P-loop contain  88.0    0.18   4E-06   39.5   0.5   17   69-85     31-47  (272)
142 COG1222 RPT1 ATP-dependent 26S  88.0     0.2 4.4E-06   43.1   0.7   61   21-85    137-199 (406)
143 PRK00411 cdc6 cell division co  87.9    0.24 5.3E-06   38.8   1.1   47   32-88     25-72  (394)
144 KOG0730|consensus               87.9    0.22 4.7E-06   45.3   0.9   42   41-85    438-482 (693)
145 TIGR01650 PD_CobS cobaltochela  87.8    0.19   4E-06   41.6   0.4   17   69-85     62-78  (327)
146 PRK08533 flagellar accessory p  87.8    0.29 6.3E-06   37.1   1.4   21   67-87     20-40  (230)
147 PRK10865 protein disaggregatio  87.7    0.18 3.9E-06   45.6   0.2   46   36-88    567-615 (857)
148 KOG0733|consensus               87.6    0.22 4.8E-06   45.8   0.7   15   71-85    223-237 (802)
149 PRK09183 transposase/IS protei  87.6    0.26 5.7E-06   38.1   1.1   19   70-88    101-119 (259)
150 PRK07133 DNA polymerase III su  87.4    0.24 5.1E-06   44.9   0.8   39   36-86     17-55  (725)
151 PF00270 DEAD:  DEAD/DEAH box h  87.4    0.23   5E-06   33.4   0.6   16   70-85     13-28  (169)
152 TIGR02524 dot_icm_DotB Dot/Icm  87.4    0.25 5.5E-06   40.5   0.9   18   70-87    133-150 (358)
153 PRK05541 adenylylsulfate kinas  87.3    0.28   6E-06   34.6   1.0   19   70-88      6-24  (176)
154 cd01129 PulE-GspE PulE/GspE Th  87.3     0.3 6.5E-06   38.0   1.2   23   70-92     79-101 (264)
155 TIGR02239 recomb_RAD51 DNA rep  87.2     0.3 6.6E-06   39.1   1.3   25   66-90     91-115 (316)
156 PF13481 AAA_25:  AAA domain; P  87.2   0.047   1E-06   38.3  -3.0   28   70-97     31-58  (193)
157 PRK09111 DNA polymerase III su  87.1    0.25 5.4E-06   43.4   0.7   46   28-86     16-61  (598)
158 cd01122 GP4d_helicase GP4d_hel  87.1    0.27 5.9E-06   36.7   0.9   27   66-92     25-51  (271)
159 KOG0991|consensus               87.0     0.3 6.5E-06   40.9   1.2   37   37-86     27-63  (333)
160 COG0470 HolB ATPase involved i  87.0    0.24 5.1E-06   37.1   0.5   15   73-87     26-40  (325)
161 cd02019 NK Nucleoside/nucleoti  86.8    0.26 5.7E-06   30.7   0.5   15   74-88      2-16  (69)
162 PRK07003 DNA polymerase III su  86.6    0.26 5.6E-06   45.6   0.6   39   36-86     15-53  (830)
163 PF00005 ABC_tran:  ABC transpo  86.6    0.26 5.5E-06   32.8   0.4   20   68-87      8-27  (137)
164 PRK14965 DNA polymerase III su  86.4    0.27 5.8E-06   42.5   0.6   39   36-86     15-53  (576)
165 TIGR02655 circ_KaiC circadian   86.4    0.35 7.7E-06   40.5   1.3   26   65-90    257-282 (484)
166 PRK00889 adenylylsulfate kinas  86.4    0.32   7E-06   34.2   0.9   19   70-88      3-21  (175)
167 TIGR03346 chaperone_ClpB ATP-d  86.3    0.23   5E-06   44.6   0.1   43   36-85    564-609 (852)
168 PRK00149 dnaA chromosomal repl  86.3    0.26 5.7E-06   40.5   0.5   51   29-87    114-164 (450)
169 PRK09302 circadian clock prote  86.2    0.35 7.5E-06   40.3   1.2   23   67-89     27-49  (509)
170 TIGR02012 tigrfam_recA protein  86.1    0.35 7.6E-06   39.6   1.1   24   66-89     50-73  (321)
171 PRK08181 transposase; Validate  86.0    0.37   8E-06   38.1   1.1   16   71-86    106-121 (269)
172 TIGR02238 recomb_DMC1 meiotic   85.9    0.54 1.2E-05   37.8   2.1   23   66-88     91-113 (313)
173 PRK09862 putative ATP-dependen  85.8    0.52 1.1E-05   40.9   2.0   36   36-86    190-225 (506)
174 PRK05480 uridine/cytidine kina  85.8    0.35 7.6E-06   35.1   0.9   22   70-91      5-26  (209)
175 PF13604 AAA_30:  AAA domain; P  85.8    0.27 5.9E-06   36.2   0.3   17   71-87     18-34  (196)
176 PF04851 ResIII:  Type III rest  85.7    0.28   6E-06   33.1   0.3   18   71-88     25-42  (184)
177 TIGR02782 TrbB_P P-type conjug  85.7    0.38 8.3E-06   38.2   1.1   23   70-92    131-153 (299)
178 PLN03186 DNA repair protein RA  85.7    0.41   9E-06   39.2   1.3   24   66-89    118-141 (342)
179 PRK08356 hypothetical protein;  85.7    0.35 7.5E-06   35.1   0.8   15   72-86      6-20  (195)
180 TIGR00235 udk uridine kinase.   85.6    0.33 7.1E-06   35.5   0.6   19   70-88      5-23  (207)
181 KOG0738|consensus               85.6    0.34 7.5E-06   42.5   0.9   40   40-85    215-259 (491)
182 PLN02200 adenylate kinase fami  85.4    0.38 8.3E-06   36.8   0.9   18   71-88     43-60  (234)
183 PLN03187 meiotic recombination  85.3    0.53 1.2E-05   38.7   1.8   23   66-88    121-143 (344)
184 TIGR02788 VirB11 P-type DNA tr  85.0    0.25 5.4E-06   38.9  -0.2   23   68-90    141-163 (308)
185 TIGR02525 plasmid_TraJ plasmid  85.0    0.43 9.4E-06   39.6   1.1   23   70-92    148-170 (372)
186 cd03272 ABC_SMC3_euk Eukaryoti  84.9     0.6 1.3E-05   34.3   1.8   22   69-90     21-42  (243)
187 cd03283 ABC_MutS-like MutS-lik  84.8    0.48   1E-05   35.2   1.2   19   70-88     24-42  (199)
188 cd00983 recA RecA is a  bacter  84.6    0.48 1.1E-05   38.9   1.2   25   66-90     50-74  (325)
189 PHA00729 NTP-binding motif con  84.5    0.38 8.3E-06   37.8   0.6   15   73-87     19-33  (226)
190 COG2804 PulE Type II secretory  84.3    0.44 9.5E-06   41.8   0.9   16   70-85    257-272 (500)
191 TIGR02902 spore_lonB ATP-depen  84.3     0.5 1.1E-05   40.4   1.2   36   37-85     65-100 (531)
192 PRK10436 hypothetical protein;  84.3    0.53 1.2E-05   40.1   1.4   17   70-86    217-233 (462)
193 PRK10787 DNA-binding ATP-depen  84.2    0.39 8.4E-06   43.3   0.6   44   38-88    323-366 (784)
194 PRK13851 type IV secretion sys  84.2    0.24 5.2E-06   40.6  -0.7   25   70-94    161-185 (344)
195 PRK09302 circadian clock prote  84.0    0.37   8E-06   40.2   0.3   25   66-90    268-292 (509)
196 PRK05564 DNA polymerase III su  84.0    0.44 9.5E-06   37.1   0.7   40   37-88      4-43  (313)
197 smart00487 DEXDc DEAD-like hel  84.0     0.6 1.3E-05   30.8   1.3   15   72-86     25-39  (201)
198 PRK13833 conjugal transfer pro  83.9    0.47   1E-05   38.7   0.9   19   71-89    144-162 (323)
199 TIGR01243 CDC48 AAA family ATP  83.9    0.55 1.2E-05   41.1   1.4   52   35-87    176-228 (733)
200 PRK14948 DNA polymerase III su  83.8    0.49 1.1E-05   41.6   1.1   39   36-86     15-53  (620)
201 PRK08727 hypothetical protein;  83.7    0.44 9.5E-06   35.9   0.6   16   72-87     42-57  (233)
202 PLN02165 adenylate isopentenyl  83.7    0.54 1.2E-05   39.0   1.2   16   71-86     43-58  (334)
203 PF14532 Sigma54_activ_2:  Sigm  83.6     0.5 1.1E-05   32.4   0.8   15   71-85     21-35  (138)
204 cd03243 ABC_MutS_homologs The   83.6    0.82 1.8E-05   33.2   2.0   24   68-91     26-49  (202)
205 cd03238 ABC_UvrA The excision   83.5    0.68 1.5E-05   34.2   1.5   25   67-91     17-41  (176)
206 PRK11823 DNA repair protein Ra  83.4    0.54 1.2E-05   39.4   1.1   27   66-92     75-101 (446)
207 COG3839 MalK ABC-type sugar tr  83.3     0.6 1.3E-05   38.8   1.3   24   67-90     25-48  (338)
208 TIGR02533 type_II_gspE general  83.3    0.58 1.2E-05   39.9   1.2   19   70-88    241-259 (486)
209 PRK07667 uridine kinase; Provi  83.2    0.35 7.5E-06   35.3  -0.1   19   71-89     17-35  (193)
210 TIGR03499 FlhF flagellar biosy  83.2    0.59 1.3E-05   36.6   1.1   20   70-89    193-212 (282)
211 PRK14959 DNA polymerase III su  83.1    0.36 7.8E-06   43.0  -0.1   39   36-86     15-53  (624)
212 PF01695 IstB_IS21:  IstB-like   83.1    0.38 8.2E-06   35.3   0.1   17   71-87     47-63  (178)
213 PF13476 AAA_23:  AAA domain; P  83.1    0.66 1.4E-05   31.8   1.2   18   69-86     17-34  (202)
214 KOG0989|consensus               83.1    0.56 1.2E-05   39.7   1.0   38   36-86     35-72  (346)
215 TIGR00665 DnaB replicative DNA  83.0    0.64 1.4E-05   37.7   1.3   26   67-92    191-216 (434)
216 PRK13900 type IV secretion sys  82.9    0.25 5.4E-06   40.1  -1.1   24   70-93    159-182 (332)
217 TIGR02538 type_IV_pilB type IV  82.8     0.6 1.3E-05   40.2   1.2   18   70-87    315-332 (564)
218 PRK15455 PrkA family serine pr  82.7    0.75 1.6E-05   41.6   1.7   44   37-89     76-121 (644)
219 PRK14722 flhF flagellar biosyn  82.7    0.63 1.4E-05   38.9   1.2   22   68-89    134-155 (374)
220 KOG0741|consensus               82.4    0.67 1.5E-05   42.3   1.4   48   37-85    196-270 (744)
221 PRK08451 DNA polymerase III su  82.4     0.5 1.1E-05   41.2   0.5   40   35-86     12-51  (535)
222 PRK09354 recA recombinase A; P  82.2    0.68 1.5E-05   38.5   1.2   27   66-92     55-81  (349)
223 PTZ00035 Rad51 protein; Provis  82.2    0.86 1.9E-05   37.0   1.8   22   67-88    114-135 (337)
224 KOG0739|consensus               81.9    0.98 2.1E-05   39.0   2.1   43   40-85    136-180 (439)
225 PRK13894 conjugal transfer ATP  81.8    0.65 1.4E-05   37.5   1.0   24   70-93    147-170 (319)
226 TIGR00376 DNA helicase, putati  81.7    0.64 1.4E-05   40.8   0.9   22   71-92    173-194 (637)
227 KOG0735|consensus               81.6    0.34 7.3E-06   45.3  -0.8   25   71-95    701-725 (952)
228 PRK09087 hypothetical protein;  81.5    0.76 1.6E-05   34.9   1.2   50   25-86      9-59  (226)
229 PRK10875 recD exonuclease V su  81.4     0.6 1.3E-05   41.2   0.7   26   70-95    166-191 (615)
230 cd03280 ABC_MutS2 MutS2 homolo  81.4    0.81 1.8E-05   33.3   1.3   19   72-90     29-47  (200)
231 PRK14088 dnaA chromosomal repl  81.3    0.54 1.2E-05   39.2   0.3   47   30-86     98-145 (440)
232 PRK11331 5-methylcytosine-spec  81.3    0.68 1.5E-05   40.1   0.9   16   70-85    193-208 (459)
233 PHA02244 ATPase-like protein    81.3    0.67 1.5E-05   39.4   0.9   16   71-86    119-134 (383)
234 TIGR00416 sms DNA repair prote  81.2    0.72 1.6E-05   38.9   1.0   26   66-91     89-114 (454)
235 TIGR00150 HI0065_YjeE ATPase,   81.2    0.49 1.1E-05   34.2   0.1   23   69-91     20-42  (133)
236 TIGR00362 DnaA chromosomal rep  81.0    0.61 1.3E-05   37.6   0.5   18   71-88    136-153 (405)
237 TIGR02639 ClpA ATP-dependent C  81.0     0.6 1.3E-05   41.1   0.5   38   37-87    182-219 (731)
238 PRK05748 replicative DNA helic  80.8    0.98 2.1E-05   37.2   1.7   26   67-92    199-224 (448)
239 KOG3078|consensus               80.7    0.65 1.4E-05   37.1   0.6   26   71-96     15-40  (235)
240 PRK06547 hypothetical protein;  80.6    0.72 1.6E-05   33.8   0.8   21   71-91     15-35  (172)
241 KOG1807|consensus               80.6     0.2 4.4E-06   46.9  -2.6   40   57-99    382-421 (1025)
242 cd03278 ABC_SMC_barmotin Barmo  80.5     1.1 2.4E-05   33.0   1.7   17   70-87     22-38  (197)
243 PRK14971 DNA polymerase III su  80.4     0.7 1.5E-05   40.5   0.7   39   36-86     16-54  (614)
244 KOG0736|consensus               80.3    0.79 1.7E-05   43.1   1.0   13   73-85    707-719 (953)
245 KOG0737|consensus               80.2    0.62 1.3E-05   39.9   0.4   14   72-85    128-141 (386)
246 cd01121 Sms Sms (bacterial rad  80.2    0.79 1.7E-05   37.8   1.0   23   66-88     77-99  (372)
247 PTZ00202 tuzin; Provisional     80.2    0.93   2E-05   40.4   1.4   42   35-87    260-302 (550)
248 TIGR03600 phage_DnaB phage rep  79.8    0.92   2E-05   36.8   1.2   26   67-92    190-215 (421)
249 cd03255 ABC_MJ0796_Lo1CDE_FtsE  79.8    0.89 1.9E-05   32.9   1.0   17   69-85     28-44  (218)
250 cd03269 ABC_putative_ATPase Th  79.6     1.2 2.5E-05   32.2   1.6   22   67-88     22-43  (210)
251 PF00308 Bac_DnaA:  Bacterial d  79.5    0.48   1E-05   35.7  -0.5   45   31-86      2-49  (219)
252 KOG0743|consensus               79.5    0.72 1.6E-05   40.2   0.5   20   68-87    232-251 (457)
253 PRK07004 replicative DNA helic  79.5     1.2 2.7E-05   37.4   1.9   24   67-90    209-232 (460)
254 PRK05057 aroK shikimate kinase  79.5    0.99 2.2E-05   32.5   1.2   21   71-91      4-24  (172)
255 TIGR03608 L_ocin_972_ABC putat  79.4    0.93   2E-05   32.4   1.0   17   70-86     23-39  (206)
256 COG2805 PilT Tfp pilus assembl  79.3       1 2.2E-05   38.4   1.3   16   71-86    125-140 (353)
257 TIGR00455 apsK adenylylsulfate  79.2    0.92   2E-05   32.2   0.9   20   70-89     17-36  (184)
258 KOG0651|consensus               79.2     1.2 2.6E-05   38.2   1.8   42   43-87    139-182 (388)
259 PF13555 AAA_29:  P-loop contai  79.1       1 2.2E-05   29.1   1.0   15   71-85     23-37  (62)
260 PRK06921 hypothetical protein;  79.0    0.91   2E-05   35.5   0.9   17   71-87    117-133 (266)
261 COG0466 Lon ATP-dependent Lon   78.8     1.3 2.8E-05   41.0   1.9   20   67-86    346-365 (782)
262 KOG0060|consensus               78.7    0.63 1.4E-05   42.2  -0.1   30   67-96    457-486 (659)
263 cd00820 PEPCK_HprK Phosphoenol  78.6     1.1 2.4E-05   31.5   1.2   23   70-92     14-36  (107)
264 cd03288 ABCC_SUR2 The SUR doma  78.6     1.1 2.4E-05   33.7   1.2   22   67-88     43-64  (257)
265 cd03257 ABC_NikE_OppD_transpor  78.5       1 2.2E-05   32.6   1.0   20   69-88     29-48  (228)
266 PRK08116 hypothetical protein;  78.5    0.84 1.8E-05   35.6   0.6   18   71-88    114-131 (268)
267 PRK14729 miaA tRNA delta(2)-is  78.5     1.1 2.4E-05   36.4   1.2   17   71-87      4-20  (300)
268 TIGR02315 ABC_phnC phosphonate  78.4       1 2.3E-05   33.0   1.0   20   68-87     25-44  (243)
269 cd03262 ABC_HisP_GlnQ_permease  78.2     1.1 2.3E-05   32.2   1.0   17   70-86     25-41  (213)
270 cd03226 ABC_cobalt_CbiO_domain  78.2     1.1 2.3E-05   32.3   1.0   19   68-86     23-41  (205)
271 TIGR01166 cbiO cobalt transpor  78.1     1.1 2.4E-05   31.9   1.0   20   68-87     15-34  (190)
272 PRK07952 DNA replication prote  78.0    0.89 1.9E-05   35.5   0.6   17   72-88    100-116 (244)
273 cd03258 ABC_MetN_methionine_tr  77.9     1.2 2.7E-05   32.5   1.3   19   68-86     28-46  (233)
274 PF03796 DnaB_C:  DnaB-like hel  77.8    0.86 1.9E-05   34.3   0.4   24   67-90     15-38  (259)
275 cd03292 ABC_FtsE_transporter F  77.8     1.1 2.4E-05   32.1   1.0   18   69-86     25-42  (214)
276 PRK06851 hypothetical protein;  77.6    0.31 6.6E-06   40.7  -2.2   27   70-96     29-55  (367)
277 cd03268 ABC_BcrA_bacitracin_re  77.6     1.1 2.5E-05   32.2   1.0   21   69-89     24-44  (208)
278 TIGR01447 recD exodeoxyribonuc  77.4       1 2.2E-05   39.5   0.8   24   70-93    159-182 (586)
279 PRK06696 uridine kinase; Valid  77.2     1.1 2.4E-05   33.2   0.9   22   71-92     22-43  (223)
280 cd03250 ABCC_MRP_domain1 Domai  77.2     1.3 2.7E-05   31.9   1.2   23   68-90     28-50  (204)
281 cd03256 ABC_PhnC_transporter A  77.2     1.2 2.6E-05   32.6   1.0   22   68-89     24-45  (241)
282 PRK00091 miaA tRNA delta(2)-is  77.2     1.2 2.5E-05   36.0   1.1   18   71-88      4-21  (307)
283 PRK07399 DNA polymerase III su  77.0    0.75 1.6E-05   36.9  -0.1   39   37-87      4-42  (314)
284 cd03237 ABC_RNaseL_inhibitor_d  76.9     1.6 3.4E-05   33.3   1.6   25   63-87     17-41  (246)
285 cd03247 ABCC_cytochrome_bd The  76.8     1.3 2.7E-05   31.5   1.0   24   67-90     24-47  (178)
286 COG4525 TauB ABC-type taurine   76.8     1.4 2.9E-05   36.1   1.3   20   67-86     27-46  (259)
287 PRK10584 putative ABC transpor  76.8     1.2 2.7E-05   32.4   1.0   17   70-86     35-51  (228)
288 TIGR02673 FtsE cell division A  76.7     1.2 2.7E-05   32.0   1.0   17   69-85     26-42  (214)
289 cd03228 ABCC_MRP_Like The MRP   76.7     1.5 3.3E-05   30.9   1.4   20   67-86     24-43  (171)
290 KOG0652|consensus               76.7     1.6 3.5E-05   37.3   1.8   63   18-85    154-219 (424)
291 PRK12422 chromosomal replicati  76.7     0.9   2E-05   38.2   0.3   51   29-87    103-157 (445)
292 cd03225 ABC_cobalt_CbiO_domain  76.7     1.2 2.7E-05   32.0   1.0   18   69-86     25-42  (211)
293 PRK05703 flhF flagellar biosyn  76.7     1.3 2.7E-05   37.2   1.1   18   70-87    220-237 (424)
294 TIGR03410 urea_trans_UrtE urea  76.6     1.3 2.7E-05   32.4   1.0   18   68-85     23-40  (230)
295 TIGR00960 3a0501s02 Type II (G  76.6     1.3 2.7E-05   32.1   1.0   19   68-86     26-44  (216)
296 cd03221 ABCF_EF-3 ABCF_EF-3  E  76.4     1.3 2.8E-05   30.9   1.0   22   67-88     22-43  (144)
297 cd03293 ABC_NrtD_SsuB_transpor  76.3     1.3 2.8E-05   32.3   1.0   17   69-85     28-44  (220)
298 PRK10247 putative ABC transpor  76.3     1.3 2.8E-05   32.6   1.0   19   69-87     31-49  (225)
299 TIGR02211 LolD_lipo_ex lipopro  76.2     1.3 2.8E-05   32.1   1.0   19   69-87     29-47  (221)
300 PRK13764 ATPase; Provisional    76.1     1.2 2.6E-05   39.5   1.0   23   71-93    257-279 (602)
301 cd03224 ABC_TM1139_LivF_branch  76.0     1.3 2.8E-05   32.0   0.9   19   68-86     23-41  (222)
302 COG4178 ABC-type uncharacteriz  76.0     1.5 3.3E-05   39.3   1.5   18   70-87    418-435 (604)
303 PF00580 UvrD-helicase:  UvrD/R  75.9    0.86 1.9E-05   33.4  -0.0   14   72-85     14-27  (315)
304 PTZ00088 adenylate kinase 1; P  75.9     1.4 3.1E-05   33.8   1.2   17   74-90      9-25  (229)
305 PRK08939 primosomal protein Dn  75.9     1.2 2.7E-05   35.6   0.9   16   71-86    156-171 (306)
306 cd03214 ABC_Iron-Siderophores_  75.9     1.7 3.7E-05   31.0   1.5   23   68-90     22-44  (180)
307 PF01637 Arch_ATPase:  Archaeal  75.8    0.96 2.1E-05   31.5   0.2   17   71-87     20-36  (234)
308 cd04155 Arl3 Arl3 subfamily.    75.8     1.4   3E-05   29.8   1.0   21   71-91     14-34  (173)
309 cd03246 ABCC_Protease_Secretio  75.7     1.8 3.9E-05   30.6   1.6   20   67-86     24-43  (173)
310 COG1474 CDC6 Cdc6-related prot  75.7     1.4 2.9E-05   36.4   1.1   13   74-86     45-57  (366)
311 PRK14247 phosphate ABC transpo  75.7     1.4   3E-05   32.7   1.0   23   69-91     27-49  (250)
312 cd03301 ABC_MalK_N The N-termi  75.6     1.4   3E-05   31.7   1.0   18   69-86     24-41  (213)
313 PRK13541 cytochrome c biogenes  75.6     1.4   3E-05   31.7   1.0   19   70-88     25-43  (195)
314 TIGR01978 sufC FeS assembly AT  75.5     1.5 3.3E-05   32.1   1.2   22   69-90     24-45  (243)
315 KOG1803|consensus               75.5     1.5 3.2E-05   39.9   1.4   15   72-86    202-216 (649)
316 PRK05595 replicative DNA helic  75.5     1.6 3.6E-05   36.0   1.5   26   67-92    197-222 (444)
317 PRK11124 artP arginine transpo  75.4     1.5 3.3E-05   32.3   1.2   19   68-86     25-43  (242)
318 cd03232 ABC_PDR_domain2 The pl  75.4     1.5 3.2E-05   31.6   1.1   22   70-91     32-53  (192)
319 cd03254 ABCC_Glucan_exporter_l  75.3     1.4 3.1E-05   32.0   1.0   22   67-88     25-46  (229)
320 cd03260 ABC_PstB_phosphate_tra  75.3     1.4 3.1E-05   32.1   1.0   21   69-89     24-44  (227)
321 cd03235 ABC_Metallic_Cations A  75.2     1.6 3.5E-05   31.5   1.3   22   67-88     21-42  (213)
322 TIGR00750 lao LAO/AO transport  75.2     1.4 3.1E-05   34.4   1.1   21   70-90     33-53  (300)
323 PRK13539 cytochrome c biogenes  75.2     1.5 3.1E-05   32.0   1.0   23   67-89     24-46  (207)
324 cd03266 ABC_NatA_sodium_export  75.0     1.5 3.2E-05   31.7   1.0   20   68-87     28-47  (218)
325 PRK15177 Vi polysaccharide exp  74.9     1.6 3.4E-05   32.3   1.1   18   70-87     12-29  (213)
326 cd03245 ABCC_bacteriocin_expor  74.9     1.8 3.8E-05   31.4   1.4   21   69-89     28-48  (220)
327 TIGR03864 PQQ_ABC_ATP ABC tran  74.9     1.8   4E-05   31.9   1.5   19   68-86     24-42  (236)
328 PRK10536 hypothetical protein;  74.8     1.3 2.9E-05   35.7   0.8   16   71-86     74-89  (262)
329 PRK13948 shikimate kinase; Pro  74.7     1.7 3.7E-05   32.4   1.3   18   70-87      9-26  (182)
330 cd03253 ABCC_ATM1_transporter   74.7     1.8   4E-05   31.6   1.5   25   67-91     23-47  (236)
331 PRK14242 phosphate transporter  74.6     1.6 3.5E-05   32.4   1.2   21   68-88     29-49  (253)
332 PRK06835 DNA replication prote  74.6     1.2 2.7E-05   36.2   0.6   16   72-87    184-199 (329)
333 cd03234 ABCG_White The White s  74.6     1.6 3.4E-05   32.0   1.1   19   67-85     29-47  (226)
334 PRK10869 recombination and rep  74.5    0.98 2.1E-05   39.0  -0.0   22   69-94     20-41  (553)
335 TIGR00064 ftsY signal recognit  74.4     1.4   3E-05   34.6   0.8   16   71-86     72-87  (272)
336 TIGR03005 ectoine_ehuA ectoine  74.4     1.7 3.7E-05   32.4   1.2   19   68-86     23-41  (252)
337 PLN02674 adenylate kinase       74.4     1.5 3.1E-05   34.6   0.9   18   72-89     32-49  (244)
338 PRK08154 anaerobic benzoate ca  74.3     1.5 3.3E-05   34.6   1.0   26   65-90    127-152 (309)
339 PRK14974 cell division protein  74.2     1.6 3.4E-05   35.8   1.1   18   70-87    139-156 (336)
340 TIGR03346 chaperone_ClpB ATP-d  74.2    0.92   2E-05   40.8  -0.3   16   71-86    194-209 (852)
341 cd03259 ABC_Carb_Solutes_like   74.2     1.6 3.4E-05   31.5   1.0   20   68-87     23-42  (213)
342 TIGR00678 holB DNA polymerase   74.1     1.4 3.1E-05   31.4   0.7   18   71-88     14-31  (188)
343 cd03264 ABC_drug_resistance_li  74.1     1.4   3E-05   31.8   0.7   17   70-87     25-41  (211)
344 cd03261 ABC_Org_Solvent_Resist  74.1     1.6 3.5E-05   32.1   1.0   19   68-86     23-41  (235)
345 TIGR02323 CP_lyasePhnK phospho  74.0     1.6 3.4E-05   32.5   1.0   17   70-86     28-44  (253)
346 PRK11248 tauB taurine transpor  74.0     1.6 3.4E-05   33.1   1.0   20   68-87     24-43  (255)
347 cd03296 ABC_CysA_sulfate_impor  74.0     1.6 3.5E-05   32.2   1.0   21   67-87     24-44  (239)
348 PRK08760 replicative DNA helic  74.0     1.9 4.2E-05   36.5   1.6   26   67-92    225-250 (476)
349 cd03219 ABC_Mj1267_LivG_branch  74.0     1.6 3.4E-05   31.9   1.0   22   68-89     23-44  (236)
350 cd03281 ABC_MSH5_euk MutS5 hom  74.0     1.6 3.6E-05   32.7   1.1   16   72-87     30-45  (213)
351 PRK13946 shikimate kinase; Pro  73.9     1.6 3.5E-05   31.4   1.0   18   70-87      9-26  (184)
352 PRK10416 signal recognition pa  73.8     1.5 3.2E-05   35.4   0.9   17   70-86    113-129 (318)
353 cd03263 ABC_subfamily_A The AB  73.7     1.7 3.6E-05   31.5   1.0   18   68-85     25-42  (220)
354 PF02463 SMC_N:  RecF/RecN/SMC   73.6     1.2 2.7E-05   32.2   0.3   18   69-86     22-39  (220)
355 PRK11629 lolD lipoprotein tran  73.5     1.7 3.6E-05   32.0   1.0   18   69-86     33-50  (233)
356 COG1855 ATPase (PilT family) [  73.5     1.3 2.8E-05   39.8   0.5   15   74-88    266-280 (604)
357 PRK08058 DNA polymerase III su  73.4     1.2 2.6E-05   35.5   0.2   36   39-86      7-43  (329)
358 KOG3347|consensus               73.3       2 4.2E-05   33.6   1.4   20   71-90      7-26  (176)
359 PRK13543 cytochrome c biogenes  73.3     1.7 3.6E-05   31.8   0.9   23   68-90     34-56  (214)
360 cd03218 ABC_YhbG The ABC trans  73.2     1.7 3.7E-05   31.7   1.0   18   69-86     24-41  (232)
361 cd03249 ABC_MTABC3_MDL1_MDL2 M  73.1     1.6 3.6E-05   32.0   0.9   18   70-87     28-45  (238)
362 COG1484 DnaC DNA replication p  73.1     1.4   3E-05   34.3   0.5   17   70-86    104-120 (254)
363 PRK09165 replicative DNA helic  73.1     1.9 4.2E-05   36.6   1.4   23   67-89    213-235 (497)
364 cd03213 ABCG_EPDR ABCG transpo  73.1     1.8   4E-05   31.3   1.1   24   68-91     32-55  (194)
365 TIGR02324 CP_lyasePhnL phospho  73.0     1.8 3.8E-05   31.5   1.0   19   68-86     31-49  (224)
366 PRK13538 cytochrome c biogenes  73.0       2 4.3E-05   31.1   1.3   19   68-86     24-42  (204)
367 PRK10908 cell division protein  73.0     1.8 3.9E-05   31.6   1.0   22   69-90     26-47  (222)
368 cd03251 ABCC_MsbA MsbA is an e  72.9     2.2 4.8E-05   31.1   1.5   21   68-88     25-45  (234)
369 COG0497 RecN ATPase involved i  72.9     1.1 2.4E-05   39.8  -0.1   22   69-94     20-41  (557)
370 PRK10733 hflB ATP-dependent me  72.9     1.1 2.5E-05   39.1   0.0   49   36-87    151-201 (644)
371 PLN02840 tRNA dimethylallyltra  72.9     1.8 3.9E-05   37.0   1.2   20   68-87     18-37  (421)
372 PRK14267 phosphate ABC transpo  72.8     1.8 3.8E-05   32.2   1.0   19   69-87     28-46  (253)
373 cd00268 DEADc DEAD-box helicas  72.8     1.7 3.7E-05   30.6   0.9   15   71-85     36-50  (203)
374 cd03298 ABC_ThiQ_thiamine_tran  72.8     1.8 3.9E-05   31.2   1.0   22   68-89     21-42  (211)
375 TIGR00968 3a0106s01 sulfate AB  72.8     2.2 4.9E-05   31.6   1.5   21   67-87     22-42  (237)
376 PRK10771 thiQ thiamine transpo  72.8     1.8 3.9E-05   31.9   1.0   21   67-87     21-41  (232)
377 KOG0990|consensus               72.7     1.7 3.8E-05   37.0   1.1   16   73-88     64-79  (360)
378 PRK13540 cytochrome c biogenes  72.7     2.3 4.9E-05   30.7   1.5   23   67-89     23-45  (200)
379 PRK06995 flhF flagellar biosyn  72.7     1.8 3.8E-05   37.5   1.1   21   70-90    255-275 (484)
380 cd03223 ABCD_peroxisomal_ALDP   72.5     1.9 4.1E-05   30.6   1.0   24   67-90     23-46  (166)
381 PRK12338 hypothetical protein;  72.5     1.8 3.9E-05   35.7   1.1   18   71-88      4-21  (319)
382 TIGR01448 recD_rel helicase, p  72.5     1.7 3.8E-05   38.6   1.0   25   71-95    338-362 (720)
383 PF01580 FtsK_SpoIIIE:  FtsK/Sp  72.5     1.2 2.5E-05   32.1  -0.0   16   73-88     40-55  (205)
384 PRK09493 glnQ glutamine ABC tr  72.4     1.8   4E-05   31.9   1.0   19   69-87     25-43  (240)
385 PRK06904 replicative DNA helic  72.4       2 4.4E-05   36.4   1.4   24   66-89    216-239 (472)
386 cd03233 ABC_PDR_domain1 The pl  72.2     1.8 3.9E-05   31.5   0.9   18   70-87     32-49  (202)
387 cd03229 ABC_Class3 This class   72.1     1.9 4.2E-05   30.6   1.0   20   67-86     22-41  (178)
388 cd00267 ABC_ATPase ABC (ATP-bi  72.1     2.5 5.4E-05   29.2   1.6   20   67-86     21-40  (157)
389 cd03265 ABC_DrrA DrrA is the A  72.1     1.9   4E-05   31.4   0.9   19   69-87     24-42  (220)
390 cd03215 ABC_Carb_Monos_II This  72.1     1.9 4.2E-05   30.7   1.0   18   69-86     24-41  (182)
391 TIGR01277 thiQ thiamine ABC tr  71.9     1.9 4.2E-05   31.3   1.0   19   68-86     21-39  (213)
392 PRK06851 hypothetical protein;  71.9     1.7 3.8E-05   36.3   0.8   25   71-95    214-238 (367)
393 PRK14239 phosphate transporter  71.9     1.9 4.2E-05   31.9   1.0   23   69-91     29-51  (252)
394 PRK11264 putative amino-acid A  71.7       2 4.3E-05   31.8   1.0   19   69-87     27-45  (250)
395 PRK11614 livF leucine/isoleuci  71.7     1.9 4.2E-05   31.7   1.0   22   68-89     28-49  (237)
396 PRK10895 lipopolysaccharide AB  71.7       2 4.3E-05   31.7   1.0   20   68-87     26-45  (241)
397 cd03244 ABCC_MRP_domain2 Domai  71.6       2 4.3E-05   31.1   1.0   21   69-89     28-48  (221)
398 TIGR01189 ccmA heme ABC export  71.5     2.5 5.4E-05   30.4   1.5   20   67-86     22-41  (198)
399 PRK14262 phosphate ABC transpo  71.5       2 4.4E-05   31.9   1.0   23   67-89     25-47  (250)
400 PRK12726 flagellar biosynthesi  71.4       2 4.4E-05   36.9   1.1   19   68-86    203-221 (407)
401 PRK06321 replicative DNA helic  71.2     2.3   5E-05   36.2   1.4   26   67-92    222-247 (472)
402 cd03230 ABC_DR_subfamily_A Thi  71.1     2.1 4.5E-05   30.3   1.0   19   68-86     23-41  (173)
403 cd03241 ABC_RecN RecN ATPase i  71.1     3.2   7E-05   31.9   2.1   17   69-85     19-35  (276)
404 PRK13645 cbiO cobalt transport  71.0       2 4.4E-05   32.9   1.0   18   69-86     35-52  (289)
405 cd01878 HflX HflX subfamily.    71.0    0.78 1.7E-05   32.5  -1.2   21   72-92     42-62  (204)
406 PF00158 Sigma54_activat:  Sigm  71.0     1.9 4.1E-05   31.5   0.8   14   72-85     23-36  (168)
407 PRK09580 sufC cysteine desulfu  70.9     2.1 4.5E-05   31.5   1.0   21   70-90     26-46  (248)
408 cd03252 ABCC_Hemolysin The ABC  70.9     2.1 4.5E-05   31.4   1.0   23   68-90     25-47  (237)
409 PRK05416 glmZ(sRNA)-inactivati  70.8     1.8 3.9E-05   34.6   0.7   19   71-89      6-24  (288)
410 PRK10575 iron-hydroxamate tran  70.8     2.1 4.6E-05   32.4   1.0   23   69-91     35-57  (265)
411 PRK14256 phosphate ABC transpo  70.7     2.1 4.6E-05   31.9   1.0   20   68-87     27-46  (252)
412 PRK03846 adenylylsulfate kinas  70.6       2 4.4E-05   31.2   0.9   18   70-87     23-40  (198)
413 TIGR02168 SMC_prok_B chromosom  70.5     2.5 5.3E-05   36.9   1.5   19   69-87     21-39  (1179)
414 cd01128 rho_factor Transcripti  70.5     2.2 4.8E-05   33.4   1.1   21   70-90     15-35  (249)
415 CHL00095 clpC Clp protease ATP  70.5     1.8 3.9E-05   38.8   0.7   16   71-86    200-215 (821)
416 PRK11247 ssuB aliphatic sulfon  70.5     2.1 4.6E-05   32.8   1.0   20   69-88     36-55  (257)
417 cd03248 ABCC_TAP TAP, the Tran  70.4     2.2 4.7E-05   31.1   1.0   22   68-89     37-58  (226)
418 TIGR00972 3a0107s01c2 phosphat  70.4     2.2 4.7E-05   31.7   1.0   18   68-85     24-41  (247)
419 TIGR02770 nickel_nikD nickel i  70.4     2.2 4.7E-05   31.4   1.0   18   68-85      9-26  (230)
420 PRK14240 phosphate transporter  70.4     2.2 4.7E-05   31.7   1.0   21   70-90     28-48  (250)
421 PRK13632 cbiO cobalt transport  70.3     2.7 5.9E-05   31.9   1.6   19   69-87     33-51  (271)
422 COG0419 SbcC ATPase involved i  70.1     2.4 5.3E-05   38.1   1.4   19   67-85     21-39  (908)
423 cd03295 ABC_OpuCA_Osmoprotecti  70.0     2.3 4.9E-05   31.5   1.0   21   67-87     23-43  (242)
424 TIGR03411 urea_trans_UrtD urea  70.0     2.2 4.8E-05   31.4   1.0   19   69-87     26-44  (242)
425 PRK10865 protein disaggregatio  70.0     1.9   4E-05   39.2   0.7   16   71-86    199-214 (857)
426 PRK11300 livG leucine/isoleuci  69.9     2.7 5.9E-05   31.2   1.4   19   69-87     29-47  (255)
427 TIGR03740 galliderm_ABC gallid  69.8     2.3   5E-05   31.0   1.0   19   68-86     23-41  (223)
428 TIGR03771 anch_rpt_ABC anchore  69.7     2.2 4.8E-05   31.4   0.9   18   70-87      5-22  (223)
429 cd03275 ABC_SMC1_euk Eukaryoti  69.7     2.5 5.4E-05   31.8   1.2   18   70-87     21-38  (247)
430 KOG2373|consensus               69.7     2.7 5.8E-05   37.1   1.5   24   64-89    268-291 (514)
431 PF00931 NB-ARC:  NB-ARC domain  69.5     1.6 3.4E-05   32.3   0.1   20   70-89     18-37  (287)
432 cd03270 ABC_UvrA_I The excisio  69.4     2.2 4.8E-05   31.8   0.9   21   67-87     17-37  (226)
433 cd03273 ABC_SMC2_euk Eukaryoti  69.4     2.5 5.4E-05   31.7   1.2   18   69-86     23-40  (251)
434 PRK14274 phosphate ABC transpo  69.4     2.3 5.1E-05   31.8   1.0   22   68-89     35-56  (259)
435 PRK11701 phnK phosphonate C-P   69.3     2.4 5.1E-05   31.8   1.0   18   70-87     31-48  (258)
436 cd03290 ABCC_SUR1_N The SUR do  69.2       3 6.5E-05   30.3   1.5   23   68-90     24-46  (218)
437 PTZ00112 origin recognition co  69.2     2.2 4.7E-05   41.0   1.0   49   34-91    752-801 (1164)
438 TIGR01184 ntrCD nitrate transp  69.2     2.4 5.2E-05   31.4   1.0   19   69-87      9-27  (230)
439 PHA02653 RNA helicase NPH-II;   69.2     2.5 5.5E-05   37.8   1.3   60   25-86    125-194 (675)
440 PRK13638 cbiO cobalt transport  69.2     2.4 5.2E-05   32.2   1.0   21   67-87     23-43  (271)
441 COG1618 Predicted nucleotide k  69.1       2 4.4E-05   33.5   0.6   20   73-92      7-26  (179)
442 cd03369 ABCC_NFT1 Domain 2 of   69.1     2.4 5.3E-05   30.5   1.0   19   69-87     32-50  (207)
443 PRK13649 cbiO cobalt transport  69.1     2.4 5.2E-05   32.2   1.0   19   69-87     31-49  (280)
444 PRK12608 transcription termina  69.0     2.4 5.1E-05   36.0   1.0   21   70-90    132-152 (380)
445 PRK04220 2-phosphoglycerate ki  69.0     1.9 4.1E-05   35.3   0.5   17   72-88     93-109 (301)
446 PRK08506 replicative DNA helic  69.0     2.7 5.9E-05   35.5   1.4   29   67-95    188-216 (472)
447 PF10236 DAP3:  Mitochondrial r  68.9     1.6 3.5E-05   34.8   0.1   16   70-85     22-37  (309)
448 KOG0742|consensus               68.8     2.4 5.2E-05   38.1   1.1   17   72-88    385-401 (630)
449 cd03279 ABC_sbcCD SbcCD and ot  68.7     2.7 5.9E-05   30.8   1.2   20   71-90     28-47  (213)
450 cd01918 HprK_C HprK/P, the bif  68.7     2.3 4.9E-05   31.4   0.8   18   70-87     13-30  (149)
451 PHA02624 large T antigen; Prov  68.7       1 2.2E-05   40.8  -1.2   24   69-92    429-452 (647)
452 PRK03695 vitamin B12-transport  68.6     2.5 5.4E-05   31.7   1.0   21   69-89     20-40  (248)
453 cd03217 ABC_FeS_Assembly ABC-t  68.6     2.5 5.5E-05   30.6   1.0   18   69-86     24-41  (200)
454 cd03220 ABC_KpsT_Wzt ABC_KpsT_  68.6     2.5 5.4E-05   31.3   1.0   23   68-90     45-67  (224)
455 cd03216 ABC_Carb_Monos_I This   68.6     2.6 5.6E-05   29.8   1.0   21   67-87     22-42  (163)
456 PRK04132 replication factor C   68.6     3.3 7.1E-05   38.3   1.9   37   36-85     18-54  (846)
457 cd03239 ABC_SMC_head The struc  68.5     3.8 8.3E-05   29.9   1.9   15   71-85     22-36  (178)
458 PRK14261 phosphate ABC transpo  68.5     2.5 5.4E-05   31.5   1.0   23   69-91     30-52  (253)
459 PRK13548 hmuV hemin importer A  68.4     2.5 5.5E-05   31.9   1.0   23   69-91     26-48  (258)
460 PRK10419 nikE nickel transport  68.3     2.5 5.5E-05   32.1   1.0   18   70-87     37-54  (268)
461 PRK08840 replicative DNA helic  68.3     2.8   6E-05   35.6   1.3   26   66-91    212-237 (464)
462 cd03267 ABC_NatA_like Similar   68.2     2.6 5.6E-05   31.4   1.0   22   69-90     45-66  (236)
463 PRK12724 flagellar biosynthesi  68.1     2.5 5.5E-05   36.4   1.1   20   70-89    222-241 (432)
464 cd03242 ABC_RecF RecF is a rec  68.1     2.7 5.8E-05   32.2   1.1   17   69-85     19-35  (270)
465 PRK14250 phosphate ABC transpo  68.1     2.6 5.6E-05   31.4   1.0   19   69-87     27-45  (241)
466 cd03282 ABC_MSH4_euk MutS4 hom  68.1     2.9 6.3E-05   31.4   1.3   18   70-87     28-45  (204)
467 PRK14266 phosphate ABC transpo  68.1     3.3 7.1E-05   30.7   1.5   21   68-88     26-46  (250)
468 cd04114 Rab30 Rab30 subfamily.  68.1     2.2 4.8E-05   28.6   0.6   21   72-92      8-28  (169)
469 TIGR03345 VI_ClpV1 type VI sec  68.0       2 4.3E-05   39.1   0.4   15   72-86    209-223 (852)
470 PRK14249 phosphate ABC transpo  67.9       3 6.6E-05   31.0   1.3   19   67-85     26-44  (251)
471 COG2812 DnaX DNA polymerase II  67.9     1.7 3.6E-05   38.1  -0.1   39   36-86     15-53  (515)
472 PRK09270 nucleoside triphospha  67.9     2.4 5.2E-05   31.6   0.8   21   71-91     33-53  (229)
473 PRK13547 hmuV hemin importer A  67.7     2.6 5.7E-05   32.5   1.0   20   70-89     26-45  (272)
474 PRK10744 pstB phosphate transp  67.7     2.6 5.7E-05   31.7   1.0   23   69-91     37-59  (260)
475 PRK11607 potG putrescine trans  67.7     2.8   6E-05   34.4   1.2   20   67-86     41-60  (377)
476 KOG0064|consensus               67.6     2.9 6.2E-05   38.4   1.4   16   70-85    507-522 (728)
477 PLN02748 tRNA dimethylallyltra  67.6     2.5 5.3E-05   36.5   0.9   17   71-87     22-38  (468)
478 PRK14244 phosphate ABC transpo  67.5     2.7 5.9E-05   31.3   1.0   20   68-87     28-47  (251)
479 TIGR01618 phage_P_loop phage n  67.5     2.4 5.1E-05   32.9   0.7   17   72-88     13-29  (220)
480 KOG1969|consensus               67.5     2.9 6.2E-05   39.2   1.4   19   69-87    324-342 (877)
481 PRK15112 antimicrobial peptide  67.4     2.6 5.7E-05   32.0   1.0   16   70-85     38-53  (267)
482 PRK13648 cbiO cobalt transport  67.4     2.7 5.9E-05   31.8   1.0   19   69-87     33-51  (269)
483 PRK14259 phosphate ABC transpo  67.3     2.7 5.9E-05   32.0   1.0   23   68-90     36-58  (269)
484 PRK10919 ATP-dependent DNA hel  67.2     2.6 5.7E-05   37.0   1.0   15   70-85     15-29  (672)
485 PRK09984 phosphonate/organopho  67.2     2.7 5.9E-05   31.5   1.0   18   69-86     28-45  (262)
486 PRK11831 putative ABC transpor  67.1     2.8 6.1E-05   31.9   1.0   21   68-88     30-50  (269)
487 PRK06749 replicative DNA helic  67.1     3.5 7.6E-05   34.5   1.7   26   66-91    181-206 (428)
488 PRK14241 phosphate transporter  66.7     2.8 6.1E-05   31.4   1.0   21   68-88     27-47  (258)
489 PRK14273 phosphate ABC transpo  66.7     2.9 6.3E-05   31.2   1.0   20   67-86     29-48  (254)
490 CHL00131 ycf16 sulfate ABC tra  66.6     2.9 6.3E-05   31.0   1.0   21   69-89     31-51  (252)
491 PF05970 PIF1:  PIF1-like helic  66.5     2.7 5.8E-05   33.9   0.9   18   70-87     21-38  (364)
492 COG0378 HypB Ni2+-binding GTPa  66.4     2.6 5.7E-05   33.3   0.8   15   72-86     14-28  (202)
493 KOG0729|consensus               66.3     3.2 6.9E-05   35.7   1.3   20   67-86    207-226 (435)
494 PRK14255 phosphate ABC transpo  66.2       3 6.5E-05   31.0   1.0   21   68-88     28-48  (252)
495 cd03294 ABC_Pro_Gly_Bertaine T  66.2       3 6.5E-05   31.8   1.0   22   67-88     46-67  (269)
496 cd03240 ABC_Rad50 The catalyti  66.2     3.3 7.2E-05   30.6   1.3   17   71-87     22-38  (204)
497 PF02562 PhoH:  PhoH-like prote  66.1     3.8 8.2E-05   31.6   1.6   14   72-85     20-33  (205)
498 PRK14087 dnaA chromosomal repl  66.1     2.4 5.2E-05   35.6   0.5   14   72-85    142-155 (450)
499 PRK14253 phosphate ABC transpo  65.9       3 6.6E-05   30.9   1.0   21   68-88     26-46  (249)
500 PRK15056 manganese/iron transp  65.8       3 6.6E-05   31.7   1.0   20   68-87     30-49  (272)

No 1  
>KOG1942|consensus
Probab=99.95  E-value=6.8e-30  Score=212.64  Aligned_cols=83  Identities=49%  Similarity=0.646  Sum_probs=77.4

Q ss_pred             CccceeecceeeeeeccccccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCC
Q psy2779           1 MKIEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRT   80 (101)
Q Consensus         1 ~~i~ev~~~~r~~RIaaHSHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p   80 (101)
                      ++|+||+++.+.+||++||||||||||+.|.|.+.++|||||++|||||||||||       +|++ +++||++|++|||
T Consensus         2 ~~ieeVkst~~~~ria~HsHvkgLGlde~g~~~~~~~g~vGQ~~AReAagiivdl-------ik~K-kmaGravLlaGpp   73 (456)
T KOG1942|consen    2 VKIEEVKSTGRTQRIAAHSHVKGLGLDETGNAVEVAAGFVGQENAREAAGIIVDL-------IKSK-KMAGRAVLLAGPP   73 (456)
T ss_pred             cchhhhcccccchhhhhhhhccccCcCCCCCeeecccccccchhhhhhhhHHHHH-------HHhh-hccCcEEEEecCC
Confidence            5899999999999999999999999999999999999999999999999999999       5554 5689999999999


Q ss_pred             CCC--------------CCCCceee
Q psy2779          81 KCP--------------KPPNTSMI   91 (101)
Q Consensus        81 ~~g--------------~~~~~~~~   91 (101)
                      |||              |.||++|.
T Consensus        74 gtGKTAlAlaisqELG~kvPFcpmv   98 (456)
T KOG1942|consen   74 GTGKTALALAISQELGPKVPFCPMV   98 (456)
T ss_pred             CCchhHHHHHHHHHhCCCCCccccc
Confidence            999              56999986


No 2  
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=99.94  E-value=2.4e-28  Score=204.87  Aligned_cols=74  Identities=35%  Similarity=0.516  Sum_probs=67.5

Q ss_pred             eeeeeeccccccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCC------
Q psy2779          10 VKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCP------   83 (101)
Q Consensus        10 ~r~~RIaaHSHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g------   83 (101)
                      ...+|+++||||||||||+||+|++.++|||||++|||||||||+|       +|+++ ++||.+|++||||||      
T Consensus        12 ~~~~~i~aHSHI~GLGLdeng~~k~~~dG~VGQ~~AReAaGvIv~m-------ik~gk-~aGrgiLi~GppgTGKTAlA~   83 (450)
T COG1224          12 GERERIAAHSHIKGLGLDENGKAKFIGDGLVGQEEAREAAGVIVKM-------IKQGK-MAGRGILIVGPPGTGKTALAM   83 (450)
T ss_pred             chhcccchhccccccccCCCCCEeEcCCcccchHHHHHhhhHHHHH-------HHhCc-ccccEEEEECCCCCcHHHHHH
Confidence            4557999999999999999999999999999999999999999999       66665 589999999999999      


Q ss_pred             --------CCCCceee
Q psy2779          84 --------KPPNTSMI   91 (101)
Q Consensus        84 --------~~~~~~~~   91 (101)
                              ++||++|.
T Consensus        84 gIa~eLG~dvPF~~is   99 (450)
T COG1224          84 GIARELGEDVPFVAIS   99 (450)
T ss_pred             HHHHHhCCCCCceeec
Confidence                    57999885


No 3  
>PF06068 TIP49:  TIP49 C-terminus;  InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the AAA ATPase, central region IPR003959 from INTERPRO domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway []. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities. TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases [].; GO: 0003678 DNA helicase activity, 0005524 ATP binding; PDB: 2XSZ_E 2CQA_A 2C9O_C.
Probab=99.94  E-value=1.6e-28  Score=204.25  Aligned_cols=70  Identities=41%  Similarity=0.577  Sum_probs=53.0

Q ss_pred             eeccccccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCC----------
Q psy2779          14 RISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCP----------   83 (101)
Q Consensus        14 RIaaHSHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g----------   83 (101)
                      ||++||||||||||++++|.+.++|||||++||||||+||||       +|++| ++||++|++||||||          
T Consensus         1 Ri~~HSHI~GLGld~~~~~~~~~~GlVGQ~~AReAagiiv~m-------Ik~~K-~aGr~iLiaGppGtGKTAlA~~ia~   72 (398)
T PF06068_consen    1 RIGAHSHIKGLGLDENGEARYIADGLVGQEKAREAAGIIVDM-------IKEGK-IAGRAILIAGPPGTGKTALAMAIAK   72 (398)
T ss_dssp             HHGCCTT--S--B-TTS-B-SEETTEES-HHHHHHHHHHHHH-------HHTT---TT-EEEEEE-TTSSHHHHHHHHHH
T ss_pred             CcccccccccCCcCCCCCEeeccccccChHHHHHHHHHHHHH-------Hhccc-ccCcEEEEeCCCCCCchHHHHHHHH
Confidence            799999999999999999999999999999999999999999       55554 689999999999999          


Q ss_pred             ----CCCCceee
Q psy2779          84 ----KPPNTSMI   91 (101)
Q Consensus        84 ----~~~~~~~~   91 (101)
                          |+||++|.
T Consensus        73 eLG~~~PF~~is   84 (398)
T PF06068_consen   73 ELGEDVPFVSIS   84 (398)
T ss_dssp             HCTTTS-EEEEE
T ss_pred             HhCCCCCeeEcc
Confidence                58999885


No 4  
>KOG2680|consensus
Probab=99.92  E-value=3.5e-26  Score=190.70  Aligned_cols=81  Identities=30%  Similarity=0.467  Sum_probs=74.6

Q ss_pred             cceeecceeeeeeccccccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCC
Q psy2779           3 IEEVKSTVKTQRISSHSHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKC   82 (101)
Q Consensus         3 i~ev~~~~r~~RIaaHSHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~   82 (101)
                      ..|+++..+.+||++||||+|||||+..+|++.++|||||.+||+|||+|++|     +|.   .+++||++|++|+|||
T Consensus         6 ~~e~rDv~~veri~aHSHI~GlGldd~le~~~~s~GmVGQ~~AR~Aagvi~km-----i~e---gkiaGraiLiaG~pgt   77 (454)
T KOG2680|consen    6 LIEIRDVTRVERIGAHSHIRGLGLDDVLEPRYVSEGMVGQVKARKAAGVILKM-----IRE---GKIAGRAILIAGQPGT   77 (454)
T ss_pred             cccccchhhhhhccchhhccccCCCcccCcccccccchhhHHHHHHhHHHHHH-----HHc---CcccceEEEEecCCCC
Confidence            45788999999999999999999999999999999999999999999999999     555   5679999999999999


Q ss_pred             CC--------------CCCceee
Q psy2779          83 PK--------------PPNTSMI   91 (101)
Q Consensus        83 g~--------------~~~~~~~   91 (101)
                      ||              +||||++
T Consensus        78 GKtAiAmg~sksLG~~tpF~~i~  100 (454)
T KOG2680|consen   78 GKTAIAMGMSKSLGDDTPFTSIS  100 (454)
T ss_pred             CceeeeeehhhhhCCCCceeeee
Confidence            96              6888875


No 5  
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=97.13  E-value=0.00012  Score=61.29  Aligned_cols=44  Identities=16%  Similarity=0.149  Sum_probs=36.4

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccc---cceEEecCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFR---GGRAVAGGRTKCPKP   85 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~---g~~ll~~G~p~~g~~   85 (101)
                      .-+-.||||+|.++|.||++-       .++-.+|+   -+-+|.-||||||||
T Consensus       119 t~ddViGqEeAK~kcrli~~y-------LenPe~Fg~WAPknVLFyGppGTGKT  165 (368)
T COG1223         119 TLDDVIGQEEAKRKCRLIMEY-------LENPERFGDWAPKNVLFYGPPGTGKT  165 (368)
T ss_pred             cHhhhhchHHHHHHHHHHHHH-------hhChHHhcccCcceeEEECCCCccHH
Confidence            446689999999999999988       66655554   578999999999965


No 6  
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=96.58  E-value=0.00091  Score=58.11  Aligned_cols=36  Identities=17%  Similarity=0.123  Sum_probs=30.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-.+||+.||+|+-|               --++|.=||+-||||||||=
T Consensus       178 ~~DV~GQ~~AKrAlei---------------AAAGgHnLl~~GpPGtGKTm  213 (490)
T COG0606         178 FKDVKGQEQAKRALEI---------------AAAGGHNLLLVGPPGTGKTM  213 (490)
T ss_pred             hhhhcCcHHHHHHHHH---------------HHhcCCcEEEecCCCCchHH
Confidence            4568999999999754               34579999999999999973


No 7  
>PF01078 Mg_chelatase:  Magnesium chelatase, subunit ChlI;  InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.
Probab=96.43  E-value=0.00095  Score=51.82  Aligned_cols=34  Identities=21%  Similarity=0.234  Sum_probs=25.1

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      +-.+||+.|++|+-|-               -+++.=||+.||||||||
T Consensus         3 ~dI~GQe~aKrAL~iA---------------AaG~h~lLl~GppGtGKT   36 (206)
T PF01078_consen    3 SDIVGQEEAKRALEIA---------------AAGGHHLLLIGPPGTGKT   36 (206)
T ss_dssp             CCSSSTHHHHHHHHHH---------------HHCC--EEEES-CCCTHH
T ss_pred             hhhcCcHHHHHHHHHH---------------HcCCCCeEEECCCCCCHH
Confidence            4579999999998653               335778999999999985


No 8  
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=96.39  E-value=0.00072  Score=51.27  Aligned_cols=45  Identities=16%  Similarity=0.056  Sum_probs=29.9

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      -+.||||++..+.....++.       .+... -.-.-+|+.||||||||-..
T Consensus         3 ~~~~iG~~~~~~~l~~~l~~-------~~~~~-~~~~~~ll~Gp~G~GKT~la   47 (305)
T TIGR00635         3 LAEFIGQEKVKEQLQLFIEA-------AKMRQ-EALDHLLLYGPPGLGKTTLA   47 (305)
T ss_pred             HHHHcCHHHHHHHHHHHHHH-------HHhcC-CCCCeEEEECCCCCCHHHHH
Confidence            45799999999986665554       11111 01234789999999998543


No 9  
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=96.02  E-value=0.0015  Score=54.34  Aligned_cols=45  Identities=18%  Similarity=0.292  Sum_probs=29.3

Q ss_pred             cccchHHHHhhcceeeecccceeeeeccc------cccccceEEecCCCCCCCC
Q psy2779          38 GLVGQQAAREVSRAVTWEKSFQFERCKSH------SLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        38 GlVGQ~~AREAaGIVVdm~~~~~~~~~~~------~~~~g~~ll~~G~p~~g~~   85 (101)
                      =+|||+.|.++.-+-|--   .+.|++..      --...+-+|+.||||||||
T Consensus        72 ~ViGq~~ak~~l~~av~~---~~~r~~~~~~~~~~~~~~~~~iLl~Gp~GtGKT  122 (412)
T PRK05342         72 YVIGQERAKKVLSVAVYN---HYKRLRHGDKKDDDVELQKSNILLIGPTGSGKT  122 (412)
T ss_pred             HeeChHHHHHHHHHHHHH---HHHhhhcccccccccccCCceEEEEcCCCCCHH
Confidence            479999999998765521   11223211      1123466889999999986


No 10 
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=95.94  E-value=0.002  Score=50.33  Aligned_cols=44  Identities=14%  Similarity=0.083  Sum_probs=32.0

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..+-||||++..++....++.       .+..+. .-..+|+.||||||||-
T Consensus        23 ~~~~~vG~~~~~~~l~~~l~~-------~~~~~~-~~~~~ll~GppG~GKT~   66 (328)
T PRK00080         23 SLDEFIGQEKVKENLKIFIEA-------AKKRGE-ALDHVLLYGPPGLGKTT   66 (328)
T ss_pred             CHHHhcCcHHHHHHHHHHHHH-------HHhcCC-CCCcEEEECCCCccHHH
Confidence            457799999999998777765       211111 23568899999999984


No 11 
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=95.93  E-value=0.001  Score=50.45  Aligned_cols=53  Identities=9%  Similarity=0.007  Sum_probs=30.4

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccc--cceEEecCCCCCCCCCCce
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFR--GGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~--g~~ll~~G~p~~g~~~~~~   89 (101)
                      +.|||++++.++.-=++.....+..|.+.+....  ..-+|+.||||||||-...
T Consensus         6 ~~~~Gl~~vk~~i~~~~~~~~~~~~~~~~g~~~~~~~~~vll~GppGtGKTtlA~   60 (261)
T TIGR02881         6 SRMVGLDEVKALIKEIYAWIQINEKRKEEGLKTSKQVLHMIFKGNPGTGKTTVAR   60 (261)
T ss_pred             HHhcChHHHHHHHHHHHHHHHHHHHHHHcCCCCCCCcceEEEEcCCCCCHHHHHH
Confidence            5689999998877544333111111221111112  2356899999999986543


No 12 
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=95.91  E-value=0.0019  Score=51.40  Aligned_cols=48  Identities=10%  Similarity=0.031  Sum_probs=31.0

Q ss_pred             CCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          30 GEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        30 g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..|. +-+-||||++..+-..+..+.       ++..+. .=--+|+.||||||||-
T Consensus        18 lRP~-~L~efiGQ~~l~~~l~i~i~a-------a~~r~~-~l~h~lf~GPPG~GKTT   65 (233)
T PF05496_consen   18 LRPK-SLDEFIGQEHLKGNLKILIRA-------AKKRGE-ALDHMLFYGPPGLGKTT   65 (233)
T ss_dssp             TS-S-SCCCS-S-HHHHHHHHHHHHH-------HHCTTS----EEEEESSTTSSHHH
T ss_pred             cCCC-CHHHccCcHHHHhhhHHHHHH-------HHhcCC-CcceEEEECCCccchhH
Confidence            4444 367899999999999988887       321110 01247899999999964


No 13 
>PRK13342 recombination factor protein RarA; Reviewed
Probab=95.61  E-value=0.0032  Score=51.14  Aligned_cols=41  Identities=12%  Similarity=0.060  Sum_probs=31.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+++-+..+++..+       +++..   -..+|+.||||||||-
T Consensus        11 l~d~vGq~~~v~~~~~L~~~-------i~~~~---~~~ilL~GppGtGKTt   51 (413)
T PRK13342         11 LDEVVGQEHLLGPGKPLRRM-------IEAGR---LSSMILWGPPGTGKTT   51 (413)
T ss_pred             HHHhcCcHHHhCcchHHHHH-------HHcCC---CceEEEECCCCCCHHH
Confidence            45699999988777778777       54444   2367889999999974


No 14 
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=95.59  E-value=0.004  Score=53.43  Aligned_cols=48  Identities=15%  Similarity=0.163  Sum_probs=30.6

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeecc----ccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKS----HSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~----~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-+|||.+|.+|.-+.+-.   .|.|..-    ..-...+-+|+.||||||||-
T Consensus        11 d~~IiGQ~eAkk~lsvAl~n---~~~r~~~~~~~~~e~~p~~ILLiGppG~GKT~   62 (441)
T TIGR00390        11 DKYIIGQDNAKKSVAIALRN---RYRRSQLNEELKDEVTPKNILMIGPTGVGKTE   62 (441)
T ss_pred             hhhccCHHHHHHHHHHHHHh---hhhhhccccccccccCCceEEEECCCCCCHHH
Confidence            35589999999999776654   1111110    001123567899999999863


No 15 
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=95.47  E-value=0.0039  Score=42.72  Aligned_cols=41  Identities=20%  Similarity=0.149  Sum_probs=21.1

Q ss_pred             ccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCce
Q psy2779          39 LVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        39 lVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      |||-++..+..-=.+++       .+++.   ++.+++.|++|||||=...
T Consensus         2 fvgR~~e~~~l~~~l~~-------~~~~~---~~~~ll~G~~G~GKT~ll~   42 (185)
T PF13191_consen    2 FVGREEEIERLRDLLDA-------AQSGS---PRNLLLTGESGSGKTSLLR   42 (185)
T ss_dssp             -TT-HHHHHHHHHTTGG-------TSS--------EEE-B-TTSSHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHH-------HHcCC---CcEEEEECCCCCCHHHHHH
Confidence            56666666655444444       43333   6899999999999985543


No 16 
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=95.31  E-value=0.0072  Score=50.81  Aligned_cols=49  Identities=16%  Similarity=0.216  Sum_probs=30.2

Q ss_pred             cCcccchHHHHhhcceeeecccceeeee-cccc-----ccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERC-KSHS-----LFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~-~~~~-----~~~g~~ll~~G~p~~g~~   85 (101)
                      ..=.|||++|.++.-+.|-- ++.-++. +...     -.....+|+.||||||||
T Consensus        76 ~~~ViGQe~A~~~l~~av~~-h~~~~~~~~~~~~~~~~~~~~~~iLL~GP~GsGKT  130 (413)
T TIGR00382        76 DEYVIGQEQAKKVLSVAVYN-HYKRLNFEKNKKSDNGVELSKSNILLIGPTGSGKT  130 (413)
T ss_pred             cceecCHHHHHHHHHHHHHH-HHhhhccccccccccccccCCceEEEECCCCcCHH
Confidence            34479999999998776621 0000111 0011     123567899999999986


No 17 
>PRK06893 DNA replication initiation factor; Validated
Probab=95.27  E-value=0.009  Score=44.84  Aligned_cols=51  Identities=8%  Similarity=-0.121  Sum_probs=32.3

Q ss_pred             CCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          26 LKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        26 Lde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      |+=...+....+-||+|.++.-+..+.-.+     .   +   .....+++.||||||||-.
T Consensus         5 l~~~~~~~~~fd~f~~~~~~~~~~~~~~~~-----~---~---~~~~~l~l~G~~G~GKThL   55 (229)
T PRK06893          5 LPIHQIDDETLDNFYADNNLLLLDSLRKNF-----I---D---LQQPFFYIWGGKSSGKSHL   55 (229)
T ss_pred             cCCCCCCcccccccccCChHHHHHHHHHHh-----h---c---cCCCeEEEECCCCCCHHHH
Confidence            343344566778899888876554443222     1   1   1245689999999999843


No 18 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=95.23  E-value=0.009  Score=37.67  Aligned_cols=26  Identities=12%  Similarity=-0.001  Sum_probs=19.9

Q ss_pred             ccceEEecCCCCCCCCCCceeeeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      .++.+++.||||||||-....+.+.|
T Consensus        18 ~~~~v~i~G~~G~GKT~l~~~i~~~~   43 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANEL   43 (151)
T ss_pred             CCCeEEEECCCCCCHHHHHHHHHHHh
Confidence            46789999999999997655555444


No 19 
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=95.22  E-value=0.0053  Score=42.75  Aligned_cols=13  Identities=15%  Similarity=0.107  Sum_probs=10.6

Q ss_pred             eEEecCCCCCCCC
Q psy2779          73 RAVAGGRTKCPKP   85 (101)
Q Consensus        73 ~ll~~G~p~~g~~   85 (101)
                      +.|+.||||||||
T Consensus        19 ~~~i~GpPGTGKT   31 (236)
T PF13086_consen   19 ITLIQGPPGTGKT   31 (236)
T ss_dssp             -EEEE-STTSSHH
T ss_pred             CEEEECCCCCChH
Confidence            6899999999998


No 20 
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=95.17  E-value=0.0065  Score=45.81  Aligned_cols=25  Identities=20%  Similarity=0.109  Sum_probs=21.9

Q ss_pred             cccccccceEEecCCCCCCCCCCce
Q psy2779          65 SHSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        65 ~~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .+....|+.+|+.|+||||||.|+.
T Consensus        17 ~GG~p~g~~~lI~G~pGsGKT~f~~   41 (260)
T COG0467          17 GGGLPRGSVVLITGPPGTGKTIFAL   41 (260)
T ss_pred             cCCCcCCcEEEEEcCCCCcHHHHHH
Confidence            4677889999999999999998864


No 21 
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=94.90  E-value=0.01  Score=48.97  Aligned_cols=51  Identities=14%  Similarity=0.149  Sum_probs=35.1

Q ss_pred             CCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCceee
Q psy2779          28 ENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        28 e~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +.-.+.+...-+|||++++.|.-+-.--          .+.  |+ +|+.|++||||+-+-.++
T Consensus         8 ~~~~~~~pf~~ivGq~~~k~al~~~~~~----------p~~--~~-vli~G~~GtGKs~~ar~~   58 (350)
T CHL00081          8 KKERPVFPFTAIVGQEEMKLALILNVID----------PKI--GG-VMIMGDRGTGKSTTIRAL   58 (350)
T ss_pred             hccCCCCCHHHHhChHHHHHHHHHhccC----------CCC--Ce-EEEEcCCCCCHHHHHHHH
Confidence            3344566778899999999997654322          232  44 559999999997655443


No 22 
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=94.89  E-value=0.011  Score=48.19  Aligned_cols=37  Identities=16%  Similarity=0.153  Sum_probs=27.5

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .+-+|||+.+++|+-+-.-.             .+++-+|+.|+||||||
T Consensus         7 f~~i~Gq~~~~~~l~~~~~~-------------~~~~~vLl~G~pG~gKT   43 (334)
T PRK13407          7 FSAIVGQEEMKQAMVLTAID-------------PGIGGVLVFGDRGTGKS   43 (334)
T ss_pred             HHHhCCHHHHHHHHHHHHhc-------------cCCCcEEEEcCCCCCHH
Confidence            45689999999998763221             12345889999999996


No 23 
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.70  E-value=0.011  Score=47.34  Aligned_cols=39  Identities=10%  Similarity=0.038  Sum_probs=27.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+.+|||+.+.+..   ..+       ++.++.  -.++|+.||||||||-
T Consensus        15 ~~~iiGq~~~~~~l---~~~-------~~~~~~--~h~~L~~Gp~G~GKTt   53 (363)
T PRK14961         15 FRDIIGQKHIVTAI---SNG-------LSLGRI--HHAWLLSGTRGVGKTT   53 (363)
T ss_pred             hhhccChHHHHHHH---HHH-------HHcCCC--CeEEEEecCCCCCHHH
Confidence            56799999998874   233       222222  3468999999999984


No 24 
>PF13245 AAA_19:  Part of AAA domain
Probab=94.65  E-value=0.015  Score=37.83  Aligned_cols=16  Identities=19%  Similarity=0.038  Sum_probs=13.9

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      ..+.+++.||||||||
T Consensus         9 ~~~~~vv~g~pGtGKT   24 (76)
T PF13245_consen    9 GSPLFVVQGPPGTGKT   24 (76)
T ss_pred             hCCeEEEECCCCCCHH
Confidence            3677888999999998


No 25 
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.57  E-value=0.0097  Score=50.37  Aligned_cols=40  Identities=18%  Similarity=0.180  Sum_probs=27.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      -+-+|||+.+.+..   ..+       +++++.  ...+|+.||||||||-.
T Consensus        13 ~~divGq~~i~~~L---~~~-------i~~~~l--~~~~Lf~GPpGtGKTTl   52 (472)
T PRK14962         13 FSEVVGQDHVKKLI---INA-------LKKNSI--SHAYIFAGPRGTGKTTV   52 (472)
T ss_pred             HHHccCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHHHH
Confidence            45699999986643   334       333332  34588999999999754


No 26 
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.55  E-value=0.011  Score=47.99  Aligned_cols=39  Identities=13%  Similarity=0.124  Sum_probs=27.8

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+.   +..+       ++++++  .-++|+.|||||||+.
T Consensus        15 ~~eiiGq~~~~~~---L~~~-------~~~~~~--~ha~lf~Gp~G~GKtt   53 (397)
T PRK14955         15 FADITAQEHITRT---IQNS-------LRMGRV--GHGYIFSGLRGVGKTT   53 (397)
T ss_pred             HhhccChHHHHHH---HHHH-------HHhCCc--ceeEEEECCCCCCHHH
Confidence            4678999999874   3444       333332  4568899999999974


No 27 
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=94.43  E-value=0.014  Score=48.78  Aligned_cols=42  Identities=17%  Similarity=0.023  Sum_probs=27.1

Q ss_pred             cccchHHHHhhcceeeecccceeeeeccc-cccccceEEecCCCCCCCCCC
Q psy2779          38 GLVGQQAAREVSRAVTWEKSFQFERCKSH-SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        38 GlVGQ~~AREAaGIVVdm~~~~~~~~~~~-~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      -++||++|.+..  |-.+      +.... ..-.+++|++.|||||||+-+
T Consensus        52 ~~~G~~~~i~~l--v~~l------~~~a~g~~~~r~il~L~GPPGsGKStl   94 (361)
T smart00763       52 DFFGMEEAIERF--VNYF------KSAAQGLEERKQILYLLGPVGGGKSSL   94 (361)
T ss_pred             hccCcHHHHHHH--HHHH------HHHHhcCCCCCcEEEEECCCCCCHHHH
Confidence            699999986542  2222      22111 122468999999999999754


No 28 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=94.31  E-value=0.018  Score=43.66  Aligned_cols=38  Identities=13%  Similarity=0.039  Sum_probs=25.1

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      -+.++||..+++...-.+.-           +.  -..+|+.||||||||-
T Consensus        14 ~~~~~g~~~~~~~L~~~~~~-----------~~--~~~lll~Gp~GtGKT~   51 (337)
T PRK12402         14 LEDILGQDEVVERLSRAVDS-----------PN--LPHLLVQGPPGSGKTA   51 (337)
T ss_pred             HHHhcCCHHHHHHHHHHHhC-----------CC--CceEEEECCCCCCHHH
Confidence            46689999987764322221           11  1258899999999973


No 29 
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=94.28  E-value=0.012  Score=48.82  Aligned_cols=67  Identities=12%  Similarity=-0.022  Sum_probs=37.6

Q ss_pred             cccccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          19 SHVKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        19 SHIkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.|.-+.+.+  .|...-+-+.|.+...+..--.+++--......+....-..+-+|+.||||||||-.
T Consensus       129 ~~~~~~~~~~--~p~v~~~digGl~~~k~~l~~~v~~pl~~~~~~~~~Gl~~pkgvLL~GppGTGKT~L  195 (398)
T PTZ00454        129 SSIQLLQMSE--KPDVTYSDIGGLDIQKQEIREAVELPLTCPELYEQIGIDPPRGVLLYGPPGTGKTML  195 (398)
T ss_pred             chhhhhcccC--CCCCCHHHcCCHHHHHHHHHHHHHHHhcCHHHHHhcCCCCCceEEEECCCCCCHHHH
Confidence            3344445544  234445568888888877665555400000011111333467788999999999754


No 30 
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.18  E-value=0.018  Score=49.70  Aligned_cols=39  Identities=18%  Similarity=0.089  Sum_probs=27.7

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+.   +..+       ++++++  +.++|+.||||||||-
T Consensus        17 f~dvVGQe~iv~~---L~~~-------i~~~ri--~ha~Lf~GP~GtGKTT   55 (484)
T PRK14956         17 FRDVIHQDLAIGA---LQNA-------LKSGKI--GHAYIFFGPRGVGKTT   55 (484)
T ss_pred             HHHHhChHHHHHH---HHHH-------HHcCCC--CeEEEEECCCCCCHHH
Confidence            4679999999876   2233       333332  4578999999999984


No 31 
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=94.01  E-value=0.0095  Score=46.57  Aligned_cols=52  Identities=12%  Similarity=-0.026  Sum_probs=28.1

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccc--cccceEEecCCCCCCCCCCc
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSL--FRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~--~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +-|||++.+.+..-=++.+-..+-.|.+-+-.  ..+.-+|+.||||||||-..
T Consensus        22 ~~l~Gl~~vk~~i~e~~~~~~~~~~r~~~g~~~~~~~~~vll~G~pGTGKT~lA   75 (284)
T TIGR02880        22 RELIGLKPVKTRIREIAALLLVERLRQRLGLASAAPTLHMSFTGNPGTGKTTVA   75 (284)
T ss_pred             HhccCHHHHHHHHHHHHHHHHHHHHHHHhCCCcCCCCceEEEEcCCCCCHHHHH
Confidence            46899888888753333320000011110100  02345889999999998643


No 32 
>PRK04195 replication factor C large subunit; Provisional
Probab=93.84  E-value=0.019  Score=47.63  Aligned_cols=46  Identities=15%  Similarity=0.125  Sum_probs=29.1

Q ss_pred             CcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          31 EANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        31 ~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .|.. .+-+|||+++.+..--.++-  ++     .+.  ..+.+|+.||||||||-
T Consensus         9 rP~~-l~dlvg~~~~~~~l~~~l~~--~~-----~g~--~~~~lLL~GppG~GKTt   54 (482)
T PRK04195          9 RPKT-LSDVVGNEKAKEQLREWIES--WL-----KGK--PKKALLLYGPPGVGKTS   54 (482)
T ss_pred             CCCC-HHHhcCCHHHHHHHHHHHHH--Hh-----cCC--CCCeEEEECCCCCCHHH
Confidence            3444 34599999998764322221  11     111  16789999999999983


No 33 
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=93.81  E-value=0.03  Score=40.26  Aligned_cols=23  Identities=17%  Similarity=0.021  Sum_probs=19.2

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +.+..|.+.++.||||||||=+.
T Consensus         7 GGi~~g~i~~i~G~~GsGKT~l~   29 (209)
T TIGR02237         7 GGVERGTITQIYGPPGSGKTNIC   29 (209)
T ss_pred             CCCCCCeEEEEECCCCCCHHHHH
Confidence            45667899999999999998653


No 34 
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=93.79  E-value=0.019  Score=49.47  Aligned_cols=50  Identities=12%  Similarity=0.064  Sum_probs=30.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeec--cccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCK--SHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~--~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-+|||++|.+|+-+-+-- .+...+..  ...-...+-+|+.||||||||.
T Consensus        14 d~~IiGQe~AkkalavAl~~-~~~r~~l~~~~~~e~~~~~ILliGp~G~GKT~   65 (443)
T PRK05201         14 DKYIIGQDDAKRAVAIALRN-RWRRMQLPEELRDEVTPKNILMIGPTGVGKTE   65 (443)
T ss_pred             ccccCCHHHHHHHHHHHHHH-HHHHhcCCcccccccCCceEEEECCCCCCHHH
Confidence            45699999999998765521 00000000  0011124568899999999874


No 35 
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=93.76  E-value=0.025  Score=48.75  Aligned_cols=17  Identities=18%  Similarity=0.243  Sum_probs=14.7

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      ..++|||+||||||||-
T Consensus        44 ~~~iLlLtGP~G~GKtt   60 (519)
T PF03215_consen   44 PKRILLLTGPSGCGKTT   60 (519)
T ss_pred             CcceEEEECCCCCCHHH
Confidence            46799999999999874


No 36 
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=93.69  E-value=0.022  Score=42.79  Aligned_cols=25  Identities=8%  Similarity=-0.013  Sum_probs=21.0

Q ss_pred             cccccccceEEecCCCCCCCCCCce
Q psy2779          65 SHSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        65 ~~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .+....|..+|+.|+||||||.+..
T Consensus        15 ~GG~~~gs~~lI~G~pGsGKT~la~   39 (237)
T TIGR03877        15 HGGIPERNVVLLSGGPGTGKSIFSQ   39 (237)
T ss_pred             cCCCcCCeEEEEEcCCCCCHHHHHH
Confidence            3466679999999999999998764


No 37 
>PF13654 AAA_32:  AAA domain; PDB: 3K1J_B.
Probab=93.65  E-value=0.019  Score=49.33  Aligned_cols=47  Identities=15%  Similarity=0.079  Sum_probs=0.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCceeeeee
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDS   94 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~~~~~~   94 (101)
                      ..++|||+.|.+|...=++|       -     ..|==+.+.|+|||||.-++.-.+..
T Consensus         7 ~~~~iGQ~RA~~Al~~gl~i-------~-----~~GYNIfv~G~~GtGr~t~v~~~l~~   53 (509)
T PF13654_consen    7 LEGIIGQERAVEALEFGLGI-------R-----KPGYNIFVMGPPGTGRRTYVRRFLEE   53 (509)
T ss_dssp             -----------------------------------------------------------
T ss_pred             cccccccccccccccccccc-------c-----cccccccccccccccccccccccccc
Confidence            47999999999999999999       1     13667889999999998877655543


No 38 
>PLN03025 replication factor C subunit; Provisional
Probab=93.59  E-value=0.027  Score=44.02  Aligned_cols=37  Identities=14%  Similarity=0.107  Sum_probs=25.2

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      -+-+|||+++.+..-   .+       +++.+   -.-+|+.||||||||
T Consensus        12 l~~~~g~~~~~~~L~---~~-------~~~~~---~~~lll~Gp~G~GKT   48 (319)
T PLN03025         12 LDDIVGNEDAVSRLQ---VI-------ARDGN---MPNLILSGPPGTGKT   48 (319)
T ss_pred             HHHhcCcHHHHHHHH---HH-------HhcCC---CceEEEECCCCCCHH
Confidence            466899999887643   22       22222   124789999999998


No 39 
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=93.45  E-value=0.02  Score=47.59  Aligned_cols=51  Identities=14%  Similarity=0.042  Sum_probs=29.8

Q ss_pred             cccccCcccchHHHHhhcceeeec-ccce-eeeeccccccccceEEecCCCCCCCC
Q psy2779          32 ANEMAAGLVGQQAAREVSRAVTWE-KSFQ-FERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        32 a~~~a~GlVGQ~~AREAaGIVVdm-~~~~-~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      +...-+-++|++++++...=+++. +..+ |.+. ..+  .-+-+|+.||||||||
T Consensus        50 ~~~~~~di~g~~~~k~~l~~~~~~l~~~~~~~~~-g~~--~~~giLL~GppGtGKT  102 (495)
T TIGR01241        50 PKVTFKDVAGIDEAKEELMEIVDFLKNPSKFTKL-GAK--IPKGVLLVGPPGTGKT  102 (495)
T ss_pred             CCCCHHHhCCHHHHHHHHHHHHHHHHCHHHHHhc-CCC--CCCcEEEECCCCCCHH
Confidence            444556789999998776544443 1110 1111 011  1234789999999997


No 40 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=93.39  E-value=0.039  Score=42.68  Aligned_cols=49  Identities=18%  Similarity=0.091  Sum_probs=30.5

Q ss_pred             CcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          31 EANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        31 ~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .+.+...-|+|+++.-+..--.+.-       +.++.  ....+++.||||||||-..
T Consensus         9 ~~~~~p~~l~gRe~e~~~l~~~l~~-------~~~~~--~~~~i~I~G~~GtGKT~l~   57 (365)
T TIGR02928         9 EPDYVPDRIVHRDEQIEELAKALRP-------ILRGS--RPSNVFIYGKTGTGKTAVT   57 (365)
T ss_pred             CCCCCCCCCCCcHHHHHHHHHHHHH-------HHcCC--CCCcEEEECCCCCCHHHHH
Confidence            3445556789998877664332221       11112  2457899999999998544


No 41 
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=93.36  E-value=0.041  Score=42.31  Aligned_cols=28  Identities=7%  Similarity=-0.142  Sum_probs=22.1

Q ss_pred             cccccccceEEecCCCCCCCCCCceeee
Q psy2779          65 SHSLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        65 ~~~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+....|.+.|+.|+||||||=|....+
T Consensus        30 ~GGip~gs~~lI~G~pGtGKT~l~~qf~   57 (259)
T TIGR03878        30 LGGIPAYSVINITGVSDTGKSLMVEQFA   57 (259)
T ss_pred             CCCeECCcEEEEEcCCCCCHHHHHHHHH
Confidence            3455668899999999999998776543


No 42 
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=93.35  E-value=0.02  Score=37.48  Aligned_cols=18  Identities=17%  Similarity=0.017  Sum_probs=11.4

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .++.+++.|+||||||=.
T Consensus         3 ~~~~~~i~G~~G~GKT~~   20 (131)
T PF13401_consen    3 SQRILVISGPPGSGKTTL   20 (131)
T ss_dssp             ----EEEEE-TTSSHHHH
T ss_pred             CCcccEEEcCCCCCHHHH
Confidence            367899999999999843


No 43 
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=93.33  E-value=0.03  Score=47.96  Aligned_cols=46  Identities=17%  Similarity=0.294  Sum_probs=30.5

Q ss_pred             CcccchHHHHhhcceeeecccceeeeecccc-----ccccceEEecCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHS-----LFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~-----~~~g~~ll~~G~p~~g~~   85 (101)
                      +=.|||+.|.++..+-|==   .|-|+.+..     -.+.--+|+-||||||||
T Consensus        61 ~YVIGQe~AKKvLsVAVYN---HYKRl~~~~~~~dvEL~KSNILLiGPTGsGKT  111 (408)
T COG1219          61 EYVIGQEQAKKVLSVAVYN---HYKRLNNKEDNDDVELSKSNILLIGPTGSGKT  111 (408)
T ss_pred             hheecchhhhceeeeeehh---HHHHHhccCCCCceeeeeccEEEECCCCCcHH
Confidence            3468999999998887743   223332211     134455778999999987


No 44 
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=93.23  E-value=0.044  Score=39.76  Aligned_cols=25  Identities=16%  Similarity=0.007  Sum_probs=20.2

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +.+..|.++++.|+||||||=+...
T Consensus        14 GGi~~g~i~~i~G~~GsGKT~l~~~   38 (218)
T cd01394          14 GGVERGTVTQVYGPPGTGKTNIAIQ   38 (218)
T ss_pred             CCccCCeEEEEECCCCCCHHHHHHH
Confidence            4566789999999999999866443


No 45 
>TIGR00764 lon_rel lon-related putative ATP-dependent protease. Members of this family from Pyrococcus horikoshii and Pyrococcus abyssi each contain a predicted intein.
Probab=93.23  E-value=0.032  Score=48.55  Aligned_cols=41  Identities=15%  Similarity=0.178  Sum_probs=30.8

Q ss_pred             cccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          32 ANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        32 a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      |..-.+-++||++|.+++-..+..               ++-+|+.||||||||=.
T Consensus        13 ~~~~~~~viG~~~a~~~l~~a~~~---------------~~~~ll~G~pG~GKT~l   53 (608)
T TIGR00764        13 PERLIDQVIGQEEAVEIIKKAAKQ---------------KRNVLLIGEPGVGKSML   53 (608)
T ss_pred             chhhHhhccCHHHHHHHHHHHHHc---------------CCCEEEECCCCCCHHHH
Confidence            345566789999999987665554               34677999999999843


No 46 
>KOG0734|consensus
Probab=93.21  E-value=0.036  Score=50.26  Aligned_cols=57  Identities=18%  Similarity=0.194  Sum_probs=41.0

Q ss_pred             ccccCCCCCCcccc----cCcccchHHHHhhcceeeecccceeeeecccccc---ccc---eEEecCCCCCCCC
Q psy2779          22 KGLGLKENGEANEM----AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLF---RGG---RAVAGGRTKCPKP   85 (101)
Q Consensus        22 kGLGLde~g~a~~~----a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~---~g~---~ll~~G~p~~g~~   85 (101)
                      .++||+..-.+...    ..-.-|-.+|+.-..=|||.       .|+-.+|   +|+   =+|+.||||||||
T Consensus       285 ~~~gl~~ev~p~~~~nv~F~dVkG~DEAK~ELeEiVef-------LkdP~kftrLGGKLPKGVLLvGPPGTGKT  351 (752)
T KOG0734|consen  285 STTGLDSEVDPEQMKNVTFEDVKGVDEAKQELEEIVEF-------LKDPTKFTRLGGKLPKGVLLVGPPGTGKT  351 (752)
T ss_pred             cccccccccChhhhcccccccccChHHHHHHHHHHHHH-------hcCcHHhhhccCcCCCceEEeCCCCCchh
Confidence            46777766665543    45567889999999999998       5555444   332   3679999999987


No 47 
>TIGR00763 lon ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock.
Probab=93.13  E-value=0.029  Score=49.61  Aligned_cols=43  Identities=14%  Similarity=0.043  Sum_probs=27.3

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.+||+++.+..--.+..      + +......|..+|+.||||||||-
T Consensus       320 ~~~~G~~~~k~~i~~~~~~------~-~~~~~~~~~~lll~GppG~GKT~  362 (775)
T TIGR00763       320 EDHYGLKKVKERILEYLAV------Q-KLRGKMKGPILCLVGPPGVGKTS  362 (775)
T ss_pred             hhcCChHHHHHHHHHHHHH------H-HhhcCCCCceEEEECCCCCCHHH
Confidence            3478999998874322111      0 01122346789999999999974


No 48 
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=93.06  E-value=0.031  Score=42.66  Aligned_cols=41  Identities=10%  Similarity=-0.040  Sum_probs=28.0

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.+-+|||+..++..-   ..       +++++.  -.++|+.||||+|||-.
T Consensus        19 ~~~~~~~~~~~~~~l~---~~-------~~~~~~--~~~lll~G~~G~GKT~l   59 (316)
T PHA02544         19 TIDECILPAADKETFK---SI-------VKKGRI--PNMLLHSPSPGTGKTTV   59 (316)
T ss_pred             cHHHhcCcHHHHHHHH---HH-------HhcCCC--CeEEEeeCcCCCCHHHH
Confidence            4577999999988532   22       222221  35788899999999854


No 49 
>KOG0744|consensus
Probab=93.03  E-value=0.049  Score=46.83  Aligned_cols=19  Identities=11%  Similarity=0.018  Sum_probs=15.9

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.-.|.+|+.||||||||-
T Consensus       174 It~NRliLlhGPPGTGKTS  192 (423)
T KOG0744|consen  174 ITWNRLILLHGPPGTGKTS  192 (423)
T ss_pred             eeeeeEEEEeCCCCCChhH
Confidence            3347899999999999984


No 50 
>KOG1970|consensus
Probab=92.95  E-value=0.055  Score=48.59  Aligned_cols=21  Identities=14%  Similarity=0.224  Sum_probs=18.2

Q ss_pred             ccccccceEEecCCCCCCCCC
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+.+++++||++||+||||+-
T Consensus       105 ~~~l~~~iLLltGPsGcGKST  125 (634)
T KOG1970|consen  105 TPKLGSRILLLTGPSGCGKST  125 (634)
T ss_pred             ccCCCceEEEEeCCCCCCchh
Confidence            366789999999999999973


No 51 
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=92.88  E-value=0.035  Score=42.66  Aligned_cols=40  Identities=13%  Similarity=0.106  Sum_probs=26.9

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      -+-+|||+++.+..-   ..       +++++.  ..++|+.||||+|||..
T Consensus        13 ~~~iig~~~~~~~l~---~~-------~~~~~~--~~~~Ll~G~~G~GKt~~   52 (355)
T TIGR02397        13 FEDVIGQEHIVQTLK---NA-------IKNGRI--AHAYLFSGPRGTGKTSI   52 (355)
T ss_pred             HhhccCcHHHHHHHH---HH-------HHcCCC--CeEEEEECCCCCCHHHH
Confidence            345799999987432   22       233332  45789999999999743


No 52 
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional
Probab=92.84  E-value=0.038  Score=51.40  Aligned_cols=39  Identities=18%  Similarity=0.126  Sum_probs=28.7

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+.   +.++       ++.+++  ..++|+.||||||||-
T Consensus        15 FddIIGQe~Iv~~---Lkna-------I~~~rl--~HAyLFtGPpGtGKTT   53 (944)
T PRK14949         15 FEQMVGQSHVLHA---LTNA-------LTQQRL--HHAYLFTGTRGVGKTS   53 (944)
T ss_pred             HHHhcCcHHHHHH---HHHH-------HHhCCC--CeEEEEECCCCCCHHH
Confidence            4679999999887   3344       444443  5677899999999983


No 53 
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=92.75  E-value=0.038  Score=40.42  Aligned_cols=23  Identities=13%  Similarity=0.167  Sum_probs=19.4

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +....|..+|+.|+||||||-|.
T Consensus        14 GGip~gs~~li~G~~GsGKT~l~   36 (226)
T PF06745_consen   14 GGIPKGSVVLISGPPGSGKTTLA   36 (226)
T ss_dssp             TSEETTSEEEEEESTTSSHHHHH
T ss_pred             CCCCCCcEEEEEeCCCCCcHHHH
Confidence            45677999999999999998654


No 54 
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit. A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.
Probab=92.69  E-value=0.046  Score=47.45  Aligned_cols=37  Identities=19%  Similarity=0.293  Sum_probs=26.6

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-+|||+.+++|+-+..--          .+ . |. +|+.|+|||||+=
T Consensus         4 ~~ivGq~~~~~al~~~av~----------~~-~-g~-vli~G~~GtgKs~   40 (633)
T TIGR02442         4 TAIVGQEDLKLALLLNAVD----------PR-I-GG-VLIRGEKGTAKST   40 (633)
T ss_pred             chhcChHHHHHHHHHHhhC----------CC-C-Ce-EEEEcCCCCcHHH
Confidence            4689999999998544322          12 2 33 8899999999963


No 55 
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=92.67  E-value=0.036  Score=47.87  Aligned_cols=52  Identities=13%  Similarity=0.106  Sum_probs=38.9

Q ss_pred             CCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCce
Q psy2779          27 KENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        27 de~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .+...|+. -+-+|||+.-----+++-.|       ++++.+.   -+++-||||||||-..+
T Consensus        15 A~rmRP~~-lde~vGQ~HLlg~~~~lrr~-------v~~~~l~---SmIl~GPPG~GKTTlA~   66 (436)
T COG2256          15 AERLRPKS-LDEVVGQEHLLGEGKPLRRA-------VEAGHLH---SMILWGPPGTGKTTLAR   66 (436)
T ss_pred             HHHhCCCC-HHHhcChHhhhCCCchHHHH-------HhcCCCc---eeEEECCCCCCHHHHHH
Confidence            33444444 57799999988778899999       8777753   35689999999986544


No 56 
>TIGR00368 Mg chelatase-related protein. The N-terminal end matches very strongly a pfam Mg_chelatase domain.
Probab=92.66  E-value=0.061  Score=46.04  Aligned_cols=38  Identities=18%  Similarity=0.114  Sum_probs=29.3

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .+-++||..|++|..+.+               .+|..+|+.|||||||+=+.
T Consensus       191 ~~dv~Gq~~~~~al~~aa---------------~~g~~vlliG~pGsGKTtla  228 (499)
T TIGR00368       191 LKDIKGQQHAKRALEIAA---------------AGGHNLLLFGPPGSGKTMLA  228 (499)
T ss_pred             HHHhcCcHHHHhhhhhhc---------------cCCCEEEEEecCCCCHHHHH
Confidence            456899999998865543               24778999999999986543


No 57 
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=92.59  E-value=0.041  Score=40.21  Aligned_cols=25  Identities=16%  Similarity=-0.028  Sum_probs=20.6

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +..-.|..+++.|+||||||-+...
T Consensus        15 GGi~~G~~~~i~G~~G~GKT~l~~~   39 (229)
T TIGR03881        15 GGIPRGFFVAVTGEPGTGKTIFCLH   39 (229)
T ss_pred             CCCcCCeEEEEECCCCCChHHHHHH
Confidence            3556788999999999999987653


No 58 
>PRK13531 regulatory ATPase RavA; Provisional
Probab=92.57  E-value=0.041  Score=47.92  Aligned_cols=40  Identities=15%  Similarity=0.118  Sum_probs=31.2

Q ss_pred             cccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          34 EMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        34 ~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +...+++||+++-+.+.++.-               +|+-+|+-||||||||=..
T Consensus        17 ~l~~~i~gre~vI~lll~aal---------------ag~hVLL~GpPGTGKT~LA   56 (498)
T PRK13531         17 ALEKGLYERSHAIRLCLLAAL---------------SGESVFLLGPPGIAKSLIA   56 (498)
T ss_pred             HHhhhccCcHHHHHHHHHHHc---------------cCCCEEEECCCChhHHHHH
Confidence            456899999998887766543               4778889999999997443


No 59 
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]
Probab=92.51  E-value=0.045  Score=48.53  Aligned_cols=53  Identities=23%  Similarity=0.206  Sum_probs=40.1

Q ss_pred             CcccchHHHHhhcceeeecccceeeeecccccc-------ccceEEecCCCCCCCC------------CCceeeeeeecc
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLF-------RGGRAVAGGRTKCPKP------------PNTSMIIDSWVE   97 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~-------~g~~ll~~G~p~~g~~------------~~~~~~~~~~~~   97 (101)
                      .=.-|..+|+|...=|||-       .|+.+++       -.+ +|+.||||||||            ||-|+...++||
T Consensus       150 ~DVAG~dEakeel~EiVdf-------Lk~p~ky~~lGakiPkG-vlLvGpPGTGKTLLAkAvAgEA~VPFf~iSGS~FVe  221 (596)
T COG0465         150 ADVAGVDEAKEELSELVDF-------LKNPKKYQALGAKIPKG-VLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVE  221 (596)
T ss_pred             hhhcCcHHHHHHHHHHHHH-------HhCchhhHhcccccccc-eeEecCCCCCcHHHHHHHhcccCCCceeccchhhhh
Confidence            3456889999999988888       6655533       334 458899999976            888888777766


No 60 
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=92.50  E-value=0.053  Score=41.58  Aligned_cols=16  Identities=19%  Similarity=0.082  Sum_probs=14.2

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .|+-+|+.||||||||
T Consensus        20 ~g~~vLL~G~~GtGKT   35 (262)
T TIGR02640        20 SGYPVHLRGPAGTGKT   35 (262)
T ss_pred             cCCeEEEEcCCCCCHH
Confidence            4778899999999997


No 61 
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional
Probab=92.48  E-value=0.044  Score=46.81  Aligned_cols=38  Identities=18%  Similarity=0.114  Sum_probs=27.2

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .+-+|||+.+.++..   .+       ++++++  ..++|+.||||||||
T Consensus        15 f~divGq~~v~~~L~---~~-------i~~~~~--~ha~Lf~Gp~G~GKT   52 (527)
T PRK14969         15 FSELVGQEHVVRALT---NA-------LEQQRL--HHAYLFTGTRGVGKT   52 (527)
T ss_pred             HHHhcCcHHHHHHHH---HH-------HHcCCC--CEEEEEECCCCCCHH
Confidence            467999999988533   33       223332  457889999999998


No 62 
>PRK05973 replicative DNA helicase; Provisional
Probab=92.35  E-value=0.059  Score=42.22  Aligned_cols=25  Identities=20%  Similarity=0.078  Sum_probs=20.7

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +.+..|..+|++|+||+|||=|.-.
T Consensus        59 GGl~~Gsl~LIaG~PG~GKT~lalq   83 (237)
T PRK05973         59 SQLKPGDLVLLGARPGHGKTLLGLE   83 (237)
T ss_pred             CCCCCCCEEEEEeCCCCCHHHHHHH
Confidence            4667899999999999999976543


No 63 
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=92.32  E-value=0.05  Score=48.87  Aligned_cols=45  Identities=20%  Similarity=0.070  Sum_probs=29.2

Q ss_pred             cCcccchHHHHhhcceeeecccceeeee--ccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERC--KSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~--~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-+|||.+|-++.--.+..     .+.  .+..+. -+.+|+.||||||||-
T Consensus       457 ~~~ViGQ~~ai~~l~~~i~~-----~~~gl~~~~kp-~~~~Lf~GP~GvGKT~  503 (758)
T PRK11034        457 KMLVFGQDKAIEALTEAIKM-----SRAGLGHEHKP-VGSFLFAGPTGVGKTE  503 (758)
T ss_pred             cceEeCcHHHHHHHHHHHHH-----HhccccCCCCC-cceEEEECCCCCCHHH
Confidence            34589999999876665554     111  111111 2368899999999983


No 64 
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional
Probab=92.08  E-value=0.061  Score=47.09  Aligned_cols=38  Identities=21%  Similarity=0.277  Sum_probs=27.3

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .+-+|||+.+.+.   +..+       ++++++  ..++|+.||+|||||
T Consensus        12 f~eivGq~~i~~~---L~~~-------i~~~r~--~ha~Lf~Gp~G~GKT   49 (584)
T PRK14952         12 FAEVVGQEHVTEP---LSSA-------LDAGRI--NHAYLFSGPRGCGKT   49 (584)
T ss_pred             HHHhcCcHHHHHH---HHHH-------HHcCCC--CeEEEEECCCCCCHH
Confidence            5679999998886   3333       333332  447899999999997


No 65 
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=92.06  E-value=0.072  Score=38.91  Aligned_cols=26  Identities=19%  Similarity=0.134  Sum_probs=21.0

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+..|..++++|+||+|||=|..-++
T Consensus         9 Gl~~G~l~lI~G~~G~GKT~~~~~~~   34 (242)
T cd00984           9 GLQPGDLIIIAARPSMGKTAFALNIA   34 (242)
T ss_pred             CCCCCeEEEEEeCCCCCHHHHHHHHH
Confidence            45678899999999999997765443


No 66 
>CHL00181 cbbX CbbX; Provisional
Probab=91.97  E-value=0.034  Score=43.81  Aligned_cols=19  Identities=16%  Similarity=0.015  Sum_probs=14.6

Q ss_pred             cceEEecCCCCCCCCCCce
Q psy2779          71 GGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~   89 (101)
                      |--+|+.||||||||-...
T Consensus        59 ~~~ill~G~pGtGKT~lAr   77 (287)
T CHL00181         59 GLHMSFTGSPGTGKTTVAL   77 (287)
T ss_pred             CceEEEECCCCCCHHHHHH
Confidence            4458899999999975433


No 67 
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=91.90  E-value=0.052  Score=48.52  Aligned_cols=52  Identities=17%  Similarity=0.137  Sum_probs=34.9

Q ss_pred             ccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          24 LGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        24 LGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +-|.+...|.. -+.+|||+..-.--.++..+       +++.+   -.-+|+.||||||||-
T Consensus        16 ~PLaek~RP~t-ldd~vGQe~ii~~~~~L~~~-------i~~~~---~~slLL~GPpGtGKTT   67 (725)
T PRK13341         16 APLADRLRPRT-LEEFVGQDHILGEGRLLRRA-------IKADR---VGSLILYGPPGVGKTT   67 (725)
T ss_pred             CChHHhcCCCc-HHHhcCcHHHhhhhHHHHHH-------HhcCC---CceEEEECCCCCCHHH
Confidence            34555555544 46799999876555556666       43333   2357899999999984


No 68 
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.87  E-value=0.06  Score=46.00  Aligned_cols=39  Identities=26%  Similarity=0.277  Sum_probs=26.3

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+-+..--   .       +.++++  ..++|+.||||||||-
T Consensus        13 ~~dvvGq~~v~~~L~~---~-------i~~~~l--~ha~Lf~GppGtGKTT   51 (504)
T PRK14963         13 FDEVVGQEHVKEVLLA---A-------LRQGRL--GHAYLFSGPRGVGKTT   51 (504)
T ss_pred             HHHhcChHHHHHHHHH---H-------HHcCCC--CeEEEEECCCCCCHHH
Confidence            4568999998554322   2       223332  4567999999999984


No 69 
>PRK07940 DNA polymerase III subunit delta'; Validated
Probab=91.78  E-value=0.063  Score=44.56  Aligned_cols=49  Identities=16%  Similarity=0.071  Sum_probs=28.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      -+-+|||+++.+...=.+.-..-.+-.. ..+  -..++|+.||||+||+.+
T Consensus         4 f~~IiGq~~~~~~L~~~i~~~~~~~~~~-~~~--l~ha~Lf~Gp~G~GKt~l   52 (394)
T PRK07940          4 WDDLVGQEAVVAELRAAARAARADVAAA-GSG--MTHAWLFTGPPGSGRSVA   52 (394)
T ss_pred             hhhccChHHHHHHHHHHHHhcccccccc-CCC--CCeEEEEECCCCCcHHHH
Confidence            3458999999887443333200000000 001  146799999999999743


No 70 
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.78  E-value=0.061  Score=45.96  Aligned_cols=39  Identities=13%  Similarity=0.053  Sum_probs=28.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+.+|||+...++.-   .+       ++++++  ..++|+.||||||||-
T Consensus        15 f~divGq~~v~~~L~---~~-------~~~~~l--~ha~Lf~Gp~G~GKTt   53 (509)
T PRK14958         15 FQEVIGQAPVVRALS---NA-------LDQQYL--HHAYLFTGTRGVGKTT   53 (509)
T ss_pred             HHHhcCCHHHHHHHH---HH-------HHhCCC--CeeEEEECCCCCCHHH
Confidence            467999999988643   33       233332  4578999999999973


No 71 
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=91.77  E-value=0.075  Score=38.70  Aligned_cols=22  Identities=9%  Similarity=0.129  Sum_probs=14.9

Q ss_pred             cceEEecCCCCCCCCCCceeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      -.+++++|+|||||+-...+++
T Consensus        15 P~~~i~aG~~GsGKSt~~~~~~   36 (199)
T PF06414_consen   15 PTLIIIAGQPGSGKSTLARQLL   36 (199)
T ss_dssp             -EEEEEES-TTSTTHHHHHHHH
T ss_pred             CEEEEEeCCCCCCHHHHHHHhh
Confidence            5689999999999964444333


No 72 
>PRK07994 DNA polymerase III subunits gamma and tau; Validated
Probab=91.67  E-value=0.059  Score=47.93  Aligned_cols=40  Identities=18%  Similarity=0.054  Sum_probs=28.1

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+-+|||+.+.++.-   ..       ++++++  -.++|+.||||||||-
T Consensus        14 ~f~divGQe~vv~~L~---~~-------l~~~rl--~hAyLf~Gp~GvGKTT   53 (647)
T PRK07994         14 TFAEVVGQEHVLTALA---NA-------LDLGRL--HHAYLFSGTRGVGKTT   53 (647)
T ss_pred             CHHHhcCcHHHHHHHH---HH-------HHcCCC--CeEEEEECCCCCCHHH
Confidence            3578999999998543   33       323332  3458899999999973


No 73 
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=91.50  E-value=0.079  Score=38.79  Aligned_cols=20  Identities=5%  Similarity=-0.170  Sum_probs=16.0

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..+.+++.||||||||=...
T Consensus        41 ~~~~~~l~G~~G~GKT~La~   60 (227)
T PRK08903         41 ADRFFYLWGEAGSGRSHLLQ   60 (227)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            46789999999999985443


No 74 
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.48  E-value=0.068  Score=45.92  Aligned_cols=40  Identities=20%  Similarity=0.106  Sum_probs=27.6

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .+-+|||+.+.+..-   ..       +.+++  -+.++|+.||||||||..
T Consensus        15 ~~eiiGq~~~~~~L~---~~-------i~~~~--i~~a~Lf~Gp~G~GKTtl   54 (585)
T PRK14950         15 FAELVGQEHVVQTLR---NA-------IAEGR--VAHAYLFTGPRGVGKTST   54 (585)
T ss_pred             HHHhcCCHHHHHHHH---HH-------HHhCC--CceEEEEECCCCCCHHHH
Confidence            467999999988642   22       22223  256789999999999843


No 75 
>PRK08084 DNA replication initiation factor; Provisional
Probab=91.42  E-value=0.12  Score=38.99  Aligned_cols=16  Identities=13%  Similarity=0.063  Sum_probs=13.8

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      +..+++.||||||||=
T Consensus        45 ~~~l~l~Gp~G~GKTh   60 (235)
T PRK08084         45 SGYIYLWSREGAGRSH   60 (235)
T ss_pred             CCeEEEECCCCCCHHH
Confidence            4678999999999984


No 76 
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=91.41  E-value=0.071  Score=39.42  Aligned_cols=27  Identities=7%  Similarity=-0.032  Sum_probs=21.7

Q ss_pred             ccccccceEEecCCCCCCCCCCceeee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      +..-.|.++++.|+||||||.+...++
T Consensus        20 gG~~~g~~~~i~G~~GsGKt~l~~~~~   46 (234)
T PRK06067         20 GGIPFPSLILIEGDHGTGKSVLSQQFV   46 (234)
T ss_pred             CCCcCCcEEEEECCCCCChHHHHHHHH
Confidence            456678999999999999998765443


No 77 
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=91.38  E-value=0.13  Score=37.17  Aligned_cols=27  Identities=11%  Similarity=-0.066  Sum_probs=21.4

Q ss_pred             ccccccceEEecCCCCCCCCCCceeee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      +....|.+..+.|+||||||-+...++
T Consensus        14 GG~~~g~v~~I~G~~GsGKT~l~~~ia   40 (226)
T cd01393          14 GGIPTGRITEIFGEFGSGKTQLCLQLA   40 (226)
T ss_pred             CCCcCCcEEEEeCCCCCChhHHHHHHH
Confidence            455678999999999999997765443


No 78 
>KOG0731|consensus
Probab=91.35  E-value=0.064  Score=49.05  Aligned_cols=59  Identities=20%  Similarity=0.128  Sum_probs=38.2

Q ss_pred             cCcccchHHHHhhcceeeec-ccc-eeeeeccccccccceEEecCCCCCCCC------------CCceeeeeeecc
Q psy2779          36 AAGLVGQQAAREVSRAVTWE-KSF-QFERCKSHSLFRGGRAVAGGRTKCPKP------------PNTSMIIDSWVE   97 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm-~~~-~~~~~~~~~~~~g~~ll~~G~p~~g~~------------~~~~~~~~~~~~   97 (101)
                      ..-..|+++|++-.-=||+. |+- ||.+.  +-++-+++| |.||||||||            ||-||.-..+||
T Consensus       310 FkDVAG~deAK~El~E~V~fLKNP~~Y~~l--GAKiPkGvL-L~GPPGTGKTLLAKAiAGEAgVPF~svSGSEFvE  382 (774)
T KOG0731|consen  310 FKDVAGVDEAKEELMEFVKFLKNPEQYQEL--GAKIPKGVL-LVGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVE  382 (774)
T ss_pred             cccccCcHHHHHHHHHHHHHhcCHHHHHHc--CCcCcCceE-EECCCCCcHHHHHHHHhcccCCceeeechHHHHH
Confidence            45578999999888777775 110 12221  223344554 8999999997            888877655555


No 79 
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.34  E-value=0.076  Score=46.21  Aligned_cols=41  Identities=17%  Similarity=0.077  Sum_probs=27.9

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.+-+|||+.+.+..   ...       +++++.  ..++|+.||||||||-.
T Consensus        14 ~f~diiGq~~~v~~L---~~~-------i~~~rl--~ha~Lf~Gp~GvGKTTl   54 (546)
T PRK14957         14 SFAEVAGQQHALNSL---VHA-------LETQKV--HHAYLFTGTRGVGKTTL   54 (546)
T ss_pred             cHHHhcCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHHHH
Confidence            356799999998762   233       322221  34688999999999853


No 80 
>PRK14737 gmk guanylate kinase; Provisional
Probab=91.26  E-value=0.092  Score=38.81  Aligned_cols=18  Identities=6%  Similarity=-0.164  Sum_probs=15.6

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      ++++.+++.||+|+||+.
T Consensus         2 ~~~~~ivl~GpsG~GK~t   19 (186)
T PRK14737          2 ASPKLFIISSVAGGGKST   19 (186)
T ss_pred             CCCeEEEEECCCCCCHHH
Confidence            568999999999999863


No 81 
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.23  E-value=0.08  Score=46.67  Aligned_cols=39  Identities=13%  Similarity=0.140  Sum_probs=27.6

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ...+|||+.+.+.   +..+       ++++++  .-++|+.||||||||-
T Consensus        15 f~eivGQe~i~~~---L~~~-------i~~~ri--~ha~Lf~Gp~GvGKtt   53 (620)
T PRK14954         15 FADITAQEHITHT---IQNS-------LRMDRV--GHGYIFSGLRGVGKTT   53 (620)
T ss_pred             HHHhcCcHHHHHH---HHHH-------HHcCCC--CeeEEEECCCCCCHHH
Confidence            5679999999885   3333       333332  3468899999999974


No 82 
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=91.23  E-value=0.11  Score=38.15  Aligned_cols=23  Identities=17%  Similarity=0.042  Sum_probs=18.5

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +....|.++++.|+||+|||=|.
T Consensus        11 gGi~~g~~~li~G~~G~GKt~~~   33 (224)
T TIGR03880        11 GGFPEGHVIVVIGEYGTGKTTFS   33 (224)
T ss_pred             CCCCCCeEEEEECCCCCCHHHHH
Confidence            34556889999999999998653


No 83 
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional
Probab=91.23  E-value=0.085  Score=47.82  Aligned_cols=40  Identities=18%  Similarity=0.078  Sum_probs=29.0

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+-+|||+.+.++.   ..+       ++++++  -.++|+.||||||||-
T Consensus        13 tFddVIGQe~vv~~L---~~a-------I~~grl--~HAyLF~GPpGvGKTT   52 (702)
T PRK14960         13 NFNELVGQNHVSRAL---SSA-------LERGRL--HHAYLFTGTRGVGKTT   52 (702)
T ss_pred             CHHHhcCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHHH
Confidence            357799999997764   344       333443  3688999999999984


No 84 
>PF07088 GvpD:  GvpD gas vesicle protein;  InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins. GvpD is thought to be involved in the regulation of gas vesicle formation [,].; GO: 0005524 ATP binding
Probab=91.22  E-value=0.11  Score=45.55  Aligned_cols=26  Identities=15%  Similarity=0.171  Sum_probs=21.9

Q ss_pred             ccceEEecCCCCCCCCCCceeeeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      .|..||+-|.||||||-||--+.|+.
T Consensus         9 ~G~TLLIKG~PGTGKTtfaLelL~~l   34 (484)
T PF07088_consen    9 PGQTLLIKGEPGTGKTTFALELLNSL   34 (484)
T ss_pred             CCcEEEEecCCCCCceeeehhhHHHH
Confidence            48899999999999999986666553


No 85 
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=91.21  E-value=0.068  Score=44.89  Aligned_cols=43  Identities=16%  Similarity=0.131  Sum_probs=31.7

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccc---eEEecCCCCCCCCCCc
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGG---RAVAGGRTKCPKPPNT   88 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~---~ll~~G~p~~g~~~~~   88 (101)
                      .-+-||||++.++-..|..+-       .    +.++.   -+|+.||||.|||-..
T Consensus        24 ~l~efiGQ~~vk~~L~ifI~A-------A----k~r~e~lDHvLl~GPPGlGKTTLA   69 (332)
T COG2255          24 TLDEFIGQEKVKEQLQIFIKA-------A----KKRGEALDHVLLFGPPGLGKTTLA   69 (332)
T ss_pred             cHHHhcChHHHHHHHHHHHHH-------H----HhcCCCcCeEEeeCCCCCcHHHHH
Confidence            357899999999988877655       2    11232   3689999999998543


No 86 
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=91.18  E-value=0.11  Score=37.76  Aligned_cols=26  Identities=12%  Similarity=-0.018  Sum_probs=21.1

Q ss_pred             ccccccceEEecCCCCCCCCCCceee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +....|.+.++.|+||||||-+...+
T Consensus        14 GGi~~g~i~~i~G~~GsGKT~l~~~l   39 (235)
T cd01123          14 GGIETGSITEIFGEFGSGKTQLCHQL   39 (235)
T ss_pred             CCCCCCeEEEEECCCCCCHHHHHHHH
Confidence            45667999999999999999776544


No 87 
>PRK04328 hypothetical protein; Provisional
Probab=91.16  E-value=0.11  Score=39.69  Aligned_cols=23  Identities=9%  Similarity=0.008  Sum_probs=19.1

Q ss_pred             cccccceEEecCCCCCCCCCCce
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ....|..+|+.|+||||||-+..
T Consensus        19 Gip~gs~ili~G~pGsGKT~l~~   41 (249)
T PRK04328         19 GIPERNVVLLSGGPGTGKSIFSQ   41 (249)
T ss_pred             CCcCCcEEEEEcCCCCCHHHHHH
Confidence            45578999999999999987643


No 88 
>PRK06526 transposase; Provisional
Probab=91.08  E-value=0.094  Score=40.85  Aligned_cols=17  Identities=18%  Similarity=-0.056  Sum_probs=14.0

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      +.-+++.||||||||-.
T Consensus        98 ~~nlll~Gp~GtGKThL  114 (254)
T PRK06526         98 KENVVFLGPPGTGKTHL  114 (254)
T ss_pred             CceEEEEeCCCCchHHH
Confidence            45689999999999843


No 89 
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=91.07  E-value=0.085  Score=45.39  Aligned_cols=39  Identities=23%  Similarity=0.170  Sum_probs=26.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+..--   .       ++++++  ...+|+.||||||||-
T Consensus        20 f~dliGq~~vv~~L~~---a-------i~~~ri--~~a~Lf~Gp~G~GKTT   58 (507)
T PRK06645         20 FAELQGQEVLVKVLSY---T-------ILNDRL--AGGYLLTGIRGVGKTT   58 (507)
T ss_pred             HHHhcCcHHHHHHHHH---H-------HHcCCC--CceEEEECCCCCCHHH
Confidence            4678999998874322   1       222222  3578999999999984


No 90 
>CHL00195 ycf46 Ycf46; Provisional
Probab=91.04  E-value=0.064  Score=45.87  Aligned_cols=56  Identities=14%  Similarity=0.066  Sum_probs=28.0

Q ss_pred             CCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          28 ENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        28 e~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +...+....+-+.|.+.+.+...-..+.  |. .+.+...+-..+-+|+.||||||||-
T Consensus       219 e~~~~~~~~~dvgGl~~lK~~l~~~~~~--~~-~~~~~~gl~~pkGILL~GPpGTGKTl  274 (489)
T CHL00195        219 EFYSVNEKISDIGGLDNLKDWLKKRSTS--FS-KQASNYGLPTPRGLLLVGIQGTGKSL  274 (489)
T ss_pred             cccCCCCCHHHhcCHHHHHHHHHHHHHH--hh-HHHHhcCCCCCceEEEECCCCCcHHH
Confidence            3333334445566766666544322211  10 01111122234568899999999963


No 91 
>PRK00300 gmk guanylate kinase; Provisional
Probab=91.02  E-value=0.11  Score=37.09  Aligned_cols=23  Identities=22%  Similarity=0.251  Sum_probs=18.5

Q ss_pred             ccceEEecCCCCCCCCCCceeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .|.++++.||+||||+....++.
T Consensus         4 ~g~~i~i~G~sGsGKstl~~~l~   26 (205)
T PRK00300          4 RGLLIVLSGPSGAGKSTLVKALL   26 (205)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHH
Confidence            58899999999999986554443


No 92 
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=90.96  E-value=0.1  Score=42.48  Aligned_cols=17  Identities=12%  Similarity=-0.122  Sum_probs=13.7

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      -+-+|+.||||||||-.
T Consensus       165 p~gvLL~GppGtGKT~l  181 (389)
T PRK03992        165 PKGVLLYGPPGTGKTLL  181 (389)
T ss_pred             CCceEEECCCCCChHHH
Confidence            34588999999999854


No 93 
>PRK05642 DNA replication initiation factor; Validated
Probab=90.91  E-value=0.11  Score=39.26  Aligned_cols=56  Identities=11%  Similarity=0.006  Sum_probs=32.0

Q ss_pred             ccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          24 LGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        24 LGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      |-||=...+.++.+.||...+ +.|...+.+.       .++..-+.-.-+++.|++|||||=.
T Consensus         6 l~l~~~~~~~~tfdnF~~~~~-~~a~~~~~~~-------~~~~~~~~~~~l~l~G~~G~GKTHL   61 (234)
T PRK05642          6 LPLGVRLRDDATFANYYPGAN-AAALGYVERL-------CEADAGWTESLIYLWGKDGVGRSHL   61 (234)
T ss_pred             cccCCCCCCcccccccCcCCh-HHHHHHHHHH-------hhccccCCCCeEEEECCCCCCHHHH
Confidence            455655666677788873333 2343334333       1111111236788999999999844


No 94 
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=90.90  E-value=0.053  Score=46.93  Aligned_cols=50  Identities=18%  Similarity=0.073  Sum_probs=26.9

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+.|+..+-+..--.+.+-..+-...+.+.+-..+-+|+.||||||||-
T Consensus       182 ~dIgGl~~~i~~i~~~v~lp~~~~~l~~~~gl~~p~GILLyGPPGTGKT~  231 (512)
T TIGR03689       182 ADIGGLDSQIEQIRDAVELPFLHPELYREYDLKPPKGVLLYGPPGCGKTL  231 (512)
T ss_pred             HHcCChHHHHHHHHHHHHHHhhCHHHHHhccCCCCcceEEECCCCCcHHH
Confidence            44667776665554443331011011122233334558899999999984


No 95 
>KOG0733|consensus
Probab=90.85  E-value=0.089  Score=48.21  Aligned_cols=15  Identities=20%  Similarity=0.322  Sum_probs=12.2

Q ss_pred             cceEEecCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKP   85 (101)
Q Consensus        71 g~~ll~~G~p~~g~~   85 (101)
                      -.=+|+.||||||||
T Consensus       545 PsGvLL~GPPGCGKT  559 (802)
T KOG0733|consen  545 PSGVLLCGPPGCGKT  559 (802)
T ss_pred             CCceEEeCCCCccHH
Confidence            334679999999997


No 96 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=90.82  E-value=0.12  Score=35.13  Aligned_cols=17  Identities=24%  Similarity=0.075  Sum_probs=14.4

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      +..+++.|+|||||+-.
T Consensus         4 ~~~i~l~G~~GsGKstl   20 (175)
T PRK00131          4 GPNIVLIGFMGAGKSTI   20 (175)
T ss_pred             CCeEEEEcCCCCCHHHH
Confidence            56889999999999754


No 97 
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=90.78  E-value=0.074  Score=46.47  Aligned_cols=49  Identities=8%  Similarity=0.013  Sum_probs=26.7

Q ss_pred             CcccchHHHHhhcceeeecccceeee-eccccccccceEEecCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFER-CKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~-~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +-++|++.+++..-=.+.+ .+++-. .+.-..-..+-+|+.||||||||-
T Consensus       453 ~di~g~~~~k~~l~~~v~~-~~~~~~~~~~~g~~~~~giLL~GppGtGKT~  502 (733)
T TIGR01243       453 SDIGGLEEVKQELREAVEW-PLKHPEIFEKMGIRPPKGVLLFGPPGTGKTL  502 (733)
T ss_pred             hhcccHHHHHHHHHHHHHh-hhhCHHHHHhcCCCCCceEEEECCCCCCHHH
Confidence            4467888888776554443 001100 000011123447789999999973


No 98 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=90.77  E-value=0.12  Score=37.19  Aligned_cols=18  Identities=11%  Similarity=-0.136  Sum_probs=14.9

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      .+-+++.||||||||-..
T Consensus        38 ~~~lll~G~~G~GKT~la   55 (226)
T TIGR03420        38 DRFLYLWGESGSGKSHLL   55 (226)
T ss_pred             CCeEEEECCCCCCHHHHH
Confidence            678899999999997543


No 99 
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=90.75  E-value=0.12  Score=43.37  Aligned_cols=25  Identities=16%  Similarity=0.088  Sum_probs=20.7

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +....|+..|+.|+||||||=|...
T Consensus        16 GGlp~g~~~Li~G~pGsGKT~la~q   40 (484)
T TIGR02655        16 GGLPIGRSTLVSGTSGTGKTLFSIQ   40 (484)
T ss_pred             CCCCCCeEEEEEcCCCCCHHHHHHH
Confidence            4667799999999999999876543


No 100
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=90.69  E-value=0.075  Score=39.98  Aligned_cols=19  Identities=21%  Similarity=0.181  Sum_probs=16.0

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      +++.+|++|+||||||-+-
T Consensus       126 ~~~~ili~G~tGSGKTT~l  144 (270)
T PF00437_consen  126 GRGNILISGPTGSGKTTLL  144 (270)
T ss_dssp             TTEEEEEEESTTSSHHHHH
T ss_pred             cceEEEEECCCccccchHH
Confidence            4788999999999998544


No 101
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=90.62  E-value=0.15  Score=41.76  Aligned_cols=40  Identities=23%  Similarity=0.170  Sum_probs=28.6

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ...-+|||+.|.+..-   ++       +.++++  .-++|+.||+|+||+.
T Consensus        17 ~~~~iiGq~~~~~~L~---~~-------~~~~rl--~HA~Lf~Gp~G~GK~~   56 (365)
T PRK07471         17 ETTALFGHAAAEAALL---DA-------YRSGRL--HHAWLIGGPQGIGKAT   56 (365)
T ss_pred             chhhccChHHHHHHHH---HH-------HHcCCC--CceEEEECCCCCCHHH
Confidence            3478999999987653   43       333332  4589999999999863


No 102
>CHL00095 clpC Clp protease ATP binding subunit
Probab=90.61  E-value=0.092  Score=46.79  Aligned_cols=44  Identities=18%  Similarity=0.108  Sum_probs=27.9

Q ss_pred             cCcccchHHHHhhcceeeecccceeeee--ccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERC--KSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~--~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      ..-++||..|.++.--.+..     .|.  ...++- -..+|+.||||||||
T Consensus       508 ~~~v~GQ~~ai~~l~~~i~~-----~~~gl~~~~~p-~~~~lf~Gp~GvGKt  553 (821)
T CHL00095        508 HKRIIGQDEAVVAVSKAIRR-----ARVGLKNPNRP-IASFLFSGPTGVGKT  553 (821)
T ss_pred             cCcCcChHHHHHHHHHHHHH-----HhhcccCCCCC-ceEEEEECCCCCcHH
Confidence            46789999999887544443     111  011111 135789999999998


No 103
>PRK06647 DNA polymerase III subunits gamma and tau; Validated
Probab=90.50  E-value=0.1  Score=45.25  Aligned_cols=39  Identities=18%  Similarity=0.165  Sum_probs=27.8

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+..   ...       +++++.  ..++|+.||||+|||-
T Consensus        15 f~diiGqe~iv~~L---~~~-------i~~~~i--~hayLf~Gp~G~GKTt   53 (563)
T PRK06647         15 FNSLEGQDFVVETL---KHS-------IESNKI--ANAYIFSGPRGVGKTS   53 (563)
T ss_pred             HHHccCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHHH
Confidence            46799999998852   222       333342  4678999999999863


No 104
>PRK05896 DNA polymerase III subunits gamma and tau; Validated
Probab=90.49  E-value=0.092  Score=46.57  Aligned_cols=40  Identities=13%  Similarity=0.119  Sum_probs=28.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .+.+|||+.+.+..   ...       ++.++.  ..++|+.||||+|||-+
T Consensus        15 F~dIIGQe~iv~~L---~~a-------I~~~rl--~hA~Lf~GP~GvGKTTl   54 (605)
T PRK05896         15 FKQIIGQELIKKIL---VNA-------ILNNKL--THAYIFSGPRGIGKTSI   54 (605)
T ss_pred             HHHhcCcHHHHHHH---HHH-------HHcCCC--CceEEEECCCCCCHHHH
Confidence            57899999998653   233       333332  37899999999999854


No 105
>COG0714 MoxR-like ATPases [General function prediction only]
Probab=90.39  E-value=0.11  Score=40.83  Aligned_cols=35  Identities=23%  Similarity=0.355  Sum_probs=24.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      ...++|++.+-+++-+-               +..|+-+|+-|+||||||
T Consensus        23 ~~~~~g~~~~~~~~l~a---------------~~~~~~vll~G~PG~gKT   57 (329)
T COG0714          23 EKVVVGDEEVIELALLA---------------LLAGGHVLLEGPPGVGKT   57 (329)
T ss_pred             CCeeeccHHHHHHHHHH---------------HHcCCCEEEECCCCccHH
Confidence            34477776665554322               235888999999999997


No 106
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional
Probab=90.39  E-value=0.089  Score=47.68  Aligned_cols=39  Identities=21%  Similarity=0.152  Sum_probs=28.5

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+..   .++       ++++++  ..++|+.|++|+|||-
T Consensus        15 FddVIGQe~vv~~L---~~a-------l~~gRL--pHA~LFtGP~GvGKTT   53 (700)
T PRK12323         15 FTTLVGQEHVVRAL---THA-------LEQQRL--HHAYLFTGTRGVGKTT   53 (700)
T ss_pred             HHHHcCcHHHHHHH---HHH-------HHhCCC--ceEEEEECCCCCCHHH
Confidence            56799999998843   344       334443  4578999999999984


No 107
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=90.34  E-value=0.15  Score=37.31  Aligned_cols=23  Identities=17%  Similarity=0.024  Sum_probs=18.9

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +....|.+.++.|+||+|||-+.
T Consensus        18 GGi~~g~i~~i~G~~GsGKT~l~   40 (225)
T PRK09361         18 GGFERGTITQIYGPPGSGKTNIC   40 (225)
T ss_pred             CCCCCCeEEEEECCCCCCHHHHH
Confidence            34556889999999999998764


No 108
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=90.33  E-value=0.1  Score=39.13  Aligned_cols=44  Identities=16%  Similarity=0.079  Sum_probs=27.0

Q ss_pred             CCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          30 GEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        30 g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.. -+-++||.++-+...   +.       ++.++   -..+|+.||||||||-.
T Consensus        11 yrP~~-~~~~~g~~~~~~~l~---~~-------i~~~~---~~~~ll~G~~G~GKt~~   54 (319)
T PRK00440         11 YRPRT-LDEIVGQEEIVERLK---SY-------VKEKN---MPHLLFAGPPGTGKTTA   54 (319)
T ss_pred             hCCCc-HHHhcCcHHHHHHHH---HH-------HhCCC---CCeEEEECCCCCCHHHH
Confidence            34433 345899988776633   33       22222   12479999999999743


No 109
>PRK13765 ATP-dependent protease Lon; Provisional
Probab=90.33  E-value=0.1  Score=46.16  Aligned_cols=40  Identities=18%  Similarity=0.173  Sum_probs=29.8

Q ss_pred             ccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          33 NEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        33 ~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ...-+-++||++|-++.-..++.               ++-+|+.||||||||-.
T Consensus        27 ~~~~~~vigq~~a~~~L~~~~~~---------------~~~~l~~G~~G~GKttl   66 (637)
T PRK13765         27 ERLIDQVIGQEHAVEVIKKAAKQ---------------RRHVMMIGSPGTGKSML   66 (637)
T ss_pred             cccHHHcCChHHHHHHHHHHHHh---------------CCeEEEECCCCCcHHHH
Confidence            34567799999998876554443               34688999999999743


No 110
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional
Probab=90.28  E-value=0.11  Score=44.72  Aligned_cols=40  Identities=18%  Similarity=0.137  Sum_probs=28.3

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+-+|||+.+.+...   +.       ++++++  -.++|+.||||+|||-
T Consensus        11 ~f~dliGQe~vv~~L~---~a-------~~~~ri--~ha~Lf~Gp~G~GKTT   50 (491)
T PRK14964         11 SFKDLVGQDVLVRILR---NA-------FTLNKI--PQSILLVGASGVGKTT   50 (491)
T ss_pred             CHHHhcCcHHHHHHHH---HH-------HHcCCC--CceEEEECCCCccHHH
Confidence            3578999999887543   33       223332  3578999999999974


No 111
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=90.26  E-value=0.12  Score=41.04  Aligned_cols=62  Identities=19%  Similarity=0.124  Sum_probs=31.3

Q ss_pred             cccccCCCCCCcccccCcccchHHHHhhcceeeec--ccce-eeeeccccccccceEEecCCCCCCCCCC
Q psy2779          21 VKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWE--KSFQ-FERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        21 IkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm--~~~~-~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.++-+.+.  +...-+-+.|.+++.+..--.++.  +.-. |..+   ..-..+-+|+.||||||||-.
T Consensus       108 ~~~~~~~~~--p~~~~~di~Gl~~~~~~l~~~i~~~~~~~~~~~~~---g~~~p~gvLL~GppGtGKT~l  172 (364)
T TIGR01242       108 VKGMEVEER--PNVSYEDIGGLEEQIREIREAVELPLKHPELFEEV---GIEPPKGVLLYGPPGTGKTLL  172 (364)
T ss_pred             cccceeccC--CCCCHHHhCChHHHHHHHHHHHHHHhcCHHHHHhc---CCCCCceEEEECCCCCCHHHH
Confidence            344444433  334445678877776555433322  0000 0001   111234588999999999743


No 112
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=90.13  E-value=0.14  Score=37.06  Aligned_cols=18  Identities=17%  Similarity=0.078  Sum_probs=15.5

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|..+++.||||||||-+
T Consensus        24 ~g~~i~I~G~tGSGKTTl   41 (186)
T cd01130          24 ARKNILISGGTGSGKTTL   41 (186)
T ss_pred             CCCEEEEECCCCCCHHHH
Confidence            588999999999999744


No 113
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=90.08  E-value=0.14  Score=37.82  Aligned_cols=43  Identities=9%  Similarity=0.013  Sum_probs=26.1

Q ss_pred             ccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          33 NEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        33 ~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ......|.-...-++|...+..-       +    ..+.+.+++.||||+|||-
T Consensus        16 ~~~~~~~~~~~~~~~~~~~l~~~-------~----~~~~~~~~l~G~~G~GKTt   58 (269)
T TIGR03015        16 LPDPDFFYPSKGHKRAMAYLEYG-------L----SQREGFILITGEVGAGKTT   58 (269)
T ss_pred             CCCHHHhCCCHHHHHHHHHHHHH-------H----hcCCCEEEEEcCCCCCHHH
Confidence            33344555555555655544332       1    1135688999999999974


No 114
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=90.01  E-value=0.16  Score=39.44  Aligned_cols=24  Identities=8%  Similarity=-0.133  Sum_probs=19.3

Q ss_pred             ccccccceEEecCCCCCCCCCCce
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      +.+..|.+.++.|+||||||-|.-
T Consensus        90 GGi~~g~i~ei~G~~g~GKT~l~~  113 (310)
T TIGR02236        90 GGIETQAITEVFGEFGSGKTQICH  113 (310)
T ss_pred             CCCCCCeEEEEECCCCCCHHHHHH
Confidence            345568899999999999998744


No 115
>PRK05563 DNA polymerase III subunits gamma and tau; Validated
Probab=90.01  E-value=0.12  Score=44.51  Aligned_cols=40  Identities=15%  Similarity=0.136  Sum_probs=27.3

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .+-+|||+...+..-   +.       +++++.  ..++|+.||||||||-.
T Consensus        15 f~~viGq~~v~~~L~---~~-------i~~~~~--~hayLf~Gp~GtGKTt~   54 (559)
T PRK05563         15 FEDVVGQEHITKTLK---NA-------IKQGKI--SHAYLFSGPRGTGKTSA   54 (559)
T ss_pred             HHhccCcHHHHHHHH---HH-------HHcCCC--CeEEEEECCCCCCHHHH
Confidence            567999999766432   22       222332  57889999999999743


No 116
>PRK14738 gmk guanylate kinase; Provisional
Probab=89.95  E-value=0.15  Score=37.73  Aligned_cols=19  Identities=16%  Similarity=0.010  Sum_probs=16.0

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..++.+++.||+||||+-.
T Consensus        11 ~~~~~ivi~GpsG~GK~tl   29 (206)
T PRK14738         11 AKPLLVVISGPSGVGKDAV   29 (206)
T ss_pred             CCCeEEEEECcCCCCHHHH
Confidence            4688999999999998753


No 117
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I. This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.
Probab=89.91  E-value=0.18  Score=41.15  Aligned_cols=46  Identities=13%  Similarity=0.052  Sum_probs=30.4

Q ss_pred             cCcccchHHHHhhccee-eecccceeeeeccccccccceEEecCCCCCCCCCCceeeeeee
Q psy2779          36 AAGLVGQQAAREVSRAV-TWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIV-Vdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      .+-+|||+++.+|.-+. |+=              +.+-+|+.|+||+||+-.-..+-..|
T Consensus         3 f~~ivgq~~~~~al~~~~~~~--------------~~g~vli~G~~G~gKttl~r~~~~~~   49 (337)
T TIGR02030         3 FTAIVGQDEMKLALLLNVIDP--------------KIGGVMVMGDRGTGKSTAVRALAALL   49 (337)
T ss_pred             ccccccHHHHHHHHHHHhcCC--------------CCCeEEEEcCCCCCHHHHHHHHHHhh
Confidence            35689999999996432 221              13446699999999975544443333


No 118
>PRK09112 DNA polymerase III subunit delta'; Validated
Probab=89.89  E-value=0.12  Score=42.14  Aligned_cols=40  Identities=15%  Similarity=0.053  Sum_probs=27.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..-++||++|.+..--.+.-          ++  .-.++|+.||+|+||+-+
T Consensus        22 ~~~l~Gh~~a~~~L~~a~~~----------gr--l~ha~L~~G~~G~GKttl   61 (351)
T PRK09112         22 NTRLFGHEEAEAFLAQAYRE----------GK--LHHALLFEGPEGIGKATL   61 (351)
T ss_pred             hhhccCcHHHHHHHHHHHHc----------CC--CCeeEeeECCCCCCHHHH
Confidence            46799999998765332222          22  123799999999998744


No 119
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=89.88  E-value=0.1  Score=45.88  Aligned_cols=45  Identities=20%  Similarity=0.156  Sum_probs=27.7

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeee--ccccccccceEEecCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERC--KSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~--~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      -...++||.+|-++.--.+..     .|.  .+..+ -...+|+.||||||||
T Consensus       452 l~~~v~GQ~~ai~~l~~~i~~-----~~~g~~~~~~-p~~~~lf~Gp~GvGKT  498 (731)
T TIGR02639       452 LKAKIFGQDEAIDSLVSSIKR-----SRAGLGNPNK-PVGSFLFTGPTGVGKT  498 (731)
T ss_pred             HhcceeCcHHHHHHHHHHHHH-----HhcCCCCCCC-CceeEEEECCCCccHH
Confidence            356789999998874333222     111  11111 1235789999999998


No 120
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=89.68  E-value=0.12  Score=42.52  Aligned_cols=16  Identities=13%  Similarity=-0.039  Sum_probs=13.2

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      ..+-+|+.||||||||
T Consensus       275 ~~~giLl~GpPGtGKT  290 (494)
T COG0464         275 PPKGVLLYGPPGTGKT  290 (494)
T ss_pred             CCCeeEEECCCCCCHH
Confidence            3457889999999986


No 121
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=89.55  E-value=0.21  Score=39.19  Aligned_cols=24  Identities=8%  Similarity=-0.151  Sum_probs=19.4

Q ss_pred             ccccccceEEecCCCCCCCCCCce
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      +....|.+.++.|+||||||-+.-
T Consensus        97 GGi~~g~vtei~G~~GsGKT~l~~  120 (317)
T PRK04301         97 GGIETQSITEFYGEFGSGKTQICH  120 (317)
T ss_pred             CCccCCcEEEEECCCCCCHhHHHH
Confidence            345568899999999999997654


No 122
>PRK07764 DNA polymerase III subunits gamma and tau; Validated
Probab=89.46  E-value=0.14  Score=46.64  Aligned_cols=38  Identities=21%  Similarity=0.282  Sum_probs=27.5

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .+.+|||+.+.+.   +..+       ++++++  ..++|+.||+|||||
T Consensus        14 f~eiiGqe~v~~~---L~~~-------i~~~ri--~Ha~Lf~Gp~G~GKT   51 (824)
T PRK07764         14 FAEVIGQEHVTEP---LSTA-------LDSGRI--NHAYLFSGPRGCGKT   51 (824)
T ss_pred             HHHhcCcHHHHHH---HHHH-------HHhCCC--CceEEEECCCCCCHH
Confidence            5679999998876   3333       333332  467899999999997


No 123
>PRK12377 putative replication protein; Provisional
Probab=89.40  E-value=0.12  Score=40.42  Aligned_cols=35  Identities=20%  Similarity=0.181  Sum_probs=23.0

Q ss_pred             chHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          41 GQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        41 GQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ||..|..+|.-+++-    |.   .    ...-+++.|+||||||=
T Consensus        82 ~~~~a~~~a~~~a~~----~~---~----~~~~l~l~G~~GtGKTh  116 (248)
T PRK12377         82 GQRYALSQAKSIADE----LM---T----GCTNFVFSGKPGTGKNH  116 (248)
T ss_pred             hHHHHHHHHHHHHHH----HH---h----cCCeEEEECCCCCCHHH
Confidence            566666666655554    11   1    13568899999999974


No 124
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=89.36  E-value=0.15  Score=40.17  Aligned_cols=38  Identities=16%  Similarity=0.104  Sum_probs=26.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      -+-+|||+.+.+..   .+.       +++++.  -..+|+.||||+|||
T Consensus        16 ~~~iig~~~~~~~l---~~~-------i~~~~~--~~~~L~~G~~G~GKt   53 (367)
T PRK14970         16 FDDVVGQSHITNTL---LNA-------IENNHL--AQALLFCGPRGVGKT   53 (367)
T ss_pred             HHhcCCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHH
Confidence            46789999987653   222       233332  357889999999986


No 125
>PRK06305 DNA polymerase III subunits gamma and tau; Validated
Probab=89.12  E-value=0.15  Score=42.68  Aligned_cols=40  Identities=15%  Similarity=0.111  Sum_probs=26.7

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+-+|||+.+-+.   +.+.       ++.++.  ..++|+.||||+||+-
T Consensus        15 ~~~diiGq~~~v~~---L~~~-------i~~~~i--~ha~Lf~Gp~G~GKtt   54 (451)
T PRK06305         15 TFSEILGQDAVVAV---LKNA-------LRFNRA--AHAYLFSGIRGTGKTT   54 (451)
T ss_pred             CHHHhcCcHHHHHH---HHHH-------HHcCCC--ceEEEEEcCCCCCHHH
Confidence            35678999988652   2333       222332  4678899999999974


No 126
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=89.03  E-value=0.1  Score=44.23  Aligned_cols=20  Identities=10%  Similarity=-0.105  Sum_probs=15.5

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ....+.+|+.||||||||-.
T Consensus       214 i~~p~gVLL~GPPGTGKT~L  233 (438)
T PTZ00361        214 IKPPKGVILYGPPGTGKTLL  233 (438)
T ss_pred             CCCCcEEEEECCCCCCHHHH
Confidence            33466788999999999754


No 127
>PRK14527 adenylate kinase; Provisional
Probab=89.01  E-value=0.19  Score=36.10  Aligned_cols=20  Identities=10%  Similarity=0.057  Sum_probs=16.4

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .+.++++.|+|||||+-+..
T Consensus         5 ~~~~i~i~G~pGsGKsT~a~   24 (191)
T PRK14527          5 KNKVVIFLGPPGAGKGTQAE   24 (191)
T ss_pred             CCcEEEEECCCCCCHHHHHH
Confidence            36789999999999986544


No 128
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=88.98  E-value=0.15  Score=45.27  Aligned_cols=47  Identities=11%  Similarity=0.015  Sum_probs=29.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCcee
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .+.++||++.-+..--+++-        .......++++++.||||||||-...+
T Consensus        83 ldel~~~~~ki~~l~~~l~~--------~~~~~~~~~illL~GP~GsGKTTl~~~  129 (637)
T TIGR00602        83 QHELAVHKKKIEEVETWLKA--------QVLENAPKRILLITGPSGCGKSTTIKI  129 (637)
T ss_pred             HHHhcCcHHHHHHHHHHHHh--------cccccCCCcEEEEECCCCCCHHHHHHH
Confidence            56799999765542221111        011123578899999999999865443


No 129
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=88.98  E-value=0.18  Score=40.38  Aligned_cols=21  Identities=19%  Similarity=0.172  Sum_probs=16.9

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .++.+|++||||||||-+-..
T Consensus       121 ~~g~ili~G~tGSGKTT~l~a  141 (343)
T TIGR01420       121 PRGLILVTGPTGSGKSTTLAS  141 (343)
T ss_pred             cCcEEEEECCCCCCHHHHHHH
Confidence            478899999999999855443


No 130
>PRK08691 DNA polymerase III subunits gamma and tau; Validated
Probab=88.96  E-value=0.16  Score=45.94  Aligned_cols=39  Identities=21%  Similarity=0.163  Sum_probs=27.8

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+...-.          ++++++  ...+|+.||||||||-
T Consensus        15 FddIIGQe~vv~~L~~a----------i~~~rl--~Ha~Lf~GP~GvGKTT   53 (709)
T PRK08691         15 FADLVGQEHVVKALQNA----------LDEGRL--HHAYLLTGTRGVGKTT   53 (709)
T ss_pred             HHHHcCcHHHHHHHHHH----------HHcCCC--CeEEEEECCCCCcHHH
Confidence            56799999998854332          222332  4578999999999984


No 131
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=88.93  E-value=0.046  Score=39.97  Aligned_cols=51  Identities=25%  Similarity=0.173  Sum_probs=33.4

Q ss_pred             ccCcccchHHHHhhcceeeec-ccceeeeeccccccccceEE--ecCCCCCCCCCCceeeeee
Q psy2779          35 MAAGLVGQQAAREVSRAVTWE-KSFQFERCKSHSLFRGGRAV--AGGRTKCPKPPNTSMIIDS   94 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm-~~~~~~~~~~~~~~~g~~ll--~~G~p~~g~~~~~~~~~~~   94 (101)
                      -..-+.||..|.+.   |++. +.|.    .+.  -..+.|+  +-|+|||||+=.++||.++
T Consensus        23 L~~~l~GQhla~~~---v~~ai~~~l----~~~--~p~KpLVlSfHG~tGtGKn~v~~liA~~   76 (127)
T PF06309_consen   23 LQRNLFGQHLAVEV---VVNAIKGHL----ANP--NPRKPLVLSFHGWTGTGKNFVSRLIAEH   76 (127)
T ss_pred             HHHHccCcHHHHHH---HHHHHHHHH----cCC--CCCCCEEEEeecCCCCcHHHHHHHHHHH
Confidence            34568999999886   4444 1111    111  1334444  7899999999888888766


No 132
>KOG0727|consensus
Probab=88.92  E-value=0.28  Score=41.73  Aligned_cols=63  Identities=19%  Similarity=0.116  Sum_probs=35.8

Q ss_pred             cccccccCCCCCCcccccC-cccch-HHHHhhcceeeecccce-eeeeccccccccceEEecCCCCCCCCC
Q psy2779          19 SHVKGLGLKENGEANEMAA-GLVGQ-QAAREVSRAVTWEKSFQ-FERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        19 SHIkGLGLde~g~a~~~a~-GlVGQ-~~AREAaGIVVdm~~~~-~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      |.|-=|+-|+.-...+..- |+==| .+-|||..+-+--  ++ |.++   .+---|-+|+-||||||||-
T Consensus       139 ssi~ml~~~ekpdvsy~diggld~qkqeireavelplt~--~~ly~qi---gidpprgvllygppg~gktm  204 (408)
T KOG0727|consen  139 SSISMLGPDEKPDVSYADIGGLDVQKQEIREAVELPLTH--ADLYKQI---GIDPPRGVLLYGPPGTGKTM  204 (408)
T ss_pred             ccccccCCCCCCCccccccccchhhHHHHHHHHhccchH--HHHHHHh---CCCCCcceEEeCCCCCcHHH
Confidence            3344555555544444332 34333 4679997765421  11 2233   44445668899999999973


No 133
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional
Probab=88.76  E-value=0.16  Score=43.65  Aligned_cols=17  Identities=12%  Similarity=-0.322  Sum_probs=14.3

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      -+.|++-||||||||=+
T Consensus       148 PlgllL~GPPGcGKTll  164 (413)
T PLN00020        148 PLILGIWGGKGQGKSFQ  164 (413)
T ss_pred             CeEEEeeCCCCCCHHHH
Confidence            56789999999999743


No 134
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional
Probab=88.62  E-value=0.16  Score=43.24  Aligned_cols=38  Identities=13%  Similarity=0.130  Sum_probs=26.6

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .+-+|||+.+.+..   .+.       +++++.  ..++|+.||||+|||
T Consensus        15 f~diiGq~~i~~~L---~~~-------i~~~~i--~hayLf~Gp~G~GKT   52 (486)
T PRK14953         15 FKEVIGQEIVVRIL---KNA-------VKLQRV--SHAYIFAGPRGTGKT   52 (486)
T ss_pred             HHHccChHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHH
Confidence            46789999988743   344       333332  457789999999994


No 135
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional
Probab=88.56  E-value=0.14  Score=45.35  Aligned_cols=40  Identities=18%  Similarity=0.112  Sum_probs=27.8

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+-+|||+.+.++.   .++       ++++++  -.++|+.|++|||||-
T Consensus        14 ~f~dviGQe~vv~~L---~~~-------l~~~rl--~ha~Lf~Gp~GvGKTt   53 (618)
T PRK14951         14 SFSEMVGQEHVVQAL---TNA-------LTQQRL--HHAYLFTGTRGVGKTT   53 (618)
T ss_pred             CHHHhcCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCCHHH
Confidence            357799999988743   333       333332  4568999999999973


No 136
>PRK06620 hypothetical protein; Validated
Probab=88.50  E-value=0.19  Score=37.89  Aligned_cols=16  Identities=13%  Similarity=-0.074  Sum_probs=13.4

Q ss_pred             ceEEecCCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPPN   87 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~   87 (101)
                      +.+++.||||||||=.
T Consensus        45 ~~l~l~Gp~G~GKThL   60 (214)
T PRK06620         45 FTLLIKGPSSSGKTYL   60 (214)
T ss_pred             ceEEEECCCCCCHHHH
Confidence            5689999999999843


No 137
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=88.44  E-value=0.17  Score=45.88  Aligned_cols=47  Identities=17%  Similarity=0.087  Sum_probs=29.2

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeecccccc---ccceEEecCCCCCCCCCCc
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLF---RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~---~g~~ll~~G~p~~g~~~~~   88 (101)
                      -..-++||..|-++.--.+..       ++++-.-   .-+.+|+.||||+|||-..
T Consensus       564 L~~~v~GQ~~Av~~v~~~i~~-------~~~gl~~~~~p~~~~lf~Gp~GvGKT~lA  613 (852)
T TIGR03345       564 LAERVIGQDHALEAIAERIRT-------ARAGLEDPRKPLGVFLLVGPSGVGKTETA  613 (852)
T ss_pred             hcCeEcChHHHHHHHHHHHHH-------HhcCCCCCCCCceEEEEECCCCCCHHHHH
Confidence            345789999998865433332       2211100   1236899999999998544


No 138
>KOG2028|consensus
Probab=88.40  E-value=0.12  Score=45.38  Aligned_cols=56  Identities=13%  Similarity=0.033  Sum_probs=44.6

Q ss_pred             cccccCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          21 VKGLGLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        21 IkGLGLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      |.++=|.|...|+. -+-.|||.++----|++-.+       ++++.+   --+++-||||||||-.
T Consensus       123 ~qh~PLaermRPkt-L~dyvGQ~hlv~q~gllrs~-------ieq~~i---pSmIlWGppG~GKTtl  178 (554)
T KOG2028|consen  123 LQHKPLAERMRPKT-LDDYVGQSHLVGQDGLLRSL-------IEQNRI---PSMILWGPPGTGKTTL  178 (554)
T ss_pred             hccCChhhhcCcch-HHHhcchhhhcCcchHHHHH-------HHcCCC---CceEEecCCCCchHHH
Confidence            36778888888876 57799999988878888888       766664   3467999999999854


No 139
>CHL00176 ftsH cell division protein; Validated
Probab=88.19  E-value=0.16  Score=44.87  Aligned_cols=45  Identities=18%  Similarity=0.055  Sum_probs=29.2

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeecccccc------ccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLF------RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~------~g~~ll~~G~p~~g~~~   86 (101)
                      ..+-++|++++.+...-+++.       .+....+      --+-+|+.||||||||-
T Consensus       181 ~f~dv~G~~~~k~~l~eiv~~-------lk~~~~~~~~g~~~p~gVLL~GPpGTGKT~  231 (638)
T CHL00176        181 TFRDIAGIEEAKEEFEEVVSF-------LKKPERFTAVGAKIPKGVLLVGPPGTGKTL  231 (638)
T ss_pred             CHHhccChHHHHHHHHHHHHH-------HhCHHHHhhccCCCCceEEEECCCCCCHHH
Confidence            445688998888877666655       2211110      12348899999999974


No 140
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=88.09  E-value=0.18  Score=43.91  Aligned_cols=41  Identities=17%  Similarity=0.074  Sum_probs=27.5

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +.+-+|||..+.+++   ++.       +.+.   ....+++.||||||||-..
T Consensus       152 ~~~~iiGqs~~~~~l---~~~-------ia~~---~~~~vlL~Gp~GtGKTTLA  192 (615)
T TIGR02903       152 AFSEIVGQERAIKAL---LAK-------VASP---FPQHIILYGPPGVGKTTAA  192 (615)
T ss_pred             cHHhceeCcHHHHHH---HHH-------HhcC---CCCeEEEECCCCCCHHHHH
Confidence            345689999998863   233       2221   2345889999999997543


No 141
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=88.03  E-value=0.18  Score=39.51  Aligned_cols=17  Identities=18%  Similarity=0.138  Sum_probs=14.7

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      ..++-+|+.||||||||
T Consensus        31 ~~~~pvLl~G~~GtGKT   47 (272)
T PF12775_consen   31 SNGRPVLLVGPSGTGKT   47 (272)
T ss_dssp             HCTEEEEEESSTTSSHH
T ss_pred             HcCCcEEEECCCCCchh
Confidence            35788999999999986


No 142
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=88.01  E-value=0.2  Score=43.08  Aligned_cols=61  Identities=21%  Similarity=0.131  Sum_probs=36.6

Q ss_pred             cccccCCCCCCccccc-Ccccch-HHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          21 VKGLGLKENGEANEMA-AGLVGQ-QAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        21 IkGLGLde~g~a~~~a-~GlVGQ-~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      +..+.+++.-+..|.. .|+==| ++-|||.-+-+.- .--|.++   .+---+=+|+.||||||||
T Consensus       137 V~~M~v~e~PdvtY~dIGGL~~Qi~EirE~VELPL~~-PElF~~~---GI~PPKGVLLYGPPGTGKT  199 (406)
T COG1222         137 VSVMEVEEKPDVTYEDIGGLDEQIQEIREVVELPLKN-PELFEEL---GIDPPKGVLLYGPPGTGKT  199 (406)
T ss_pred             hheeeeccCCCCChhhccCHHHHHHHHHHHhcccccC-HHHHHHc---CCCCCCceEeeCCCCCcHH
Confidence            5566666665554432 345445 4578887665532 1224444   4434455779999999998


No 143
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=87.89  E-value=0.24  Score=38.80  Aligned_cols=47  Identities=13%  Similarity=0.005  Sum_probs=28.7

Q ss_pred             cccccCcccchHHHHhhcceee-ecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          32 ANEMAAGLVGQQAAREVSRAVT-WEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        32 a~~~a~GlVGQ~~AREAaGIVV-dm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +.+...-|+|.++-.+...-.+ +.       ++. .  ....+++.||||||||-..
T Consensus        25 ~~~~P~~l~~Re~e~~~l~~~l~~~-------~~~-~--~~~~~lI~G~~GtGKT~l~   72 (394)
T PRK00411         25 PDYVPENLPHREEQIEELAFALRPA-------LRG-S--RPLNVLIYGPPGTGKTTTV   72 (394)
T ss_pred             CCCcCCCCCCHHHHHHHHHHHHHHH-------hCC-C--CCCeEEEECCCCCCHHHHH
Confidence            3345566888887766533222 32       211 1  2456889999999998543


No 144
>KOG0730|consensus
Probab=87.87  E-value=0.22  Score=45.33  Aligned_cols=42  Identities=14%  Similarity=0.130  Sum_probs=26.4

Q ss_pred             chHHHHhhcceeeecc---cceeeeeccccccccceEEecCCCCCCCC
Q psy2779          41 GQQAAREVSRAVTWEK---SFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        41 GQ~~AREAaGIVVdm~---~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      ||++-++...--|.+-   +-.|.|.   .+-.-+-+|+.||||||||
T Consensus       438 GlE~lK~elq~~V~~p~~~pe~F~r~---Gi~ppkGVLlyGPPGC~KT  482 (693)
T KOG0730|consen  438 GLEELKRELQQAVEWPLKHPEKFARF---GISPPKGVLLYGPPGCGKT  482 (693)
T ss_pred             CHHHHHHHHHHHHhhhhhchHHHHHh---cCCCCceEEEECCCCcchH
Confidence            4666666655322221   2235666   4445677889999999987


No 145
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model.
Probab=87.85  E-value=0.19  Score=41.56  Aligned_cols=17  Identities=18%  Similarity=0.108  Sum_probs=14.5

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      ..++-+|+.|+||||||
T Consensus        62 ~~~~~ilL~G~pGtGKT   78 (327)
T TIGR01650        62 AYDRRVMVQGYHGTGKS   78 (327)
T ss_pred             hcCCcEEEEeCCCChHH
Confidence            34778999999999987


No 146
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=87.83  E-value=0.29  Score=37.10  Aligned_cols=21  Identities=14%  Similarity=0.085  Sum_probs=17.7

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..-.|..+++.|+||||||-+
T Consensus        20 gi~~g~~~~i~G~~G~GKTtl   40 (230)
T PRK08533         20 GIPAGSLILIEGDESTGKSIL   40 (230)
T ss_pred             CCCCCcEEEEECCCCCCHHHH
Confidence            344588999999999999876


No 147
>PRK10865 protein disaggregation chaperone; Provisional
Probab=87.66  E-value=0.18  Score=45.59  Aligned_cols=46  Identities=17%  Similarity=0.078  Sum_probs=28.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeecccccccc---ceEEecCCCCCCCCCCc
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRG---GRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g---~~ll~~G~p~~g~~~~~   88 (101)
                      ..-++||..|-++.---+..       ++.+-.-..   ..+|+.||||||||-..
T Consensus       567 ~~~viGQ~~ai~~l~~~i~~-------~~~gl~~~~~p~~~~Lf~Gp~G~GKT~lA  615 (857)
T PRK10865        567 HHRVIGQNEAVEAVSNAIRR-------SRAGLSDPNRPIGSFLFLGPTGVGKTELC  615 (857)
T ss_pred             CCeEeCCHHHHHHHHHHHHH-------HHhcccCCCCCCceEEEECCCCCCHHHHH
Confidence            45689999997764333322       321111011   37889999999998544


No 148
>KOG0733|consensus
Probab=87.60  E-value=0.22  Score=45.77  Aligned_cols=15  Identities=20%  Similarity=0.304  Sum_probs=12.4

Q ss_pred             cceEEecCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKP   85 (101)
Q Consensus        71 g~~ll~~G~p~~g~~   85 (101)
                      -|=+|+-||||||||
T Consensus       223 prGvLlHGPPGCGKT  237 (802)
T KOG0733|consen  223 PRGVLLHGPPGCGKT  237 (802)
T ss_pred             CCceeeeCCCCccHH
Confidence            345779999999987


No 149
>PRK09183 transposase/IS protein; Provisional
Probab=87.59  E-value=0.26  Score=38.14  Aligned_cols=19  Identities=21%  Similarity=0.106  Sum_probs=15.3

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      .|..+++.||||||||=..
T Consensus       101 ~~~~v~l~Gp~GtGKThLa  119 (259)
T PRK09183        101 RNENIVLLGPSGVGKTHLA  119 (259)
T ss_pred             cCCeEEEEeCCCCCHHHHH
Confidence            3677889999999998543


No 150
>PRK07133 DNA polymerase III subunits gamma and tau; Validated
Probab=87.44  E-value=0.24  Score=44.92  Aligned_cols=39  Identities=18%  Similarity=0.124  Sum_probs=27.0

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+.+|||+.+.+..   ...       +++++.  ..+.|+.||||+|||.
T Consensus        17 f~dIiGQe~~v~~L---~~a-------I~~~rl--~HAYLF~GP~GtGKTt   55 (725)
T PRK07133         17 FDDIVGQDHIVQTL---KNI-------IKSNKI--SHAYLFSGPRGTGKTS   55 (725)
T ss_pred             HHHhcCcHHHHHHH---HHH-------HHcCCC--CeEEEEECCCCCcHHH
Confidence            46799999987642   233       333332  4677899999999973


No 151
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=87.44  E-value=0.23  Score=33.44  Aligned_cols=16  Identities=19%  Similarity=0.208  Sum_probs=13.8

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .|+-+|+.+|||+|||
T Consensus        13 ~~~~~li~aptGsGKT   28 (169)
T PF00270_consen   13 SGKNVLISAPTGSGKT   28 (169)
T ss_dssp             TTSEEEEECSTTSSHH
T ss_pred             cCCCEEEECCCCCccH
Confidence            4667889999999997


No 152
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=87.39  E-value=0.25  Score=40.46  Aligned_cols=18  Identities=22%  Similarity=0.183  Sum_probs=15.4

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .++.+|++||||||||-.
T Consensus       133 ~~glilI~GpTGSGKTTt  150 (358)
T TIGR02524       133 QEGIVFITGATGSGKSTL  150 (358)
T ss_pred             cCCEEEEECCCCCCHHHH
Confidence            478999999999999743


No 153
>PRK05541 adenylylsulfate kinase; Provisional
Probab=87.35  E-value=0.28  Score=34.55  Aligned_cols=19  Identities=16%  Similarity=-0.011  Sum_probs=15.7

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      .|..+++.|+|||||+-..
T Consensus         6 ~~~~I~i~G~~GsGKst~a   24 (176)
T PRK05541          6 NGYVIWITGLAGSGKTTIA   24 (176)
T ss_pred             CCCEEEEEcCCCCCHHHHH
Confidence            4779999999999996443


No 154
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=87.26  E-value=0.3  Score=38.03  Aligned_cols=23  Identities=17%  Similarity=0.130  Sum_probs=18.1

Q ss_pred             ccceEEecCCCCCCCCCCceeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .++.+|++|+||||||-+...++
T Consensus        79 ~~GlilisG~tGSGKTT~l~all  101 (264)
T cd01129          79 PHGIILVTGPTGSGKTTTLYSAL  101 (264)
T ss_pred             CCCEEEEECCCCCcHHHHHHHHH
Confidence            36789999999999987665443


No 155
>TIGR02239 recomb_RAD51 DNA repair protein RAD51. This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
Probab=87.20  E-value=0.3  Score=39.15  Aligned_cols=25  Identities=12%  Similarity=-0.008  Sum_probs=20.2

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +..-.|.++++.||||||||.+.-.
T Consensus        91 gGi~~g~i~~i~G~~g~GKT~l~~~  115 (316)
T TIGR02239        91 GGIETGSITEIFGEFRTGKTQLCHT  115 (316)
T ss_pred             CCCCCCeEEEEECCCCCCcCHHHHH
Confidence            3455688999999999999987644


No 156
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=87.16  E-value=0.047  Score=38.33  Aligned_cols=28  Identities=14%  Similarity=0.164  Sum_probs=22.5

Q ss_pred             ccceEEecCCCCCCCCCCceeeeeeecc
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIIDSWVE   97 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~~~~~   97 (101)
                      .|...+++|+||+|||=+..-++-+|..
T Consensus        31 ~g~l~~i~g~~g~GKT~~~~~l~~~~~~   58 (193)
T PF13481_consen   31 RGELTLIAGPPGSGKTTLALQLAAALAT   58 (193)
T ss_dssp             TTSEEEEEECSTSSHHHHHHHHHHHHHT
T ss_pred             CCeEEEEEeCCCCCHHHHHHHHHHHHHh
Confidence            5889999999999999887666555544


No 157
>PRK09111 DNA polymerase III subunits gamma and tau; Validated
Probab=87.08  E-value=0.25  Score=43.36  Aligned_cols=46  Identities=15%  Similarity=0.108  Sum_probs=30.4

Q ss_pred             CCCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          28 ENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        28 e~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +...|. +.+.+|||+.+.+..   ..+       ++++++  -.++|+.||+|+|||-
T Consensus        16 ~KyRP~-~f~dliGq~~~v~~L---~~~-------~~~gri--~ha~L~~Gp~GvGKTt   61 (598)
T PRK09111         16 RKYRPQ-TFDDLIGQEAMVRTL---TNA-------FETGRI--AQAFMLTGVRGVGKTT   61 (598)
T ss_pred             hhhCCC-CHHHhcCcHHHHHHH---HHH-------HHcCCC--CceEEEECCCCCCHHH
Confidence            334443 457899999988763   233       223332  3478899999999974


No 158
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=87.07  E-value=0.27  Score=36.68  Aligned_cols=27  Identities=15%  Similarity=0.036  Sum_probs=21.7

Q ss_pred             ccccccceEEecCCCCCCCCCCceeee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      +....|...+++|+||+|||=+...+.
T Consensus        25 gG~~~g~~~~i~g~~G~GKT~l~~~~~   51 (271)
T cd01122          25 KGLRKGELIILTAGTGVGKTTFLREYA   51 (271)
T ss_pred             EEEcCCcEEEEEcCCCCCHHHHHHHHH
Confidence            467778999999999999997665443


No 159
>KOG0991|consensus
Probab=87.03  E-value=0.3  Score=40.92  Aligned_cols=37  Identities=16%  Similarity=0.228  Sum_probs=25.4

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +-+||-|+.-+-..++..-          +.+   --++++||||||||-
T Consensus        27 ~dIVGNe~tv~rl~via~~----------gnm---P~liisGpPG~GKTT   63 (333)
T KOG0991|consen   27 QDIVGNEDTVERLSVIAKE----------GNM---PNLIISGPPGTGKTT   63 (333)
T ss_pred             HHhhCCHHHHHHHHHHHHc----------CCC---CceEeeCCCCCchhh
Confidence            5678888876665554332          332   347899999999983


No 160
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]
Probab=86.99  E-value=0.24  Score=37.11  Aligned_cols=15  Identities=13%  Similarity=0.000  Sum_probs=13.2

Q ss_pred             eEEecCCCCCCCCCC
Q psy2779          73 RAVAGGRTKCPKPPN   87 (101)
Q Consensus        73 ~ll~~G~p~~g~~~~   87 (101)
                      ++|+.||||+||+..
T Consensus        26 alL~~Gp~G~Gktt~   40 (325)
T COG0470          26 ALLFYGPPGVGKTTA   40 (325)
T ss_pred             eeeeeCCCCCCHHHH
Confidence            799999999999753


No 161
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=86.76  E-value=0.26  Score=30.71  Aligned_cols=15  Identities=13%  Similarity=0.091  Sum_probs=12.0

Q ss_pred             EEecCCCCCCCCCCc
Q psy2779          74 AVAGGRTKCPKPPNT   88 (101)
Q Consensus        74 ll~~G~p~~g~~~~~   88 (101)
                      +.+.|+|||||+-+.
T Consensus         2 i~i~G~~gsGKst~~   16 (69)
T cd02019           2 IAITGGSGSGKSTVA   16 (69)
T ss_pred             EEEECCCCCCHHHHH
Confidence            568999999997543


No 162
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=86.64  E-value=0.26  Score=45.60  Aligned_cols=39  Identities=21%  Similarity=0.131  Sum_probs=27.6

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||++..+..-   +.       ++++++  ..++|+.|++|||||-
T Consensus        15 FdEVIGQe~Vv~~L~---~a-------L~~gRL--~HAyLFtGPpGvGKTT   53 (830)
T PRK07003         15 FASLVGQEHVVRALT---HA-------LDGGRL--HHAYLFTGTRGVGKTT   53 (830)
T ss_pred             HHHHcCcHHHHHHHH---HH-------HhcCCC--CeEEEEECCCCCCHHH
Confidence            577999999988543   22       222232  4578899999999984


No 163
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=86.55  E-value=0.26  Score=32.76  Aligned_cols=20  Identities=15%  Similarity=0.042  Sum_probs=16.4

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|..+.+.|++||||+-+
T Consensus         8 i~~g~~~~i~G~nGsGKStL   27 (137)
T PF00005_consen    8 IKPGEIVAIVGPNGSGKSTL   27 (137)
T ss_dssp             EETTSEEEEEESTTSSHHHH
T ss_pred             EcCCCEEEEEccCCCccccc
Confidence            34688999999999998643


No 164
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional
Probab=86.43  E-value=0.27  Score=42.49  Aligned_cols=39  Identities=13%  Similarity=0.131  Sum_probs=26.9

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+..-=.          +++++.  ..++|+.||||+|||-
T Consensus        15 f~~iiGq~~v~~~L~~~----------i~~~~~--~hayLf~Gp~G~GKtt   53 (576)
T PRK14965         15 FSDLTGQEHVSRTLQNA----------IDTGRV--AHAFLFTGARGVGKTS   53 (576)
T ss_pred             HHHccCcHHHHHHHHHH----------HHcCCC--CeEEEEECCCCCCHHH
Confidence            56799999987665322          222332  4567899999999863


No 165
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=86.41  E-value=0.35  Score=40.52  Aligned_cols=26  Identities=23%  Similarity=0.202  Sum_probs=20.6

Q ss_pred             cccccccceEEecCCCCCCCCCCcee
Q psy2779          65 SHSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        65 ~~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .+.+..|.++|+.||||+|||-+...
T Consensus       257 gGG~~~gs~~li~G~~G~GKt~l~~~  282 (484)
T TIGR02655       257 GGGFFKDSIILATGATGTGKTLLVSK  282 (484)
T ss_pred             cCCccCCcEEEEECCCCCCHHHHHHH
Confidence            34667788999999999999865443


No 166
>PRK00889 adenylylsulfate kinase; Provisional
Probab=86.35  E-value=0.32  Score=34.20  Aligned_cols=19  Identities=21%  Similarity=0.121  Sum_probs=16.1

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      .|.++++.|.|||||+-..
T Consensus         3 ~g~~i~~~G~~GsGKST~a   21 (175)
T PRK00889          3 RGVTVWFTGLSGAGKTTIA   21 (175)
T ss_pred             CCeEEEEECCCCCCHHHHH
Confidence            3779999999999998754


No 167
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=86.30  E-value=0.23  Score=44.60  Aligned_cols=43  Identities=21%  Similarity=0.087  Sum_probs=27.8

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeecccccc---ccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLF---RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~---~g~~ll~~G~p~~g~~   85 (101)
                      ..-++||..|-++.--.+..       +..+-.-   -...+|+.||||||||
T Consensus       564 ~~~v~GQ~~av~~v~~~i~~-------~~~gl~~~~~p~~~~Lf~Gp~GvGKt  609 (852)
T TIGR03346       564 HERVVGQDEAVEAVSDAIRR-------SRAGLSDPNRPIGSFLFLGPTGVGKT  609 (852)
T ss_pred             hcccCCChHHHHHHHHHHHH-------HhccCCCCCCCCeEEEEEcCCCCCHH
Confidence            45689999998876544443       2111000   1346889999999987


No 168
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=86.27  E-value=0.26  Score=40.46  Aligned_cols=51  Identities=10%  Similarity=-0.130  Sum_probs=27.4

Q ss_pred             CCCcccccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          29 NGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        29 ~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ...+.++.+-||--..-+.|...+..+       .+.-. -...-+++.||||||||=.
T Consensus       114 ~l~~~~tfd~fv~g~~n~~a~~~~~~~-------~~~~~-~~~~~l~l~G~~G~GKThL  164 (450)
T PRK00149        114 PLNPKYTFDNFVVGKSNRLAHAAALAV-------AENPG-KAYNPLFIYGGVGLGKTHL  164 (450)
T ss_pred             CCCCCCcccccccCCCcHHHHHHHHHH-------HhCcC-ccCCeEEEECCCCCCHHHH
Confidence            344555666655333333344444443       21111 0135689999999999843


No 169
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=86.25  E-value=0.35  Score=40.31  Aligned_cols=23  Identities=17%  Similarity=0.163  Sum_probs=19.4

Q ss_pred             cccccceEEecCCCCCCCCCCce
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..-.|..+|+.|+||||||-|..
T Consensus        27 G~p~Gs~~li~G~pGsGKT~l~~   49 (509)
T PRK09302         27 GLPKGRPTLVSGTAGTGKTLFAL   49 (509)
T ss_pred             CCCCCcEEEEEeCCCCCHHHHHH
Confidence            45579999999999999997754


No 170
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=86.08  E-value=0.35  Score=39.56  Aligned_cols=24  Identities=21%  Similarity=0.040  Sum_probs=20.1

Q ss_pred             ccccccceEEecCCCCCCCCCCce
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      +..-.|++.++.||||||||-+.-
T Consensus        50 GGlp~G~iteI~G~~GsGKTtLaL   73 (321)
T TIGR02012        50 GGLPRGRIIEIYGPESSGKTTLAL   73 (321)
T ss_pred             CCCcCCeEEEEECCCCCCHHHHHH
Confidence            466778999999999999987643


No 171
>PRK08181 transposase; Validated
Probab=85.96  E-value=0.37  Score=38.13  Aligned_cols=16  Identities=19%  Similarity=0.111  Sum_probs=13.5

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      +.-+++.||||||||=
T Consensus       106 ~~nlll~Gp~GtGKTH  121 (269)
T PRK08181        106 GANLLLFGPPGGGKSH  121 (269)
T ss_pred             CceEEEEecCCCcHHH
Confidence            4558999999999983


No 172
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=85.91  E-value=0.54  Score=37.83  Aligned_cols=23  Identities=13%  Similarity=0.072  Sum_probs=19.3

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +..-.|.+.++.||||||||-+.
T Consensus        91 GGi~~G~iteI~G~~GsGKTql~  113 (313)
T TIGR02238        91 GGIESMSITEVFGEFRCGKTQLS  113 (313)
T ss_pred             CCCcCCeEEEEECCCCCCcCHHH
Confidence            45566789999999999999765


No 173
>PRK09862 putative ATP-dependent protease; Provisional
Probab=85.83  E-value=0.52  Score=40.85  Aligned_cols=36  Identities=14%  Similarity=0.122  Sum_probs=26.5

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..=..||..+.++.-+-               ..+|..+++.|+|||||+=
T Consensus       190 ~~~v~Gq~~~~~al~la---------------a~~G~~llliG~~GsGKTt  225 (506)
T PRK09862        190 LSDVIGQEQGKRGLEIT---------------AAGGHNLLLIGPPGTGKTM  225 (506)
T ss_pred             eEEEECcHHHHhhhhee---------------ccCCcEEEEECCCCCcHHH
Confidence            34467999888884322               2258899999999999863


No 174
>PRK05480 uridine/cytidine kinase; Provisional
Probab=85.81  E-value=0.35  Score=35.05  Aligned_cols=22  Identities=18%  Similarity=0.028  Sum_probs=17.0

Q ss_pred             ccceEEecCCCCCCCCCCceee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      .+.++.++|++|||||-++..+
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~l   26 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVASTI   26 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHHH
Confidence            3668899999999998655443


No 175
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=85.76  E-value=0.27  Score=36.23  Aligned_cols=17  Identities=18%  Similarity=0.059  Sum_probs=14.5

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      .+..++.|+||||||-.
T Consensus        18 ~~~~~l~G~aGtGKT~~   34 (196)
T PF13604_consen   18 DRVSVLQGPAGTGKTTL   34 (196)
T ss_dssp             CSEEEEEESTTSTHHHH
T ss_pred             CeEEEEEECCCCCHHHH
Confidence            57889999999999843


No 176
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=85.74  E-value=0.28  Score=33.06  Aligned_cols=18  Identities=17%  Similarity=0.040  Sum_probs=14.7

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      .+.+|+.+|||||||---
T Consensus        25 ~~~~ll~~~tGsGKT~~~   42 (184)
T PF04851_consen   25 ERRVLLNAPTGSGKTIIA   42 (184)
T ss_dssp             CSEEEEEESTTSSHHHHH
T ss_pred             CCCEEEEECCCCCcChhh
Confidence            577889999999998543


No 177
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=85.74  E-value=0.38  Score=38.22  Aligned_cols=23  Identities=13%  Similarity=0.114  Sum_probs=17.5

Q ss_pred             ccceEEecCCCCCCCCCCceeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .++.+|++|+||||||-+...++
T Consensus       131 ~~~~ilI~G~tGSGKTTll~al~  153 (299)
T TIGR02782       131 ARKNILVVGGTGSGKTTLANALL  153 (299)
T ss_pred             cCCeEEEECCCCCCHHHHHHHHH
Confidence            46678899999999986654443


No 178
>PLN03186 DNA repair protein RAD51 homolog; Provisional
Probab=85.70  E-value=0.41  Score=39.21  Aligned_cols=24  Identities=13%  Similarity=0.016  Sum_probs=19.5

Q ss_pred             ccccccceEEecCCCCCCCCCCce
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      +..-.|.+.++.|+||||||.+.-
T Consensus       118 GG~~~g~i~~i~G~~g~GKT~l~~  141 (342)
T PLN03186        118 GGIETGSITEIYGEFRTGKTQLCH  141 (342)
T ss_pred             CCCcCceEEEEECCCCCCccHHHH
Confidence            345567899999999999998763


No 179
>PRK08356 hypothetical protein; Provisional
Probab=85.65  E-value=0.35  Score=35.11  Aligned_cols=15  Identities=13%  Similarity=-0.035  Sum_probs=12.5

Q ss_pred             ceEEecCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPP   86 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~   86 (101)
                      .+++++|||||||+-
T Consensus         6 ~~i~~~G~~gsGK~t   20 (195)
T PRK08356          6 MIVGVVGKIAAGKTT   20 (195)
T ss_pred             EEEEEECCCCCCHHH
Confidence            367899999999864


No 180
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=85.64  E-value=0.33  Score=35.46  Aligned_cols=19  Identities=21%  Similarity=0.184  Sum_probs=15.7

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      .|.++.+.|++|||||-+.
T Consensus         5 ~g~vi~I~G~sGsGKSTl~   23 (207)
T TIGR00235         5 KGIIIGIGGGSGSGKTTVA   23 (207)
T ss_pred             CeEEEEEECCCCCCHHHHH
Confidence            3788999999999998544


No 181
>KOG0738|consensus
Probab=85.58  E-value=0.34  Score=42.50  Aligned_cols=40  Identities=20%  Similarity=0.145  Sum_probs=23.8

Q ss_pred             cchHHH----Hhhcceeeecc-cceeeeeccccccccceEEecCCCCCCCC
Q psy2779          40 VGQQAA----REVSRAVTWEK-SFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        40 VGQ~~A----REAaGIVVdm~-~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .|-.+|    +||.=+-+.|- .||=+|-      -=+-+|+.||||||||
T Consensus       215 agl~~AK~lL~EAVvlPi~mPe~F~Girr------PWkgvLm~GPPGTGKT  259 (491)
T KOG0738|consen  215 AGLHEAKKLLKEAVVLPIWMPEFFKGIRR------PWKGVLMVGPPGTGKT  259 (491)
T ss_pred             cchHHHHHHHHHHHhhhhhhHHHHhhccc------ccceeeeeCCCCCcHH
Confidence            444555    45655555551 2333332      2356889999999997


No 182
>PLN02200 adenylate kinase family protein
Probab=85.42  E-value=0.38  Score=36.81  Aligned_cols=18  Identities=11%  Similarity=-0.141  Sum_probs=14.5

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      ..++++.|+|||||+-..
T Consensus        43 ~~ii~I~G~PGSGKsT~a   60 (234)
T PLN02200         43 PFITFVLGGPGSGKGTQC   60 (234)
T ss_pred             CEEEEEECCCCCCHHHHH
Confidence            357899999999997543


No 183
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=85.30  E-value=0.53  Score=38.74  Aligned_cols=23  Identities=13%  Similarity=-0.071  Sum_probs=19.0

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +.+..|.+..+.|+||||||-+.
T Consensus       121 GGi~~G~ItEI~G~~GsGKTql~  143 (344)
T PLN03187        121 GGIETRCITEAFGEFRSGKTQLA  143 (344)
T ss_pred             CCCCCCeEEEEecCCCCChhHHH
Confidence            35567889999999999999754


No 184
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=85.03  E-value=0.25  Score=38.91  Aligned_cols=23  Identities=13%  Similarity=0.055  Sum_probs=18.1

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|..++++|++|||||-+-..
T Consensus       141 v~~~~~ili~G~tGsGKTTll~a  163 (308)
T TIGR02788       141 IASRKNIIISGGTGSGKTTFLKS  163 (308)
T ss_pred             hhCCCEEEEECCCCCCHHHHHHH
Confidence            33688999999999999865443


No 185
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=84.96  E-value=0.43  Score=39.58  Aligned_cols=23  Identities=22%  Similarity=0.219  Sum_probs=17.1

Q ss_pred             ccceEEecCCCCCCCCCCceeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      ..+.+|++||||||||-+-..++
T Consensus       148 ~~GlilI~G~TGSGKTT~l~al~  170 (372)
T TIGR02525       148 AAGLGLICGETGSGKSTLAASIY  170 (372)
T ss_pred             cCCEEEEECCCCCCHHHHHHHHH
Confidence            35678899999999986554443


No 186
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=84.91  E-value=0.6  Score=34.31  Aligned_cols=22  Identities=23%  Similarity=0.178  Sum_probs=17.5

Q ss_pred             cccceEEecCCCCCCCCCCcee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +.+...++.||+||||+-.-.+
T Consensus        21 ~~~~~~~i~GpNGsGKStll~a   42 (243)
T cd03272          21 FSPKHNVVVGRNGSGKSNFFAA   42 (243)
T ss_pred             CCCCcEEEECCCCCCHHHHHHH
Confidence            4578999999999999865433


No 187
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=84.81  E-value=0.48  Score=35.17  Aligned_cols=19  Identities=11%  Similarity=0.062  Sum_probs=16.2

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      .|+++++.||+||||+-+-
T Consensus        24 ~g~~~~ltGpNg~GKSTll   42 (199)
T cd03283          24 KKNGILITGSNMSGKSTFL   42 (199)
T ss_pred             CCcEEEEECCCCCChHHHH
Confidence            4789999999999998553


No 188
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=84.57  E-value=0.48  Score=38.88  Aligned_cols=25  Identities=12%  Similarity=-0.059  Sum_probs=20.0

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +.+-.|++.++.||||||||-+.-.
T Consensus        50 GGlp~G~iteI~Gp~GsGKTtLal~   74 (325)
T cd00983          50 GGYPKGRIIEIYGPESSGKTTLALH   74 (325)
T ss_pred             CCccCCeEEEEECCCCCCHHHHHHH
Confidence            4556689999999999999866543


No 189
>PHA00729 NTP-binding motif containing protein
Probab=84.47  E-value=0.38  Score=37.80  Aligned_cols=15  Identities=27%  Similarity=0.186  Sum_probs=12.7

Q ss_pred             eEEecCCCCCCCCCC
Q psy2779          73 RAVAGGRTKCPKPPN   87 (101)
Q Consensus        73 ~ll~~G~p~~g~~~~   87 (101)
                      .+++.|+||||||=.
T Consensus        19 nIlItG~pGvGKT~L   33 (226)
T PHA00729         19 SAVIFGKQGSGKTTY   33 (226)
T ss_pred             EEEEECCCCCCHHHH
Confidence            578999999999843


No 190
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=84.34  E-value=0.44  Score=41.84  Aligned_cols=16  Identities=25%  Similarity=0.239  Sum_probs=14.2

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .-+++|++||||||||
T Consensus       257 p~GliLvTGPTGSGKT  272 (500)
T COG2804         257 PQGLILVTGPTGSGKT  272 (500)
T ss_pred             CCeEEEEeCCCCCCHH
Confidence            3678999999999987


No 191
>TIGR02902 spore_lonB ATP-dependent protease LonB. Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.
Probab=84.30  E-value=0.5  Score=40.40  Aligned_cols=36  Identities=17%  Similarity=0.274  Sum_probs=24.5

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      +-+|||..+-+++-..  +       + +.   ...-+|+.|||||||+
T Consensus        65 ~~iiGqs~~i~~l~~a--l-------~-~~---~~~~vLi~Ge~GtGKt  100 (531)
T TIGR02902        65 DEIIGQEEGIKALKAA--L-------C-GP---NPQHVIIYGPPGVGKT  100 (531)
T ss_pred             HHeeCcHHHHHHHHHH--H-------h-CC---CCceEEEECCCCCCHH
Confidence            4599999887766421  1       1 11   1356789999999994


No 192
>PRK10436 hypothetical protein; Provisional
Probab=84.28  E-value=0.53  Score=40.11  Aligned_cols=17  Identities=24%  Similarity=0.190  Sum_probs=15.2

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      ..+++|++||||||||-
T Consensus       217 ~~GliLvtGpTGSGKTT  233 (462)
T PRK10436        217 PQGLILVTGPTGSGKTV  233 (462)
T ss_pred             cCCeEEEECCCCCChHH
Confidence            57899999999999984


No 193
>PRK10787 DNA-binding ATP-dependent protease La; Provisional
Probab=84.24  E-value=0.39  Score=43.31  Aligned_cols=44  Identities=9%  Similarity=-0.055  Sum_probs=28.5

Q ss_pred             cccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          38 GLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        38 GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      -..|++++.|+.--.+..       .+..+...|..+++.||||||||-..
T Consensus       323 ~~~g~~~vK~~i~~~l~~-------~~~~~~~~g~~i~l~GppG~GKTtl~  366 (784)
T PRK10787        323 DHYGLERVKDRILEYLAV-------QSRVNKIKGPILCLVGPPGVGKTSLG  366 (784)
T ss_pred             hccCHHHHHHHHHHHHHH-------HHhcccCCCceEEEECCCCCCHHHHH
Confidence            378999999876322221       01112235789999999999987443


No 194
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=84.17  E-value=0.24  Score=40.59  Aligned_cols=25  Identities=16%  Similarity=0.102  Sum_probs=19.3

Q ss_pred             ccceEEecCCCCCCCCCCceeeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIIDS   94 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~~   94 (101)
                      +++-+|++|+||||||-+-..+++.
T Consensus       161 ~~~nilI~G~tGSGKTTll~aLl~~  185 (344)
T PRK13851        161 GRLTMLLCGPTGSGKTTMSKTLISA  185 (344)
T ss_pred             cCCeEEEECCCCccHHHHHHHHHcc
Confidence            5778999999999998665544443


No 195
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=84.00  E-value=0.37  Score=40.16  Aligned_cols=25  Identities=28%  Similarity=0.315  Sum_probs=20.8

Q ss_pred             ccccccceEEecCCCCCCCCCCcee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +....|..+|+.|+||||||.+..-
T Consensus       268 GG~~~g~~~li~G~~G~GKT~l~~~  292 (509)
T PRK09302        268 GGFFRGSIILVSGATGTGKTLLASK  292 (509)
T ss_pred             CCCCCCcEEEEEcCCCCCHHHHHHH
Confidence            4566789999999999999987644


No 196
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=83.98  E-value=0.44  Score=37.11  Aligned_cols=40  Identities=8%  Similarity=0.065  Sum_probs=26.6

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCCc
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +-+|||+.+.+..   .+.       ++.+++  ..++|+.||+|+||+.+-
T Consensus         4 ~~i~g~~~~~~~l---~~~-------~~~~~~--~ha~Lf~G~~G~Gk~~la   43 (313)
T PRK05564          4 HTIIGHENIKNRI---KNS-------IIKNRF--SHAHIIVGEDGIGKSLLA   43 (313)
T ss_pred             hhccCcHHHHHHH---HHH-------HHcCCC--CceEEeECCCCCCHHHHH
Confidence            4578999987652   233       233332  457899999999987543


No 197
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=83.97  E-value=0.6  Score=30.82  Aligned_cols=15  Identities=13%  Similarity=0.040  Sum_probs=13.4

Q ss_pred             ceEEecCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPP   86 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~   86 (101)
                      +.+++.|++|||||=
T Consensus        25 ~~~~i~~~~GsGKT~   39 (201)
T smart00487       25 RDVILAAPTGSGKTL   39 (201)
T ss_pred             CcEEEECCCCCchhH
Confidence            678899999999985


No 198
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=83.94  E-value=0.47  Score=38.72  Aligned_cols=19  Identities=21%  Similarity=0.081  Sum_probs=15.3

Q ss_pred             cceEEecCCCCCCCCCCce
Q psy2779          71 GGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~   89 (101)
                      ++-+|++|+||||||-+..
T Consensus       144 ~~nilI~G~tGSGKTTll~  162 (323)
T PRK13833        144 RLNIVISGGTGSGKTTLAN  162 (323)
T ss_pred             CCeEEEECCCCCCHHHHHH
Confidence            5568899999999986543


No 199
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=83.93  E-value=0.55  Score=41.12  Aligned_cols=52  Identities=12%  Similarity=-0.012  Sum_probs=28.4

Q ss_pred             ccCcccchHHHHhhcceeeecccceee-eeccccccccceEEecCCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFE-RCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~-~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-+.++|..++.+.+-=.+.+- +..- ..+.-..-.++-+|+.||||||||-.
T Consensus       176 ~~~di~G~~~~~~~l~~~i~~~-~~~~~~~~~~gi~~~~giLL~GppGtGKT~l  228 (733)
T TIGR01243       176 TYEDIGGLKEAKEKIREMVELP-MKHPELFEHLGIEPPKGVLLYGPPGTGKTLL  228 (733)
T ss_pred             CHHHhcCHHHHHHHHHHHHHHH-hhCHHHHHhcCCCCCceEEEECCCCCChHHH
Confidence            3445778877766554333320 0000 00111223456788999999999854


No 200
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional
Probab=83.85  E-value=0.49  Score=41.58  Aligned_cols=39  Identities=21%  Similarity=0.115  Sum_probs=26.1

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+-.   ..+       +.++++  ..++|+.||||+||+.
T Consensus        15 f~~liGq~~i~~~L---~~~-------l~~~rl--~~a~Lf~Gp~G~GKtt   53 (620)
T PRK14948         15 FDELVGQEAIATTL---KNA-------LISNRI--APAYLFTGPRGTGKTS   53 (620)
T ss_pred             HhhccChHHHHHHH---HHH-------HHcCCC--CceEEEECCCCCChHH
Confidence            46689999886642   222       222232  3578999999999984


No 201
>PRK08727 hypothetical protein; Validated
Probab=83.67  E-value=0.44  Score=35.95  Aligned_cols=16  Identities=13%  Similarity=-0.045  Sum_probs=13.4

Q ss_pred             ceEEecCCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPPN   87 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~   87 (101)
                      ..+++.|++|||||=.
T Consensus        42 ~~l~l~G~~G~GKThL   57 (233)
T PRK08727         42 DWLYLSGPAGTGKTHL   57 (233)
T ss_pred             CeEEEECCCCCCHHHH
Confidence            4589999999999843


No 202
>PLN02165 adenylate isopentenyltransferase
Probab=83.66  E-value=0.54  Score=39.00  Aligned_cols=16  Identities=25%  Similarity=0.102  Sum_probs=14.4

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      |.+++|.||||||||-
T Consensus        43 g~iivIiGPTGSGKSt   58 (334)
T PLN02165         43 DKVVVIMGATGSGKSR   58 (334)
T ss_pred             CCEEEEECCCCCcHHH
Confidence            7799999999999973


No 203
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=83.59  E-value=0.5  Score=32.37  Aligned_cols=15  Identities=13%  Similarity=0.167  Sum_probs=12.0

Q ss_pred             cceEEecCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKP   85 (101)
Q Consensus        71 g~~ll~~G~p~~g~~   85 (101)
                      ..-+|+.|+|||||.
T Consensus        21 ~~pvli~GE~GtGK~   35 (138)
T PF14532_consen   21 SSPVLITGEPGTGKS   35 (138)
T ss_dssp             SS-EEEECCTTSSHH
T ss_pred             CCcEEEEcCCCCCHH
Confidence            456889999999974


No 204
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=83.58  E-value=0.82  Score=33.23  Aligned_cols=24  Identities=21%  Similarity=0.076  Sum_probs=18.7

Q ss_pred             ccccceEEecCCCCCCCCCCceee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +-.|..+++.||+||||+-+-.++
T Consensus        26 l~~~~~~~l~G~Ng~GKStll~~i   49 (202)
T cd03243          26 LGSGRLLLITGPNMGGKSTYLRSI   49 (202)
T ss_pred             EcCCeEEEEECCCCCccHHHHHHH
Confidence            335689999999999998665544


No 205
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=83.49  E-value=0.68  Score=34.15  Aligned_cols=25  Identities=16%  Similarity=-0.064  Sum_probs=19.4

Q ss_pred             cccccceEEecCCCCCCCCCCceee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      ..-.|.++.+.||+|||||-.-.++
T Consensus        17 ~i~~G~~~~l~G~nG~GKSTLl~~i   41 (176)
T cd03238          17 SIPLNVLVVVTGVSGSGKSTLVNEG   41 (176)
T ss_pred             EEcCCCEEEEECCCCCCHHHHHHHH
Confidence            4456899999999999998654433


No 206
>PRK11823 DNA repair protein RadA; Provisional
Probab=83.39  E-value=0.54  Score=39.40  Aligned_cols=27  Identities=19%  Similarity=0.201  Sum_probs=20.6

Q ss_pred             ccccccceEEecCCCCCCCCCCceeee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      +....|.++|+.|+||+|||-+...+.
T Consensus        75 GGi~~Gs~~lI~G~pG~GKTtL~lq~a  101 (446)
T PRK11823         75 GGLVPGSVVLIGGDPGIGKSTLLLQVA  101 (446)
T ss_pred             CCccCCEEEEEECCCCCCHHHHHHHHH
Confidence            355567899999999999987654443


No 207
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=83.33  E-value=0.6  Score=38.76  Aligned_cols=24  Identities=25%  Similarity=0.267  Sum_probs=18.7

Q ss_pred             cccccceEEecCCCCCCCCCCcee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +.-.|..+++-||.||||+-+--|
T Consensus        25 ~i~~Gef~vllGPSGcGKSTlLr~   48 (338)
T COG3839          25 DIEDGEFVVLLGPSGCGKSTLLRM   48 (338)
T ss_pred             EEcCCCEEEEECCCCCCHHHHHHH
Confidence            455688999999999999754433


No 208
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=83.25  E-value=0.58  Score=39.88  Aligned_cols=19  Identities=21%  Similarity=0.179  Sum_probs=15.7

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      ..+++|++||||||||-..
T Consensus       241 ~~GlilitGptGSGKTTtL  259 (486)
T TIGR02533       241 PHGIILVTGPTGSGKTTTL  259 (486)
T ss_pred             CCCEEEEEcCCCCCHHHHH
Confidence            4678999999999998544


No 209
>PRK07667 uridine kinase; Provisional
Probab=83.19  E-value=0.35  Score=35.33  Aligned_cols=19  Identities=11%  Similarity=-0.090  Sum_probs=15.6

Q ss_pred             cceEEecCCCCCCCCCCce
Q psy2779          71 GGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..++.++|+||||||.++.
T Consensus        17 ~~iIgI~G~~gsGKStla~   35 (193)
T PRK07667         17 RFILGIDGLSRSGKTTFVA   35 (193)
T ss_pred             CEEEEEECCCCCCHHHHHH
Confidence            3677899999999998654


No 210
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=83.19  E-value=0.59  Score=36.57  Aligned_cols=20  Identities=25%  Similarity=0.280  Sum_probs=16.2

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .++++++.||+|+|||-...
T Consensus       193 ~~~vi~~vGptGvGKTTt~~  212 (282)
T TIGR03499       193 QGGVIALVGPTGVGKTTTLA  212 (282)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            47799999999999985443


No 211
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional
Probab=83.15  E-value=0.36  Score=43.04  Aligned_cols=39  Identities=13%  Similarity=0.210  Sum_probs=25.9

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+   ++..+       +++++.  --++|+.||||||||-
T Consensus        15 f~dIiGQe~v~~---~L~~a-------i~~~ri--~ha~Lf~GPpG~GKTt   53 (624)
T PRK14959         15 FAEVAGQETVKA---ILSRA-------AQENRV--APAYLFSGTRGVGKTT   53 (624)
T ss_pred             HHHhcCCHHHHH---HHHHH-------HHcCCC--CceEEEECCCCCCHHH
Confidence            467899998733   33344       333332  2478899999999974


No 212
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=83.10  E-value=0.38  Score=35.30  Aligned_cols=17  Identities=18%  Similarity=0.092  Sum_probs=12.8

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      +.-|++.|+||||||=.
T Consensus        47 ~~~l~l~G~~G~GKThL   63 (178)
T PF01695_consen   47 GENLILYGPPGTGKTHL   63 (178)
T ss_dssp             --EEEEEESTTSSHHHH
T ss_pred             CeEEEEEhhHhHHHHHH
Confidence            44588999999999844


No 213
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=83.09  E-value=0.66  Score=31.80  Aligned_cols=18  Identities=28%  Similarity=0.283  Sum_probs=14.0

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      |..++-++.||+|||||-
T Consensus        17 f~~g~~vi~G~Ng~GKSt   34 (202)
T PF13476_consen   17 FSPGLNVIYGPNGSGKST   34 (202)
T ss_dssp             --SEEEEEEESTTSSHHH
T ss_pred             cCCCcEEEECCCCCCHHH
Confidence            356789999999999964


No 214
>KOG0989|consensus
Probab=83.05  E-value=0.56  Score=39.75  Aligned_cols=38  Identities=16%  Similarity=-0.033  Sum_probs=24.1

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-++||+.+-.+.-   .-       ++  + .-.-.+|+-||||||||-
T Consensus        35 ~de~~gQe~vV~~L~---~a-------~~--~-~~lp~~LFyGPpGTGKTS   72 (346)
T KOG0989|consen   35 FDELAGQEHVVQVLK---NA-------LL--R-RILPHYLFYGPPGTGKTS   72 (346)
T ss_pred             HHhhcchHHHHHHHH---HH-------Hh--h-cCCceEEeeCCCCCcHhH
Confidence            577899987543321   00       11  1 124568899999999984


No 215
>TIGR00665 DnaB replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of  400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites.
Probab=83.04  E-value=0.64  Score=37.72  Aligned_cols=26  Identities=15%  Similarity=0.050  Sum_probs=21.2

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+-.|..++++|+||+|||-|...++
T Consensus       191 G~~~G~l~vi~g~pg~GKT~~~l~~a  216 (434)
T TIGR00665       191 GLQPSDLIILAARPSMGKTAFALNIA  216 (434)
T ss_pred             CCCCCeEEEEEeCCCCChHHHHHHHH
Confidence            45668899999999999998876544


No 216
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=82.86  E-value=0.25  Score=40.05  Aligned_cols=24  Identities=17%  Similarity=0.149  Sum_probs=18.3

Q ss_pred             ccceEEecCCCCCCCCCCceeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIID   93 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~   93 (101)
                      +++-+|++|+||||||-+.-.+++
T Consensus       159 ~~~nili~G~tgSGKTTll~aL~~  182 (332)
T PRK13900        159 SKKNIIISGGTSTGKTTFTNAALR  182 (332)
T ss_pred             cCCcEEEECCCCCCHHHHHHHHHh
Confidence            477889999999999866544333


No 217
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=82.83  E-value=0.6  Score=40.18  Aligned_cols=18  Identities=22%  Similarity=0.222  Sum_probs=15.5

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      ..+.+|++||||||||-.
T Consensus       315 ~~Glilv~G~tGSGKTTt  332 (564)
T TIGR02538       315 PQGMVLVTGPTGSGKTVS  332 (564)
T ss_pred             cCCeEEEECCCCCCHHHH
Confidence            468899999999999854


No 218
>PRK15455 PrkA family serine protein kinase; Provisional
Probab=82.72  E-value=0.75  Score=41.64  Aligned_cols=44  Identities=14%  Similarity=-0.079  Sum_probs=27.7

Q ss_pred             CcccchHHHHhhcceeeecccceeee--eccccccccceEEecCCCCCCCCCCce
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFER--CKSHSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~--~~~~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .-+.|++++-+..   |+-     .+  .+. -.-.+++|++.||||+|||.+..
T Consensus        76 ~d~yGlee~ieri---v~~-----l~~Aa~g-l~~~~~IL~LvGPpG~GKSsLa~  121 (644)
T PRK15455         76 EEFYGMEEAIEQI---VSY-----FRHAAQG-LEEKKQILYLLGPVGGGKSSLAE  121 (644)
T ss_pred             hcccCcHHHHHHH---HHH-----HHHHHHh-cCCCCceEEEecCCCCCchHHHH
Confidence            3578999887752   121     10  000 01147899999999999987644


No 219
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=82.69  E-value=0.63  Score=38.88  Aligned_cols=22  Identities=32%  Similarity=0.318  Sum_probs=17.6

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ...|+++++.||||+|||-...
T Consensus       134 ~~~g~ii~lvGptGvGKTTtia  155 (374)
T PRK14722        134 MERGGVFALMGPTGVGKTTTTA  155 (374)
T ss_pred             ccCCcEEEEECCCCCCHHHHHH
Confidence            3458899999999999985443


No 220
>KOG0741|consensus
Probab=82.44  E-value=0.67  Score=42.32  Aligned_cols=48  Identities=21%  Similarity=0.306  Sum_probs=29.6

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccc-------cccc--------------------cceEEecCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSH-------SLFR--------------------GGRAVAGGRTKCPKP   85 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~-------~~~~--------------------g~~ll~~G~p~~g~~   85 (101)
                      =-++|+-+-|.+.-+|.+- .|.|+..-=+       ++|+                    =+=+|+-||||||||
T Consensus       196 lnL~~~~~~k~~~n~ii~P-df~Fe~mGIGGLd~EFs~IFRRAFAsRvFpp~vie~lGi~HVKGiLLyGPPGTGKT  270 (744)
T KOG0741|consen  196 LNLIGKSKTKPASNSIINP-DFNFESMGIGGLDKEFSDIFRRAFASRVFPPEVIEQLGIKHVKGILLYGPPGTGKT  270 (744)
T ss_pred             eEeeccccccchhccccCC-CCChhhcccccchHHHHHHHHHHHHhhcCCHHHHHHcCccceeeEEEECCCCCChh
Confidence            3467777777777777765 5666543111       1111                    123679999999997


No 221
>PRK08451 DNA polymerase III subunits gamma and tau; Validated
Probab=82.35  E-value=0.5  Score=41.24  Aligned_cols=40  Identities=15%  Similarity=0.159  Sum_probs=27.1

Q ss_pred             ccCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +.+-+|||+.+.+..--.+          +++++  ..++|+.||||+|||-
T Consensus        12 ~fdeiiGqe~v~~~L~~~I----------~~grl--~hayLf~Gp~G~GKTt   51 (535)
T PRK08451         12 HFDELIGQESVSKTLSLAL----------DNNRL--AHAYLFSGLRGSGKTS   51 (535)
T ss_pred             CHHHccCcHHHHHHHHHHH----------HcCCC--CeeEEEECCCCCcHHH
Confidence            3567999999875543222          22332  4567899999999874


No 222
>PRK09354 recA recombinase A; Provisional
Probab=82.22  E-value=0.68  Score=38.48  Aligned_cols=27  Identities=22%  Similarity=0.070  Sum_probs=21.1

Q ss_pred             ccccccceEEecCCCCCCCCCCceeee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      +..-.|++.++.||||||||-+.-.++
T Consensus        55 GGip~G~IteI~G~~GsGKTtLal~~~   81 (349)
T PRK09354         55 GGLPRGRIVEIYGPESSGKTTLALHAI   81 (349)
T ss_pred             CCCcCCeEEEEECCCCCCHHHHHHHHH
Confidence            456668899999999999997655433


No 223
>PTZ00035 Rad51 protein; Provisional
Probab=82.21  E-value=0.86  Score=36.96  Aligned_cols=22  Identities=14%  Similarity=0.018  Sum_probs=18.3

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ..-.|.+..+.|+||||||-+.
T Consensus       114 Gi~~G~iteI~G~~GsGKT~l~  135 (337)
T PTZ00035        114 GIETGSITELFGEFRTGKTQLC  135 (337)
T ss_pred             CCCCCeEEEEECCCCCchhHHH
Confidence            4556788999999999999765


No 224
>KOG0739|consensus
Probab=81.86  E-value=0.98  Score=39.05  Aligned_cols=43  Identities=16%  Similarity=-0.008  Sum_probs=28.2

Q ss_pred             cchHHHHhhcc--eeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          40 VGQQAAREVSR--AVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        40 VGQ~~AREAaG--IVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      -|-+.|.||..  +|+-+|.-||   =++++.-=+.+|+-|||||||.
T Consensus       136 AGLE~AKeALKEAVILPIKFPql---FtGkR~PwrgiLLyGPPGTGKS  180 (439)
T KOG0739|consen  136 AGLEGAKEALKEAVILPIKFPQL---FTGKRKPWRGILLYGPPGTGKS  180 (439)
T ss_pred             ccchhHHHHHHhheeecccchhh---hcCCCCcceeEEEeCCCCCcHH
Confidence            35566666653  5666644444   3446555677899999999984


No 225
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=81.77  E-value=0.65  Score=37.52  Aligned_cols=24  Identities=21%  Similarity=0.144  Sum_probs=18.0

Q ss_pred             ccceEEecCCCCCCCCCCceeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIID   93 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~   93 (101)
                      +++-+|++|+||||||-+...+++
T Consensus       147 ~~~~ilI~G~tGSGKTTll~aL~~  170 (319)
T PRK13894        147 AHRNILVIGGTGSGKTTLVNAIIN  170 (319)
T ss_pred             cCCeEEEECCCCCCHHHHHHHHHH
Confidence            467788999999999965544443


No 226
>TIGR00376 DNA helicase, putative. The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Probab=81.67  E-value=0.64  Score=40.81  Aligned_cols=22  Identities=14%  Similarity=0.034  Sum_probs=16.1

Q ss_pred             cceEEecCCCCCCCCCCceeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      ...+|+-||||||||-.-.-++
T Consensus       173 ~~~~lI~GpPGTGKT~t~~~ii  194 (637)
T TIGR00376       173 KDLFLIHGPPGTGKTRTLVELI  194 (637)
T ss_pred             CCeEEEEcCCCCCHHHHHHHHH
Confidence            3678899999999985433333


No 227
>KOG0735|consensus
Probab=81.59  E-value=0.34  Score=45.29  Aligned_cols=25  Identities=20%  Similarity=0.118  Sum_probs=19.5

Q ss_pred             cceEEecCCCCCCCCCCceeeeeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      ..=+|+-||||||||-..|-++.+|
T Consensus       701 ~~giLLyGppGcGKT~la~a~a~~~  725 (952)
T KOG0735|consen  701 RTGILLYGPPGCGKTLLASAIASNS  725 (952)
T ss_pred             ccceEEECCCCCcHHHHHHHHHhhC
Confidence            3346799999999998877776665


No 228
>PRK09087 hypothetical protein; Validated
Probab=81.46  E-value=0.76  Score=34.92  Aligned_cols=50  Identities=14%  Similarity=-0.012  Sum_probs=29.0

Q ss_pred             cCCCCCCcccccCcccc-hHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          25 GLKENGEANEMAAGLVG-QQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        25 GLde~g~a~~~a~GlVG-Q~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      -|+=...+.+..+-||. ..+ ++|..++.+.       . + .  ....+++.||+|||||=
T Consensus         9 ~l~~~~~~~~~~~~Fi~~~~N-~~a~~~l~~~-------~-~-~--~~~~l~l~G~~GsGKTh   59 (226)
T PRK09087          9 PLNFSHDPAYGRDDLLVTESN-RAAVSLVDHW-------P-N-W--PSPVVVLAGPVGSGKTH   59 (226)
T ss_pred             eeCCCCCCCCChhceeecCch-HHHHHHHHhc-------c-c-C--CCCeEEEECCCCCCHHH
Confidence            34433444556677764 434 3354444443       1 1 1  25678999999999974


No 229
>PRK10875 recD exonuclease V subunit alpha; Provisional
Probab=81.44  E-value=0.6  Score=41.19  Aligned_cols=26  Identities=12%  Similarity=0.147  Sum_probs=18.9

Q ss_pred             ccceEEecCCCCCCCCCCceeeeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      ..+..++.|+||||||-....++..+
T Consensus       166 ~~~~~vItGgpGTGKTt~v~~ll~~l  191 (615)
T PRK10875        166 TRRISVISGGPGTGKTTTVAKLLAAL  191 (615)
T ss_pred             cCCeEEEEeCCCCCHHHHHHHHHHHH
Confidence            36789999999999985544444443


No 230
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a
Probab=81.39  E-value=0.81  Score=33.30  Aligned_cols=19  Identities=16%  Similarity=-0.003  Sum_probs=15.5

Q ss_pred             ceEEecCCCCCCCCCCcee
Q psy2779          72 GRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~~~   90 (101)
                      +++++.||+|+||+-+--+
T Consensus        29 ~~~~ltG~Ng~GKStll~~   47 (200)
T cd03280          29 RVLVITGPNAGGKTVTLKT   47 (200)
T ss_pred             eEEEEECCCCCChHHHHHH
Confidence            6899999999999865443


No 231
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=81.29  E-value=0.54  Score=39.20  Aligned_cols=47  Identities=13%  Similarity=-0.076  Sum_probs=26.2

Q ss_pred             CCcccccCccc-chHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          30 GEANEMAAGLV-GQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        30 g~a~~~a~GlV-GQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .++.+..+-|| |..+ +.|...+..+       .++...  -.-+++.||||||||-
T Consensus        98 l~~~~tFdnFv~g~~n-~~a~~~~~~~-------~~~~~~--~n~l~lyG~~G~GKTH  145 (440)
T PRK14088         98 LNPDYTFENFVVGPGN-SFAYHAALEV-------AKNPGR--YNPLFIYGGVGLGKTH  145 (440)
T ss_pred             CCCCCcccccccCCch-HHHHHHHHHH-------HhCcCC--CCeEEEEcCCCCcHHH
Confidence            45556666666 5433 2333333333       221111  2358999999999974


No 232
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=81.28  E-value=0.68  Score=40.12  Aligned_cols=16  Identities=13%  Similarity=0.048  Sum_probs=14.3

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .++-+++.|+||||||
T Consensus       193 ~~~~iil~GppGtGKT  208 (459)
T PRK11331        193 IKKNIILQGPPGVGKT  208 (459)
T ss_pred             cCCCEEEECCCCCCHH
Confidence            5778889999999998


No 233
>PHA02244 ATPase-like protein
Probab=81.26  E-value=0.67  Score=39.39  Aligned_cols=16  Identities=13%  Similarity=-0.045  Sum_probs=13.5

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      +.-+||.||||||||-
T Consensus       119 ~~PVLL~GppGtGKTt  134 (383)
T PHA02244        119 NIPVFLKGGAGSGKNH  134 (383)
T ss_pred             CCCEEEECCCCCCHHH
Confidence            5568899999999973


No 234
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=81.19  E-value=0.72  Score=38.91  Aligned_cols=26  Identities=15%  Similarity=0.189  Sum_probs=20.7

Q ss_pred             ccccccceEEecCCCCCCCCCCceee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +....|.++|++|+||+|||=+.-.+
T Consensus        89 GGi~~GsvilI~G~pGsGKTTL~lq~  114 (454)
T TIGR00416        89 GGIVPGSLILIGGDPGIGKSTLLLQV  114 (454)
T ss_pred             CCccCCeEEEEEcCCCCCHHHHHHHH
Confidence            35667889999999999998765443


No 235
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=81.17  E-value=0.49  Score=34.22  Aligned_cols=23  Identities=13%  Similarity=-0.025  Sum_probs=18.7

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      ..|.++++.|+.|||||-|+..+
T Consensus        20 ~~~~~i~l~G~lGaGKTtl~~~l   42 (133)
T TIGR00150        20 DFGTVVLLKGDLGAGKTTLVQGL   42 (133)
T ss_pred             CCCCEEEEEcCCCCCHHHHHHHH
Confidence            35789999999999998776544


No 236
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=80.99  E-value=0.61  Score=37.59  Aligned_cols=18  Identities=11%  Similarity=-0.202  Sum_probs=14.6

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      ...+++.|+||||||-..
T Consensus       136 ~n~l~l~G~~G~GKThL~  153 (405)
T TIGR00362       136 YNPLFIYGGVGLGKTHLL  153 (405)
T ss_pred             CCeEEEECCCCCcHHHHH
Confidence            356899999999998554


No 237
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=80.96  E-value=0.6  Score=41.11  Aligned_cols=38  Identities=16%  Similarity=0.203  Sum_probs=23.3

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +-+|||++--+-  + +++     . + . +  ...-+|+.||||||||-.
T Consensus       182 ~~~igr~~ei~~--~-~~~-----L-~-~-~--~~~n~lL~G~pG~GKT~l  219 (731)
T TIGR02639       182 DPLIGREDELER--T-IQV-----L-C-R-R--KKNNPLLVGEPGVGKTAI  219 (731)
T ss_pred             CcccCcHHHHHH--H-HHH-----H-h-c-C--CCCceEEECCCCCCHHHH
Confidence            468888876663  2 232     1 1 1 1  234467899999999754


No 238
>PRK05748 replicative DNA helicase; Provisional
Probab=80.83  E-value=0.98  Score=37.22  Aligned_cols=26  Identities=15%  Similarity=0.078  Sum_probs=21.3

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+-.|..++++|+||+|||-|..-++
T Consensus       199 G~~~G~livIaarpg~GKT~~al~ia  224 (448)
T PRK05748        199 GLQPNDLIIVAARPSVGKTAFALNIA  224 (448)
T ss_pred             CCCCCceEEEEeCCCCCchHHHHHHH
Confidence            56678899999999999998765444


No 239
>KOG3078|consensus
Probab=80.72  E-value=0.65  Score=37.09  Aligned_cols=26  Identities=23%  Similarity=0.224  Sum_probs=22.3

Q ss_pred             cceEEecCCCCCCCCCCceeeeeeec
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMIIDSWV   96 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~~~~~   96 (101)
                      +..+++-|+||+||.|++.++.+.|-
T Consensus        15 ~~~~v~~G~pg~gkgt~a~~l~~~~~   40 (235)
T KOG3078|consen   15 GVRAVLLGAPGSGKGTQAPRLTKNFG   40 (235)
T ss_pred             ceEEEEEeCCCCCCCccCHHHHHhcC
Confidence            56677899999999999999888773


No 240
>PRK06547 hypothetical protein; Provisional
Probab=80.64  E-value=0.72  Score=33.82  Aligned_cols=21  Identities=14%  Similarity=0.109  Sum_probs=16.1

Q ss_pred             cceEEecCCCCCCCCCCceee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.++++.|++|||||-++..+
T Consensus        15 ~~~i~i~G~~GsGKTt~a~~l   35 (172)
T PRK06547         15 MITVLIDGRSGSGKTTLAGAL   35 (172)
T ss_pred             CEEEEEECCCCCCHHHHHHHH
Confidence            346778899999998766543


No 241
>KOG1807|consensus
Probab=80.57  E-value=0.2  Score=46.93  Aligned_cols=40  Identities=23%  Similarity=0.130  Sum_probs=32.6

Q ss_pred             cceeeeeccccccccceEEecCCCCCCCCCCceeeeeeecccC
Q psy2779          57 SFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMIIDSWVEGS   99 (101)
Q Consensus        57 ~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~~~~~~~~~~~   99 (101)
                      |-||..+   +++..+.-|+-|||||||+=-|+-|+|.-.+.+
T Consensus       382 Sq~~A~q---s~ltyelsliqgppGTgkt~vtlkav~tLL~n~  421 (1025)
T KOG1807|consen  382 SQQFAKQ---SKLTYELSLIQGPPGTGKTLVTLKAVDTLLLNS  421 (1025)
T ss_pred             HHHHHHH---HHhhhhhheeecCCCCCceeehHHHHHHHHhcc
Confidence            4566667   777899999999999999999999888655443


No 242
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=80.51  E-value=1.1  Score=33.02  Aligned_cols=17  Identities=18%  Similarity=0.073  Sum_probs=14.2

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .| ++++.||+||||+-.
T Consensus        22 ~g-~~~i~G~nGsGKStl   38 (197)
T cd03278          22 PG-LTAIVGPNGSGKSNI   38 (197)
T ss_pred             CC-cEEEECCCCCCHHHH
Confidence            35 889999999999754


No 243
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional
Probab=80.38  E-value=0.7  Score=40.54  Aligned_cols=39  Identities=18%  Similarity=0.163  Sum_probs=27.5

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.+.+.   +.++       ++++++  ..++|+.||+|+||+-
T Consensus        16 f~~viGq~~~~~~---L~~~-------i~~~~l--~hayLf~Gp~G~GKtt   54 (614)
T PRK14971         16 FESVVGQEALTTT---LKNA-------IATNKL--AHAYLFCGPRGVGKTT   54 (614)
T ss_pred             HHHhcCcHHHHHH---HHHH-------HHcCCC--CeeEEEECCCCCCHHH
Confidence            4568999999775   3333       333332  4678999999999864


No 244
>KOG0736|consensus
Probab=80.26  E-value=0.79  Score=43.05  Aligned_cols=13  Identities=15%  Similarity=0.020  Sum_probs=11.4

Q ss_pred             eEEecCCCCCCCC
Q psy2779          73 RAVAGGRTKCPKP   85 (101)
Q Consensus        73 ~ll~~G~p~~g~~   85 (101)
                      =+|+-||||||||
T Consensus       707 GILLYGPPGTGKT  719 (953)
T KOG0736|consen  707 GILLYGPPGTGKT  719 (953)
T ss_pred             eeEEECCCCCchH
Confidence            3679999999998


No 245
>KOG0737|consensus
Probab=80.23  E-value=0.62  Score=39.91  Aligned_cols=14  Identities=14%  Similarity=-0.007  Sum_probs=11.9

Q ss_pred             ceEEecCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKP   85 (101)
Q Consensus        72 ~~ll~~G~p~~g~~   85 (101)
                      +-+|+-||||||||
T Consensus       128 kGiLL~GPpG~GKT  141 (386)
T KOG0737|consen  128 KGILLYGPPGTGKT  141 (386)
T ss_pred             ccceecCCCCchHH
Confidence            45679999999987


No 246
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=80.20  E-value=0.79  Score=37.85  Aligned_cols=23  Identities=22%  Similarity=0.234  Sum_probs=18.5

Q ss_pred             ccccccceEEecCCCCCCCCCCc
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +.+..|.++|++|+||+||+=+.
T Consensus        77 GGi~~GslvLI~G~pG~GKStLl   99 (372)
T cd01121          77 GGLVPGSVILIGGDPGIGKSTLL   99 (372)
T ss_pred             CCccCCeEEEEEeCCCCCHHHHH
Confidence            34566889999999999998643


No 247
>PTZ00202 tuzin; Provisional
Probab=80.18  E-value=0.93  Score=40.43  Aligned_cols=42  Identities=19%  Similarity=0.124  Sum_probs=30.9

Q ss_pred             ccCcccchHHHHhhcceeee-cccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          35 MAAGLVGQQAAREVSRAVTW-EKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        35 ~a~GlVGQ~~AREAaGIVVd-m~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ...+|||.+..-.+..-+++ +           ..-..++++++|++|||||-.
T Consensus       260 ~~~~FVGReaEla~Lr~VL~~~-----------d~~~privvLtG~~G~GKTTL  302 (550)
T PTZ00202        260 VIRQFVSREAEESWVRQVLRRL-----------DTAHPRIVVFTGFRGCGKSSL  302 (550)
T ss_pred             CccCCCCcHHHHHHHHHHHhcc-----------CCCCceEEEEECCCCCCHHHH
Confidence            36799999988888776664 3           111235899999999999743


No 248
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
Probab=79.83  E-value=0.92  Score=36.83  Aligned_cols=26  Identities=27%  Similarity=0.295  Sum_probs=21.4

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+-.|..++++|+||+|||-|...+.
T Consensus       190 G~~~g~liviag~pg~GKT~~al~ia  215 (421)
T TIGR03600       190 GLVKGDLIVIGARPSMGKTTLALNIA  215 (421)
T ss_pred             CCCCCceEEEEeCCCCCHHHHHHHHH
Confidence            55668899999999999998876554


No 249
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=79.76  E-value=0.89  Score=32.86  Aligned_cols=17  Identities=18%  Similarity=0.114  Sum_probs=14.9

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      -.|.++.+.||+||||+
T Consensus        28 ~~G~~~~l~G~nGsGKS   44 (218)
T cd03255          28 EKGEFVAIVGPSGSGKS   44 (218)
T ss_pred             cCCCEEEEEcCCCCCHH
Confidence            35889999999999986


No 250
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.59  E-value=1.2  Score=32.17  Aligned_cols=22  Identities=18%  Similarity=0.037  Sum_probs=17.4

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ....|.++.+.||+||||+-+-
T Consensus        22 ~i~~G~~~~i~G~nGsGKSTLl   43 (210)
T cd03269          22 SVEKGEIFGLLGPNGAGKTTTI   43 (210)
T ss_pred             EEcCCcEEEEECCCCCCHHHHH
Confidence            3446899999999999986443


No 251
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=79.53  E-value=0.48  Score=35.70  Aligned_cols=45  Identities=13%  Similarity=0.055  Sum_probs=24.8

Q ss_pred             CcccccCccc-ch--HHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          31 EANEMAAGLV-GQ--QAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        31 ~a~~~a~GlV-GQ--~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ++.++.+-|| |.  +.|..|+.   .+       ++.... .-.-+++.|++|+|||=
T Consensus         2 n~~~tFdnfv~g~~N~~a~~~~~---~i-------a~~~~~-~~~~l~l~G~~G~GKTH   49 (219)
T PF00308_consen    2 NPKYTFDNFVVGESNELAYAAAK---AI-------AENPGE-RYNPLFLYGPSGLGKTH   49 (219)
T ss_dssp             -TT-SCCCS--TTTTHHHHHHHH---HH-------HHSTTT-SSSEEEEEESTTSSHHH
T ss_pred             CCCCccccCCcCCcHHHHHHHHH---HH-------HhcCCC-CCCceEEECCCCCCHHH
Confidence            4566677775 53  34444444   34       222221 23458999999999873


No 252
>KOG0743|consensus
Probab=79.50  E-value=0.72  Score=40.24  Aligned_cols=20  Identities=10%  Similarity=-0.183  Sum_probs=14.4

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ++=+|=-||-|||||||+-+
T Consensus       232 kawKRGYLLYGPPGTGKSS~  251 (457)
T KOG0743|consen  232 KAWKRGYLLYGPPGTGKSSF  251 (457)
T ss_pred             cchhccceeeCCCCCCHHHH
Confidence            33445567999999998643


No 253
>PRK07004 replicative DNA helicase; Provisional
Probab=79.48  E-value=1.2  Score=37.44  Aligned_cols=24  Identities=17%  Similarity=0.224  Sum_probs=20.0

Q ss_pred             cccccceEEecCCCCCCCCCCcee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      ..-.|..++++|+||+|||-|.-.
T Consensus       209 G~~~g~liviaarpg~GKT~~al~  232 (460)
T PRK07004        209 GMHGGELIIVAGRPSMGKTAFSMN  232 (460)
T ss_pred             CCCCCceEEEEeCCCCCccHHHHH
Confidence            556789999999999999987543


No 254
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=79.46  E-value=0.99  Score=32.52  Aligned_cols=21  Identities=10%  Similarity=-0.040  Sum_probs=16.1

Q ss_pred             cceEEecCCCCCCCCCCceee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      ...+++.|++||||+-...++
T Consensus         4 ~~~I~liG~~GaGKStl~~~L   24 (172)
T PRK05057          4 KRNIFLVGPMGAGKSTIGRQL   24 (172)
T ss_pred             CCEEEEECCCCcCHHHHHHHH
Confidence            456889999999998765443


No 255
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=79.44  E-value=0.93  Score=32.38  Aligned_cols=17  Identities=18%  Similarity=0.173  Sum_probs=14.9

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      .|.++.+.||+||||+-
T Consensus        23 ~Ge~~~i~G~nGsGKST   39 (206)
T TIGR03608        23 KGKMYAIIGESGSGKST   39 (206)
T ss_pred             CCcEEEEECCCCCCHHH
Confidence            58899999999999863


No 256
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=79.29  E-value=1  Score=38.36  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=14.2

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      .+.+|++|||||||+-
T Consensus       125 ~GLILVTGpTGSGKST  140 (353)
T COG2805         125 RGLILVTGPTGSGKST  140 (353)
T ss_pred             CceEEEeCCCCCcHHH
Confidence            5889999999999974


No 257
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=79.24  E-value=0.92  Score=32.24  Aligned_cols=20  Identities=20%  Similarity=0.102  Sum_probs=16.2

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .|.++++.|+|||||+-+..
T Consensus        17 ~~~~i~i~G~~GsGKstla~   36 (184)
T TIGR00455        17 RGVVIWLTGLSGSGKSTIAN   36 (184)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            37899999999999975443


No 258
>KOG0651|consensus
Probab=79.23  E-value=1.2  Score=38.22  Aligned_cols=42  Identities=14%  Similarity=0.014  Sum_probs=27.4

Q ss_pred             HHHHhhcceee-e-cccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          43 QAAREVSRAVT-W-EKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        43 ~~AREAaGIVV-d-m~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.|||=..+|+ - ++.|-|-|+   .+---..+||-||||+|||=.
T Consensus       139 ~qirelre~ielpl~np~lf~rv---gIk~Pkg~ll~GppGtGKTll  182 (388)
T KOG0651|consen  139 YQIRELREVIELPLTNPELFLRV---GIKPPKGLLLYGPPGTGKTLL  182 (388)
T ss_pred             HHHHHHHhheEeeccCchhcccc---CCCCCceeEEeCCCCCchhHH
Confidence            44555554432 2 245556666   444567899999999999843


No 259
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=79.06  E-value=1  Score=29.14  Aligned_cols=15  Identities=20%  Similarity=0.277  Sum_probs=13.2

Q ss_pred             cceEEecCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKP   85 (101)
Q Consensus        71 g~~ll~~G~p~~g~~   85 (101)
                      |.+.|+.|++|+||+
T Consensus        23 g~~tli~G~nGsGKS   37 (62)
T PF13555_consen   23 GDVTLITGPNGSGKS   37 (62)
T ss_pred             CcEEEEECCCCCCHH
Confidence            458999999999995


No 260
>PRK06921 hypothetical protein; Provisional
Probab=78.98  E-value=0.91  Score=35.45  Aligned_cols=17  Identities=12%  Similarity=-0.044  Sum_probs=14.2

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      +.-+++.|+||+|||=.
T Consensus       117 ~~~l~l~G~~G~GKThL  133 (266)
T PRK06921        117 KNSIALLGQPGSGKTHL  133 (266)
T ss_pred             CCeEEEECCCCCcHHHH
Confidence            56788999999999843


No 261
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=78.78  E-value=1.3  Score=41.03  Aligned_cols=20  Identities=15%  Similarity=0.109  Sum_probs=17.2

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      +...|-+|.+.||||.|||-
T Consensus       346 ~~~kGpILcLVGPPGVGKTS  365 (782)
T COG0466         346 KKLKGPILCLVGPPGVGKTS  365 (782)
T ss_pred             ccCCCcEEEEECCCCCCchh
Confidence            44578999999999999985


No 262
>KOG0060|consensus
Probab=78.73  E-value=0.63  Score=42.23  Aligned_cols=30  Identities=17%  Similarity=0.314  Sum_probs=23.8

Q ss_pred             cccccceEEecCCCCCCCCCCceeeeeeec
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMIIDSWV   96 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~~~~~   96 (101)
                      ....|.-||++||+|||||-.--+.-+-|-
T Consensus       457 ~V~~g~~LLItG~sG~GKtSLlRvlggLWp  486 (659)
T KOG0060|consen  457 EVPSGQNLLITGPSGCGKTSLLRVLGGLWP  486 (659)
T ss_pred             EecCCCeEEEECCCCCchhHHHHHHhcccc
Confidence            345689999999999999976666666664


No 263
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=78.64  E-value=1.1  Score=31.50  Aligned_cols=23  Identities=13%  Similarity=0.013  Sum_probs=18.7

Q ss_pred             ccceEEecCCCCCCCCCCceeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .|..+++.||+||||+-...++.
T Consensus        14 ~ge~v~I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          14 GKVGVLITGDSGIGKTELALELI   36 (107)
T ss_pred             CCEEEEEEcCCCCCHHHHHHHhh
Confidence            47889999999999997666643


No 264
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=78.61  E-value=1.1  Score=33.73  Aligned_cols=22  Identities=23%  Similarity=0.194  Sum_probs=17.3

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ....|.++.+.|++||||+-.-
T Consensus        43 ~i~~Ge~~~i~G~nGsGKSTLl   64 (257)
T cd03288          43 YIKPGQKVGICGRTGSGKSSLS   64 (257)
T ss_pred             EEcCCCEEEEECCCCCCHHHHH
Confidence            3446889999999999986443


No 265
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=78.50  E-value=1  Score=32.56  Aligned_cols=20  Identities=15%  Similarity=0.056  Sum_probs=16.4

Q ss_pred             cccceEEecCCCCCCCCCCc
Q psy2779          69 FRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~   88 (101)
                      -.|.++.+.||+||||+-+-
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl   48 (228)
T cd03257          29 KKGETLGLVGESGSGKSTLA   48 (228)
T ss_pred             cCCCEEEEECCCCCCHHHHH
Confidence            35889999999999987443


No 266
>PRK08116 hypothetical protein; Validated
Probab=78.49  E-value=0.84  Score=35.61  Aligned_cols=18  Identities=11%  Similarity=-0.136  Sum_probs=14.5

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      +.-+++.|+||||||-..
T Consensus       114 ~~gl~l~G~~GtGKThLa  131 (268)
T PRK08116        114 NVGLLLWGSVGTGKTYLA  131 (268)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            456889999999998543


No 267
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional
Probab=78.46  E-value=1.1  Score=36.41  Aligned_cols=17  Identities=18%  Similarity=-0.052  Sum_probs=14.3

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      ..++++.|||+||||..
T Consensus         4 ~~ii~I~GpTasGKS~L   20 (300)
T PRK14729          4 NKIVFIFGPTAVGKSNI   20 (300)
T ss_pred             CcEEEEECCCccCHHHH
Confidence            45899999999999853


No 268
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=78.42  E-value=1  Score=33.03  Aligned_cols=20  Identities=15%  Similarity=0.036  Sum_probs=16.3

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.||+||||+-+
T Consensus        25 i~~Ge~~~l~G~nGsGKSTL   44 (243)
T TIGR02315        25 INPGEFVAIIGPSGAGKSTL   44 (243)
T ss_pred             EcCCCEEEEECCCCCCHHHH
Confidence            34688999999999998643


No 269
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=78.25  E-value=1.1  Score=32.23  Aligned_cols=17  Identities=24%  Similarity=0.257  Sum_probs=15.0

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      .|.++.+.||+||||+-
T Consensus        25 ~G~~~~l~G~nGsGKST   41 (213)
T cd03262          25 KGEVVVIIGPSGSGKST   41 (213)
T ss_pred             CCCEEEEECCCCCCHHH
Confidence            58899999999999863


No 270
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=78.17  E-value=1.1  Score=32.32  Aligned_cols=19  Identities=21%  Similarity=0.350  Sum_probs=15.8

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|.++.+.||+||||+-
T Consensus        23 i~~Ge~~~i~G~nGsGKST   41 (205)
T cd03226          23 LYAGEIIALTGKNGAGKTT   41 (205)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3468899999999999863


No 271
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=78.11  E-value=1.1  Score=31.93  Aligned_cols=20  Identities=20%  Similarity=0.031  Sum_probs=16.3

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.||+||||+-.
T Consensus        15 i~~Ge~~~i~G~nGsGKSTL   34 (190)
T TIGR01166        15 AERGEVLALLGANGAGKSTL   34 (190)
T ss_pred             EcCCCEEEEECCCCCCHHHH
Confidence            34688999999999998643


No 272
>PRK07952 DNA replication protein DnaC; Validated
Probab=78.00  E-value=0.89  Score=35.53  Aligned_cols=17  Identities=12%  Similarity=0.085  Sum_probs=13.6

Q ss_pred             ceEEecCCCCCCCCCCc
Q psy2779          72 GRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~   88 (101)
                      .-+++.|+||||||=..
T Consensus       100 ~~~~l~G~~GtGKThLa  116 (244)
T PRK07952        100 ASFIFSGKPGTGKNHLA  116 (244)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            36889999999998543


No 273
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=77.93  E-value=1.2  Score=32.52  Aligned_cols=19  Identities=21%  Similarity=0.134  Sum_probs=15.9

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      +-.|.++.+.||+||||+-
T Consensus        28 i~~Ge~~~l~G~nGsGKST   46 (233)
T cd03258          28 VPKGEIFGIIGRSGAGKST   46 (233)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3468899999999999863


No 274
>PF03796 DnaB_C:  DnaB-like helicase C terminal domain;  InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis. ; GO: 0003678 DNA helicase activity, 0005524 ATP binding, 0006260 DNA replication; PDB: 1Q57_E 1E0K_D 1E0J_B 1CR2_A 1CR4_A 1CR1_A 1CR0_A 1MI8_A 2R6D_B 2R6C_C ....
Probab=77.77  E-value=0.86  Score=34.27  Aligned_cols=24  Identities=21%  Similarity=0.116  Sum_probs=18.1

Q ss_pred             cccccceEEecCCCCCCCCCCcee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .+..|...+++|+||.|||-|..-
T Consensus        15 G~~~g~L~vi~a~pg~GKT~~~l~   38 (259)
T PF03796_consen   15 GLRPGELTVIAARPGVGKTAFALQ   38 (259)
T ss_dssp             SB-TT-EEEEEESTTSSHHHHHHH
T ss_pred             CCCcCcEEEEEecccCCchHHHHH
Confidence            455688999999999999977543


No 275
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=77.77  E-value=1.1  Score=32.14  Aligned_cols=18  Identities=17%  Similarity=0.069  Sum_probs=15.3

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|..+.+.||+||||+-
T Consensus        25 ~~G~~~~i~G~nGsGKST   42 (214)
T cd03292          25 SAGEFVFLVGPSGAGKST   42 (214)
T ss_pred             cCCCEEEEECCCCCCHHH
Confidence            358899999999999863


No 276
>PRK06851 hypothetical protein; Provisional
Probab=77.65  E-value=0.31  Score=40.71  Aligned_cols=27  Identities=11%  Similarity=0.052  Sum_probs=22.3

Q ss_pred             ccceEEecCCCCCCCCCCceeeeeeec
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIIDSWV   96 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~~~~   96 (101)
                      ..++++|.|+|||||+.....+++.|.
T Consensus        29 ~~~~~il~G~pGtGKStl~~~i~~~~~   55 (367)
T PRK06851         29 ANRIFILKGGPGTGKSTLMKKIGEEFL   55 (367)
T ss_pred             cceEEEEECCCCCCHHHHHHHHHHHHH
Confidence            367899999999999988877776664


No 277
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=77.56  E-value=1.1  Score=32.17  Aligned_cols=21  Identities=14%  Similarity=-0.029  Sum_probs=16.8

Q ss_pred             cccceEEecCCCCCCCCCCce
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      -.|..+.+.||+||||+-+-.
T Consensus        24 ~~G~~~~i~G~nGsGKSTLl~   44 (208)
T cd03268          24 KKGEIYGFLGPNGAGKTTTMK   44 (208)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            358899999999999874433


No 278
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit. This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.
Probab=77.39  E-value=1  Score=39.45  Aligned_cols=24  Identities=8%  Similarity=0.123  Sum_probs=17.8

Q ss_pred             ccceEEecCCCCCCCCCCceeeee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMIID   93 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~~~   93 (101)
                      ..+..++.|+||||||-...-++.
T Consensus       159 ~~~~~vitGgpGTGKTt~v~~ll~  182 (586)
T TIGR01447       159 KSNFSLITGGPGTGKTTTVARLLL  182 (586)
T ss_pred             hCCeEEEEcCCCCCHHHHHHHHHH
Confidence            357899999999999865444433


No 279
>PRK06696 uridine kinase; Validated
Probab=77.24  E-value=1.1  Score=33.19  Aligned_cols=22  Identities=18%  Similarity=0.069  Sum_probs=17.0

Q ss_pred             cceEEecCCCCCCCCCCceeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      --++.++|++|||||-++..+.
T Consensus        22 ~~iI~I~G~sgsGKSTlA~~L~   43 (223)
T PRK06696         22 PLRVAIDGITASGKTTFADELA   43 (223)
T ss_pred             ceEEEEECCCCCCHHHHHHHHH
Confidence            4578899999999987654443


No 280
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=77.23  E-value=1.3  Score=31.93  Aligned_cols=23  Identities=17%  Similarity=0.070  Sum_probs=18.1

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|.++.+.||+||||+-+-.+
T Consensus        28 i~~G~~~~i~G~nG~GKSTLl~~   50 (204)
T cd03250          28 VPKGELVAIVGPVGSGKSSLLSA   50 (204)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHH
Confidence            34689999999999998755444


No 281
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=77.19  E-value=1.2  Score=32.60  Aligned_cols=22  Identities=14%  Similarity=0.004  Sum_probs=17.2

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ...|.++.+.||+||||+-.-.
T Consensus        24 i~~Ge~~~i~G~nGsGKSTLl~   45 (241)
T cd03256          24 INPGEFVALIGPSGAGKSTLLR   45 (241)
T ss_pred             EcCCCEEEEECCCCCCHHHHHH
Confidence            3358899999999999874433


No 282
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=77.17  E-value=1.2  Score=36.04  Aligned_cols=18  Identities=22%  Similarity=0.027  Sum_probs=15.0

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      ..++++.|||||||+...
T Consensus         4 ~~~i~i~GptgsGKt~la   21 (307)
T PRK00091          4 PKVIVIVGPTASGKTALA   21 (307)
T ss_pred             ceEEEEECCCCcCHHHHH
Confidence            468999999999998643


No 283
>PRK07399 DNA polymerase III subunit delta'; Validated
Probab=77.04  E-value=0.75  Score=36.88  Aligned_cols=39  Identities=23%  Similarity=0.245  Sum_probs=27.0

Q ss_pred             CcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          37 AGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        37 ~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.++||+.+.+..-=.+          +++++  --++|+.||+|+||.+.
T Consensus         4 ~~iiGq~~~~~~L~~~i----------~~~rl--~ha~Lf~G~~G~Gk~~~   42 (314)
T PRK07399          4 ANLIGQPLAIELLTAAI----------KQNRI--APAYLFAGPEGVGRKLA   42 (314)
T ss_pred             HHhCCHHHHHHHHHHHH----------HhCCC--CceEEEECCCCCCHHHH
Confidence            56899999987543222          22222  35889999999998764


No 284
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=76.94  E-value=1.6  Score=33.31  Aligned_cols=25  Identities=12%  Similarity=-0.080  Sum_probs=19.3

Q ss_pred             eccccccccceEEecCCCCCCCCCC
Q psy2779          63 CKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        63 ~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +++..+-.|.++.+.||+||||+-+
T Consensus        17 ~~~~~i~~Ge~~~i~G~NGsGKSTL   41 (246)
T cd03237          17 VEGGSISESEVIGILGPNGIGKTTF   41 (246)
T ss_pred             EecCCcCCCCEEEEECCCCCCHHHH
Confidence            3444556789999999999999743


No 285
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=76.82  E-value=1.3  Score=31.47  Aligned_cols=24  Identities=21%  Similarity=0.241  Sum_probs=18.3

Q ss_pred             cccccceEEecCCCCCCCCCCcee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      ....|..+.+.|++||||+-+-.+
T Consensus        24 ~i~~Ge~~~i~G~nGsGKStLl~~   47 (178)
T cd03247          24 ELKQGEKIALLGRSGSGKSTLLQL   47 (178)
T ss_pred             EEcCCCEEEEECCCCCCHHHHHHH
Confidence            344688999999999998754443


No 286
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=76.80  E-value=1.4  Score=36.13  Aligned_cols=20  Identities=25%  Similarity=0.401  Sum_probs=17.6

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+++|-.+++-||.|||||-
T Consensus        27 ~ia~ge~vv~lGpSGcGKTT   46 (259)
T COG4525          27 TIASGELVVVLGPSGCGKTT   46 (259)
T ss_pred             eecCCCEEEEEcCCCccHHH
Confidence            56789999999999999974


No 287
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=76.80  E-value=1.2  Score=32.43  Aligned_cols=17  Identities=24%  Similarity=0.266  Sum_probs=15.0

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      .|.++.+.||+||||+-
T Consensus        35 ~Ge~~~i~G~nGsGKST   51 (228)
T PRK10584         35 RGETIALIGESGSGKST   51 (228)
T ss_pred             CCCEEEEECCCCCCHHH
Confidence            58999999999999863


No 288
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=76.74  E-value=1.2  Score=32.01  Aligned_cols=17  Identities=18%  Similarity=0.139  Sum_probs=14.9

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      -.|.++.+.||+||||+
T Consensus        26 ~~G~~~~l~G~nGsGKS   42 (214)
T TIGR02673        26 RKGEFLFLTGPSGAGKT   42 (214)
T ss_pred             cCCCEEEEECCCCCCHH
Confidence            36889999999999986


No 289
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=76.70  E-value=1.5  Score=30.95  Aligned_cols=20  Identities=15%  Similarity=0.219  Sum_probs=16.4

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-.|.++.+.||+||||+-
T Consensus        24 ~i~~G~~~~l~G~nGsGKst   43 (171)
T cd03228          24 TIKPGEKVAIVGPSGSGKST   43 (171)
T ss_pred             EEcCCCEEEEECCCCCCHHH
Confidence            34468999999999999853


No 290
>KOG0652|consensus
Probab=76.70  E-value=1.6  Score=37.34  Aligned_cols=63  Identities=21%  Similarity=0.119  Sum_probs=36.1

Q ss_pred             ccccccccCCCCCCccccc-CcccchHH-HHhhcceeeecccc-eeeeeccccccccceEEecCCCCCCCC
Q psy2779          18 HSHVKGLGLKENGEANEMA-AGLVGQQA-AREVSRAVTWEKSF-QFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        18 HSHIkGLGLde~g~a~~~a-~GlVGQ~~-AREAaGIVVdm~~~-~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      -|.+|+.-+|+.-+-.|+. .|+=-|.+ --||  ||+-|+.- .|+..   .+-.-+-+|+.||||||||
T Consensus       154 DsrVkaMevDekPtE~YsDiGGldkQIqELvEA--iVLpmth~ekF~~l---gi~pPKGvLmYGPPGTGKT  219 (424)
T KOG0652|consen  154 DSRVKAMEVDEKPTEQYSDIGGLDKQIQELVEA--IVLPMTHKEKFENL---GIRPPKGVLMYGPPGTGKT  219 (424)
T ss_pred             hhhcceeeeccCCcccccccccHHHHHHHHHHH--hccccccHHHHHhc---CCCCCCceEeeCCCCCcHH
Confidence            4667788887765544433 34544433 2344  66777321 12222   3334455779999999997


No 291
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=76.70  E-value=0.9  Score=38.23  Aligned_cols=51  Identities=12%  Similarity=-0.085  Sum_probs=28.1

Q ss_pred             CCCcccccCccc-chHHHHhhcceeeecccceeeeecccccccc---ceEEecCCCCCCCCCC
Q psy2779          29 NGEANEMAAGLV-GQQAAREVSRAVTWEKSFQFERCKSHSLFRG---GRAVAGGRTKCPKPPN   87 (101)
Q Consensus        29 ~g~a~~~a~GlV-GQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g---~~ll~~G~p~~g~~~~   87 (101)
                      +.++.+..+-|| |. .-+.|...+.++       .+......|   .-+++.||||+|||=.
T Consensus       103 ~l~~~~tFdnFv~g~-~N~~a~~~a~~~-------a~~~~~~~~~~~npl~L~G~~G~GKTHL  157 (445)
T PRK12422        103 ELDPLMTFANFLVTP-ENDLPHRILQEF-------TKVSEQGKGFPFNPIYLFGPEGSGKTHL  157 (445)
T ss_pred             CCCccccccceeeCC-cHHHHHHHHHHH-------HhccccccCCCCceEEEEcCCCCCHHHH
Confidence            345666677776 53 333444444444       211111112   3578999999999844


No 292
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=76.67  E-value=1.2  Score=31.95  Aligned_cols=18  Identities=17%  Similarity=0.134  Sum_probs=15.3

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|.++.+.||+|||||-
T Consensus        25 ~~G~~~~l~G~nGsGKST   42 (211)
T cd03225          25 KKGEFVLIVGPNGSGKST   42 (211)
T ss_pred             cCCcEEEEECCCCCCHHH
Confidence            358899999999999863


No 293
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=76.67  E-value=1.3  Score=37.18  Aligned_cols=18  Identities=28%  Similarity=0.331  Sum_probs=15.1

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|+++++.||+|+|||-.
T Consensus       220 ~~~~i~~vGptGvGKTTt  237 (424)
T PRK05703        220 QGGVVALVGPTGVGKTTT  237 (424)
T ss_pred             CCcEEEEECCCCCCHHHH
Confidence            367899999999999853


No 294
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=76.65  E-value=1.3  Score=32.44  Aligned_cols=18  Identities=22%  Similarity=0.246  Sum_probs=15.4

Q ss_pred             ccccceEEecCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~   85 (101)
                      .-.|.++.+.|++||||+
T Consensus        23 i~~Ge~~~l~G~nGsGKS   40 (230)
T TIGR03410        23 VPKGEVTCVLGRNGVGKT   40 (230)
T ss_pred             ECCCCEEEEECCCCCCHH
Confidence            336889999999999986


No 295
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=76.64  E-value=1.3  Score=32.12  Aligned_cols=19  Identities=16%  Similarity=0.235  Sum_probs=15.8

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|.++.+.||+||||+-
T Consensus        26 i~~Ge~~~i~G~nGsGKST   44 (216)
T TIGR00960        26 ITKGEMVFLVGHSGAGKST   44 (216)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3468899999999999863


No 296
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=76.39  E-value=1.3  Score=30.86  Aligned_cols=22  Identities=23%  Similarity=0.185  Sum_probs=17.4

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ..-.|.++.+.|++||||+-+-
T Consensus        22 ~~~~Ge~~~i~G~nGsGKStLl   43 (144)
T cd03221          22 TINPGDRIGLVGRNGAGKSTLL   43 (144)
T ss_pred             EECCCCEEEEECCCCCCHHHHH
Confidence            3446899999999999987443


No 297
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=76.32  E-value=1.3  Score=32.25  Aligned_cols=17  Identities=24%  Similarity=0.284  Sum_probs=14.9

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      -.|.++.+.||+|||||
T Consensus        28 ~~G~~~~i~G~nGsGKS   44 (220)
T cd03293          28 EEGEFVALVGPSGCGKS   44 (220)
T ss_pred             eCCcEEEEECCCCCCHH
Confidence            35889999999999985


No 298
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=76.26  E-value=1.3  Score=32.62  Aligned_cols=19  Identities=21%  Similarity=0.265  Sum_probs=15.9

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|..+.+.||+|||||-+
T Consensus        31 ~~Ge~~~i~G~nGsGKSTL   49 (225)
T PRK10247         31 RAGEFKLITGPSGCGKSTL   49 (225)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 299
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=76.20  E-value=1.3  Score=32.06  Aligned_cols=19  Identities=16%  Similarity=0.055  Sum_probs=15.7

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        29 ~~G~~~~i~G~nGsGKSTL   47 (221)
T TIGR02211        29 GKGEIVAIVGSSGSGKSTL   47 (221)
T ss_pred             cCCcEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 300
>PRK13764 ATPase; Provisional
Probab=76.13  E-value=1.2  Score=39.52  Aligned_cols=23  Identities=9%  Similarity=0.128  Sum_probs=17.0

Q ss_pred             cceEEecCCCCCCCCCCceeeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMIID   93 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~~   93 (101)
                      ++-+|++|+||||||-+...+++
T Consensus       257 ~~~ILIsG~TGSGKTTll~AL~~  279 (602)
T PRK13764        257 AEGILIAGAPGAGKSTFAQALAE  279 (602)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH
Confidence            45588999999999866544443


No 301
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=76.00  E-value=1.3  Score=32.03  Aligned_cols=19  Identities=21%  Similarity=0.167  Sum_probs=15.8

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|.++.+.||+||||+-
T Consensus        23 i~~Ge~~~i~G~nGsGKST   41 (222)
T cd03224          23 VPEGEIVALLGRNGAGKTT   41 (222)
T ss_pred             EcCCeEEEEECCCCCCHHH
Confidence            3468899999999999863


No 302
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]
Probab=75.98  E-value=1.5  Score=39.26  Aligned_cols=18  Identities=22%  Similarity=0.285  Sum_probs=15.9

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|-.||+.||+|||||-.
T Consensus       418 ~G~~llI~G~SG~GKTsL  435 (604)
T COG4178         418 PGERLLITGESGAGKTSL  435 (604)
T ss_pred             CCCEEEEECCCCCCHHHH
Confidence            688999999999999843


No 303
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=75.94  E-value=0.86  Score=33.41  Aligned_cols=14  Identities=14%  Similarity=0.183  Sum_probs=9.4

Q ss_pred             ceEEecCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKP   85 (101)
Q Consensus        72 ~~ll~~G~p~~g~~   85 (101)
                      +.+++-|.||||||
T Consensus        14 ~~~lV~a~AGSGKT   27 (315)
T PF00580_consen   14 GPLLVNAGAGSGKT   27 (315)
T ss_dssp             SEEEEEE-TTSSHH
T ss_pred             CCEEEEeCCCCCch
Confidence            44555566999997


No 304
>PTZ00088 adenylate kinase 1; Provisional
Probab=75.93  E-value=1.4  Score=33.85  Aligned_cols=17  Identities=18%  Similarity=0.032  Sum_probs=13.4

Q ss_pred             EEecCCCCCCCCCCcee
Q psy2779          74 AVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        74 ll~~G~p~~g~~~~~~~   90 (101)
                      +++.|||||||+-...+
T Consensus         9 Ivl~G~PGsGK~T~a~~   25 (229)
T PTZ00088          9 IVLFGAPGVGKGTFAEI   25 (229)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78899999999755444


No 305
>PRK08939 primosomal protein DnaI; Reviewed
Probab=75.92  E-value=1.2  Score=35.60  Aligned_cols=16  Identities=13%  Similarity=-0.226  Sum_probs=13.4

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      ++-|++.|+||||||=
T Consensus       156 ~~gl~L~G~~G~GKTh  171 (306)
T PRK08939        156 VKGLYLYGDFGVGKSY  171 (306)
T ss_pred             CCeEEEECCCCCCHHH
Confidence            4568899999999974


No 306
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=75.91  E-value=1.7  Score=30.95  Aligned_cols=23  Identities=13%  Similarity=-0.052  Sum_probs=17.7

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|.++.+.|++||||+-+-.+
T Consensus        22 i~~G~~~~l~G~nGsGKStLl~~   44 (180)
T cd03214          22 IEAGEIVGILGPNGAGKSTLLKT   44 (180)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHH
Confidence            33588999999999998754433


No 307
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=75.85  E-value=0.96  Score=31.49  Aligned_cols=17  Identities=12%  Similarity=-0.009  Sum_probs=14.5

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      ...+++.||+|+|||-.
T Consensus        20 ~~~~~l~G~rg~GKTsL   36 (234)
T PF01637_consen   20 SQHILLYGPRGSGKTSL   36 (234)
T ss_dssp             SSEEEEEESTTSSHHHH
T ss_pred             CcEEEEEcCCcCCHHHH
Confidence            57889999999999743


No 308
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=75.83  E-value=1.4  Score=29.83  Aligned_cols=21  Identities=14%  Similarity=0.056  Sum_probs=15.9

Q ss_pred             cceEEecCCCCCCCCCCceee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      ...+++.|++||||+-+-.++
T Consensus        14 ~~~v~i~G~~g~GKStLl~~l   34 (173)
T cd04155          14 EPRILILGLDNAGKTTILKQL   34 (173)
T ss_pred             ccEEEEEccCCCCHHHHHHHH
Confidence            455889999999998655444


No 309
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=75.67  E-value=1.8  Score=30.62  Aligned_cols=20  Identities=20%  Similarity=0.130  Sum_probs=16.2

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ....|..+.+.||+||||+-
T Consensus        24 ~i~~Ge~~~i~G~nGsGKSt   43 (173)
T cd03246          24 SIEPGESLAIIGPSGSGKST   43 (173)
T ss_pred             EECCCCEEEEECCCCCCHHH
Confidence            33468899999999999863


No 310
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=75.67  E-value=1.4  Score=36.43  Aligned_cols=13  Identities=23%  Similarity=0.158  Sum_probs=11.5

Q ss_pred             EEecCCCCCCCCC
Q psy2779          74 AVAGGRTKCPKPP   86 (101)
Q Consensus        74 ll~~G~p~~g~~~   86 (101)
                      +++.|+||||||-
T Consensus        45 ~~iyG~~GTGKT~   57 (366)
T COG1474          45 IIIYGPTGTGKTA   57 (366)
T ss_pred             EEEECCCCCCHhH
Confidence            7788999999974


No 311
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=75.65  E-value=1.4  Score=32.73  Aligned_cols=23  Identities=9%  Similarity=-0.067  Sum_probs=17.6

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.|.++.+.||+||||+-+-.++
T Consensus        27 ~~Ge~~~i~G~nGsGKSTLl~~i   49 (250)
T PRK14247         27 PDNTITALMGPSGSGKSTLLRVF   49 (250)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHH
Confidence            35889999999999987544433


No 312
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=75.62  E-value=1.4  Score=31.74  Aligned_cols=18  Identities=28%  Similarity=0.322  Sum_probs=15.3

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|..+.+.||+||||+-
T Consensus        24 ~~Ge~~~l~G~nGsGKST   41 (213)
T cd03301          24 ADGEFVVLLGPSGCGKTT   41 (213)
T ss_pred             cCCcEEEEECCCCCCHHH
Confidence            358899999999999863


No 313
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=75.57  E-value=1.4  Score=31.68  Aligned_cols=19  Identities=16%  Similarity=0.181  Sum_probs=15.7

Q ss_pred             ccceEEecCCCCCCCCCCc
Q psy2779          70 RGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~   88 (101)
                      .|.++.+.|++||||+-.-
T Consensus        25 ~Ge~~~l~G~nGsGKSTLl   43 (195)
T PRK13541         25 PSAITYIKGANGCGKSSLL   43 (195)
T ss_pred             CCcEEEEECCCCCCHHHHH
Confidence            5889999999999986433


No 314
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=75.54  E-value=1.5  Score=32.11  Aligned_cols=22  Identities=14%  Similarity=0.049  Sum_probs=17.3

Q ss_pred             cccceEEecCCCCCCCCCCcee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      -.|-++.+.||+||||+-+-.+
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~~   45 (243)
T TIGR01978        24 KKGEIHAIMGPNGSGKSTLSKT   45 (243)
T ss_pred             cCCCEEEEECCCCCCHHHHHHH
Confidence            3588999999999998754443


No 315
>KOG1803|consensus
Probab=75.50  E-value=1.5  Score=39.85  Aligned_cols=15  Identities=13%  Similarity=0.060  Sum_probs=12.6

Q ss_pred             ceEEecCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPP   86 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~   86 (101)
                      -.+++-||||||||-
T Consensus       202 ~l~~I~GPPGTGKT~  216 (649)
T KOG1803|consen  202 DLLIIHGPPGTGKTR  216 (649)
T ss_pred             CceEeeCCCCCCcee
Confidence            457799999999984


No 316
>PRK05595 replicative DNA helicase; Provisional
Probab=75.48  E-value=1.6  Score=36.03  Aligned_cols=26  Identities=15%  Similarity=0.142  Sum_probs=21.1

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+-.|-.++++|+||.|||-|...+.
T Consensus       197 G~~~g~liviaarpg~GKT~~al~ia  222 (444)
T PRK05595        197 GFQKGDMILIAARPSMGKTTFALNIA  222 (444)
T ss_pred             CCCCCcEEEEEecCCCChHHHHHHHH
Confidence            45568899999999999998865544


No 317
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=75.39  E-value=1.5  Score=32.33  Aligned_cols=19  Identities=21%  Similarity=0.132  Sum_probs=15.8

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|.++.+.||+||||+-
T Consensus        25 i~~Ge~~~i~G~nGsGKST   43 (242)
T PRK11124         25 CPQGETLVLLGPSGAGKSS   43 (242)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3368899999999999863


No 318
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=75.37  E-value=1.5  Score=31.62  Aligned_cols=22  Identities=14%  Similarity=0.134  Sum_probs=17.4

Q ss_pred             ccceEEecCCCCCCCCCCceee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      .|.++.+.||+||||+-+-.++
T Consensus        32 ~Ge~~~l~G~nGsGKSTLl~~l   53 (192)
T cd03232          32 PGTLTALMGESGAGKTTLLDVL   53 (192)
T ss_pred             CCcEEEEECCCCCCHHHHHHHH
Confidence            5889999999999987554433


No 319
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=75.33  E-value=1.4  Score=32.02  Aligned_cols=22  Identities=23%  Similarity=0.128  Sum_probs=17.2

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ..-.|.++.+.||+||||+-+-
T Consensus        25 ~i~~G~~~~i~G~nGsGKSTLl   46 (229)
T cd03254          25 SIKPGETVAIVGPTGAGKTTLI   46 (229)
T ss_pred             EEcCCCEEEEECCCCCCHHHHH
Confidence            3446889999999999986443


No 320
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=75.32  E-value=1.4  Score=32.09  Aligned_cols=21  Identities=19%  Similarity=0.200  Sum_probs=16.7

Q ss_pred             cccceEEecCCCCCCCCCCce
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      -.|.++.+.|++||||+-+-.
T Consensus        24 ~~Ge~~~i~G~nGsGKSTLl~   44 (227)
T cd03260          24 PKGEITALIGPSGCGKSTLLR   44 (227)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            358899999999999864433


No 321
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=75.24  E-value=1.6  Score=31.48  Aligned_cols=22  Identities=14%  Similarity=-0.019  Sum_probs=17.2

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ....|.++.+.||+||||+-+-
T Consensus        21 ~i~~Ge~~~l~G~nGsGKSTLl   42 (213)
T cd03235          21 EVKPGEFLAIVGPNGAGKSTLL   42 (213)
T ss_pred             EEcCCCEEEEECCCCCCHHHHH
Confidence            3346889999999999987443


No 322
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=75.20  E-value=1.4  Score=34.44  Aligned_cols=21  Identities=14%  Similarity=0.037  Sum_probs=17.0

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .+.++.+.|+||||||-+...
T Consensus        33 ~~~~i~i~G~~G~GKttl~~~   53 (300)
T TIGR00750        33 NAHRVGITGTPGAGKSTLLEA   53 (300)
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            477888999999999876554


No 323
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=75.16  E-value=1.5  Score=31.96  Aligned_cols=23  Identities=22%  Similarity=0.150  Sum_probs=17.6

Q ss_pred             cccccceEEecCCCCCCCCCCce
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..-.|.++.+.|++||||+-+-.
T Consensus        24 ~i~~Ge~~~i~G~nGsGKSTLl~   46 (207)
T PRK13539         24 TLAAGEALVLTGPNGSGKTTLLR   46 (207)
T ss_pred             EEcCCCEEEEECCCCCCHHHHHH
Confidence            33468999999999999864433


No 324
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=75.00  E-value=1.5  Score=31.73  Aligned_cols=20  Identities=15%  Similarity=0.019  Sum_probs=16.1

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|..+.+.|++||||+-+
T Consensus        28 i~~Ge~~~i~G~nGsGKSTL   47 (218)
T cd03266          28 VKPGEVTGLLGPNGAGKTTT   47 (218)
T ss_pred             EcCCcEEEEECCCCCCHHHH
Confidence            33588999999999998643


No 325
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=74.94  E-value=1.6  Score=32.30  Aligned_cols=18  Identities=6%  Similarity=-0.273  Sum_probs=15.2

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|.++.+.||+||||+-.
T Consensus        12 ~Ge~~~l~G~NGsGKSTL   29 (213)
T PRK15177         12 YHEHIGILAAPGSGKTTL   29 (213)
T ss_pred             CCCEEEEECCCCCCHHHH
Confidence            588999999999998643


No 326
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=74.94  E-value=1.8  Score=31.37  Aligned_cols=21  Identities=19%  Similarity=0.126  Sum_probs=16.9

Q ss_pred             cccceEEecCCCCCCCCCCce
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      -.|.++.+.||+||||+-+-.
T Consensus        28 ~~G~~~~i~G~nGsGKSTLl~   48 (220)
T cd03245          28 RAGEKVAIIGRVGSGKSTLLK   48 (220)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            468999999999999864433


No 327
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=74.89  E-value=1.8  Score=31.88  Aligned_cols=19  Identities=16%  Similarity=0.048  Sum_probs=15.9

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|.++.+.||+||||+-
T Consensus        24 i~~Ge~~~i~G~nGsGKST   42 (236)
T TIGR03864        24 VRPGEFVALLGPNGAGKST   42 (236)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3468999999999999863


No 328
>PRK10536 hypothetical protein; Provisional
Probab=74.83  E-value=1.3  Score=35.72  Aligned_cols=16  Identities=25%  Similarity=0.231  Sum_probs=13.6

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      ...+++.||+|||||=
T Consensus        74 ~~lV~i~G~aGTGKT~   89 (262)
T PRK10536         74 KQLIFATGEAGCGKTW   89 (262)
T ss_pred             CCeEEEECCCCCCHHH
Confidence            3488999999999983


No 329
>PRK13948 shikimate kinase; Provisional
Probab=74.74  E-value=1.7  Score=32.37  Aligned_cols=18  Identities=11%  Similarity=-0.143  Sum_probs=14.7

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      ..+.+++.|.+||||+-.
T Consensus         9 ~~~~I~LiG~~GsGKSTv   26 (182)
T PRK13948          9 PVTWVALAGFMGTGKSRI   26 (182)
T ss_pred             CCCEEEEECCCCCCHHHH
Confidence            357889999999999743


No 330
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=74.74  E-value=1.8  Score=31.59  Aligned_cols=25  Identities=12%  Similarity=0.186  Sum_probs=19.1

Q ss_pred             cccccceEEecCCCCCCCCCCceee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      ..-.|..+.+.||+||||+-+-.++
T Consensus        23 ~i~~Ge~~~l~G~nGsGKSTLl~~i   47 (236)
T cd03253          23 TIPAGKKVAIVGPSGSGKSTILRLL   47 (236)
T ss_pred             EEcCCCEEEEECCCCCCHHHHHHHH
Confidence            3346889999999999987655444


No 331
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=74.64  E-value=1.6  Score=32.40  Aligned_cols=21  Identities=14%  Similarity=0.118  Sum_probs=16.7

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .-.|.++.+.|++||||+-+-
T Consensus        29 i~~Ge~~~i~G~nGsGKSTLl   49 (253)
T PRK14242         29 FEQNQVTALIGPSGCGKSTFL   49 (253)
T ss_pred             EeCCCEEEEECCCCCCHHHHH
Confidence            346889999999999986443


No 332
>PRK06835 DNA replication protein DnaC; Validated
Probab=74.59  E-value=1.2  Score=36.17  Aligned_cols=16  Identities=19%  Similarity=-0.070  Sum_probs=13.6

Q ss_pred             ceEEecCCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPPN   87 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~   87 (101)
                      .-|++.|+||+|||=.
T Consensus       184 ~~Lll~G~~GtGKThL  199 (329)
T PRK06835        184 ENLLFYGNTGTGKTFL  199 (329)
T ss_pred             CcEEEECCCCCcHHHH
Confidence            5688999999999853


No 333
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=74.58  E-value=1.6  Score=32.04  Aligned_cols=19  Identities=16%  Similarity=0.071  Sum_probs=15.7

Q ss_pred             cccccceEEecCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~   85 (101)
                      ..-.|.++.+.||+||||+
T Consensus        29 ~i~~Ge~~~l~G~nGsGKS   47 (226)
T cd03234          29 HVESGQVMAILGSSGSGKT   47 (226)
T ss_pred             EEcCCeEEEEECCCCCCHH
Confidence            3346889999999999984


No 334
>PRK10869 recombination and repair protein; Provisional
Probab=74.53  E-value=0.98  Score=38.97  Aligned_cols=22  Identities=41%  Similarity=0.608  Sum_probs=18.2

Q ss_pred             cccceEEecCCCCCCCCCCceeeeee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMIIDS   94 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~~~~   94 (101)
                      |..+.-+++||+|+||    |+++|+
T Consensus        20 f~~glnvitGetGaGK----S~ildA   41 (553)
T PRK10869         20 FQSGMTVITGETGAGK----SIAIDA   41 (553)
T ss_pred             cCCCcEEEECCCCCCh----HHHHHH
Confidence            6788999999999999    566653


No 335
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=74.45  E-value=1.4  Score=34.59  Aligned_cols=16  Identities=13%  Similarity=-0.039  Sum_probs=13.6

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      .+++++.|+||+|||-
T Consensus        72 ~~vi~l~G~~G~GKTT   87 (272)
T TIGR00064        72 PNVILFVGVNGVGKTT   87 (272)
T ss_pred             CeEEEEECCCCCcHHH
Confidence            5778888999999984


No 336
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=74.38  E-value=1.7  Score=32.35  Aligned_cols=19  Identities=16%  Similarity=0.181  Sum_probs=15.9

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      +-.|.++.+.||+||||+-
T Consensus        23 i~~Ge~~~i~G~nGsGKST   41 (252)
T TIGR03005        23 VAAGEKVALIGPSGSGKST   41 (252)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3468899999999999863


No 337
>PLN02674 adenylate kinase
Probab=74.35  E-value=1.5  Score=34.60  Aligned_cols=18  Identities=17%  Similarity=0.137  Sum_probs=13.4

Q ss_pred             ceEEecCCCCCCCCCCce
Q psy2779          72 GRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~~   89 (101)
                      ..+++-|||||||+-...
T Consensus        32 ~~i~l~G~PGsGKgT~a~   49 (244)
T PLN02674         32 KRLILIGPPGSGKGTQSP   49 (244)
T ss_pred             ceEEEECCCCCCHHHHHH
Confidence            457789999999974433


No 338
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed
Probab=74.26  E-value=1.5  Score=34.59  Aligned_cols=26  Identities=19%  Similarity=0.054  Sum_probs=20.2

Q ss_pred             cccccccceEEecCCCCCCCCCCcee
Q psy2779          65 SHSLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        65 ~~~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      ..++..+..+++.|.|||||+-.-.+
T Consensus       127 ~~~~~~~~~I~l~G~~GsGKStvg~~  152 (309)
T PRK08154        127 GRRAARRRRIALIGLRGAGKSTLGRM  152 (309)
T ss_pred             hhhccCCCEEEEECCCCCCHHHHHHH
Confidence            34566788999999999999865443


No 339
>PRK14974 cell division protein FtsY; Provisional
Probab=74.25  E-value=1.6  Score=35.84  Aligned_cols=18  Identities=17%  Similarity=-0.023  Sum_probs=15.3

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      ...++++.|+||+|||-.
T Consensus       139 ~~~vi~~~G~~GvGKTTt  156 (336)
T PRK14974        139 KPVVIVFVGVNGTGKTTT  156 (336)
T ss_pred             CCeEEEEEcCCCCCHHHH
Confidence            367999999999999853


No 340
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=74.19  E-value=0.92  Score=40.82  Aligned_cols=16  Identities=19%  Similarity=0.119  Sum_probs=12.9

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      ..-+|+.||||||||-
T Consensus       194 ~~n~lL~G~pGvGKT~  209 (852)
T TIGR03346       194 KNNPVLIGEPGVGKTA  209 (852)
T ss_pred             CCceEEEcCCCCCHHH
Confidence            4566789999999973


No 341
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=74.18  E-value=1.6  Score=31.53  Aligned_cols=20  Identities=20%  Similarity=0.157  Sum_probs=16.3

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.||+|+||+-+
T Consensus        23 i~~Ge~~~i~G~nGsGKSTL   42 (213)
T cd03259          23 VEPGEFLALLGPSGCGKTTL   42 (213)
T ss_pred             EcCCcEEEEECCCCCCHHHH
Confidence            33688999999999998743


No 342
>TIGR00678 holB DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau.
Probab=74.09  E-value=1.4  Score=31.38  Aligned_cols=18  Identities=11%  Similarity=-0.049  Sum_probs=14.4

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      ...+|+.||||+||+-+.
T Consensus        14 ~~~~L~~G~~G~gkt~~a   31 (188)
T TIGR00678        14 AHAYLFAGPEGVGKELLA   31 (188)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            457889999999987543


No 343
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=74.06  E-value=1.4  Score=31.81  Aligned_cols=17  Identities=18%  Similarity=-0.050  Sum_probs=14.1

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .| ++.+.||+||||+-.
T Consensus        25 ~g-~~~i~G~nGsGKSTL   41 (211)
T cd03264          25 PG-MYGLLGPNGAGKTTL   41 (211)
T ss_pred             CC-cEEEECCCCCCHHHH
Confidence            46 889999999998644


No 344
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=74.06  E-value=1.6  Score=32.07  Aligned_cols=19  Identities=21%  Similarity=0.153  Sum_probs=15.7

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|.++.+.||+||||+-
T Consensus        23 i~~Ge~~~l~G~nGsGKST   41 (235)
T cd03261          23 VRRGEILAIIGPSGSGKST   41 (235)
T ss_pred             EcCCCEEEEECCCCCCHHH
Confidence            3468899999999999863


No 345
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=74.04  E-value=1.6  Score=32.45  Aligned_cols=17  Identities=18%  Similarity=0.079  Sum_probs=14.8

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      .|..+.+.|++||||+-
T Consensus        28 ~Ge~~~i~G~nGsGKST   44 (253)
T TIGR02323        28 PGEVLGIVGESGSGKST   44 (253)
T ss_pred             CCcEEEEECCCCCCHHH
Confidence            58899999999999863


No 346
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=74.04  E-value=1.6  Score=33.13  Aligned_cols=20  Identities=30%  Similarity=0.298  Sum_probs=16.4

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.||+||||+-+
T Consensus        24 i~~Ge~~~i~G~nGsGKSTL   43 (255)
T PRK11248         24 LESGELLVVLGPSGCGKTTL   43 (255)
T ss_pred             ECCCCEEEEECCCCCCHHHH
Confidence            34689999999999998643


No 347
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=74.04  E-value=1.6  Score=32.25  Aligned_cols=21  Identities=14%  Similarity=0.042  Sum_probs=16.7

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      +.-.|.++.+.||+||||+-+
T Consensus        24 ~i~~Ge~~~i~G~nGsGKSTL   44 (239)
T cd03296          24 DIPSGELVALLGPSGSGKTTL   44 (239)
T ss_pred             EEcCCCEEEEECCCCCCHHHH
Confidence            334688999999999998643


No 348
>PRK08760 replicative DNA helicase; Provisional
Probab=74.02  E-value=1.9  Score=36.50  Aligned_cols=26  Identities=15%  Similarity=0.022  Sum_probs=21.3

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+-.|-.++++|+||.|||-|.-.+.
T Consensus       225 G~~~G~LivIaarPg~GKTafal~iA  250 (476)
T PRK08760        225 GLQPTDLIILAARPAMGKTTFALNIA  250 (476)
T ss_pred             CCCCCceEEEEeCCCCChhHHHHHHH
Confidence            46678899999999999998875544


No 349
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=74.00  E-value=1.6  Score=31.94  Aligned_cols=22  Identities=14%  Similarity=-0.082  Sum_probs=17.0

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .-.|.++.+.||+||||+-+-.
T Consensus        23 i~~Ge~~~l~G~nGsGKSTLl~   44 (236)
T cd03219          23 VRPGEIHGLIGPNGAGKTTLFN   44 (236)
T ss_pred             ecCCcEEEEECCCCCCHHHHHH
Confidence            3368899999999999864433


No 350
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=73.95  E-value=1.6  Score=32.67  Aligned_cols=16  Identities=19%  Similarity=0.086  Sum_probs=14.6

Q ss_pred             ceEEecCCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPPN   87 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~   87 (101)
                      +.+++.||+|+||+-+
T Consensus        30 ~~~~itGpNg~GKStl   45 (213)
T cd03281          30 SIMVITGPNSSGKSVY   45 (213)
T ss_pred             eEEEEECCCCCChHHH
Confidence            8899999999999866


No 351
>PRK13946 shikimate kinase; Provisional
Probab=73.87  E-value=1.6  Score=31.43  Aligned_cols=18  Identities=17%  Similarity=-0.020  Sum_probs=14.8

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      ..+.+++.|.|||||+-.
T Consensus         9 ~~~~I~l~G~~GsGKsti   26 (184)
T PRK13946          9 GKRTVVLVGLMGAGKSTV   26 (184)
T ss_pred             CCCeEEEECCCCCCHHHH
Confidence            456789999999999754


No 352
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=73.78  E-value=1.5  Score=35.38  Aligned_cols=17  Identities=12%  Similarity=-0.046  Sum_probs=14.6

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      .+.++++.||||+|||-
T Consensus       113 ~~~vi~lvGpnGsGKTT  129 (318)
T PRK10416        113 KPFVILVVGVNGVGKTT  129 (318)
T ss_pred             CCeEEEEECCCCCcHHH
Confidence            47889999999999973


No 353
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=73.68  E-value=1.7  Score=31.50  Aligned_cols=18  Identities=17%  Similarity=0.198  Sum_probs=15.3

Q ss_pred             ccccceEEecCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~   85 (101)
                      .-.|.++.+.||+||||+
T Consensus        25 i~~Ge~~~i~G~nGsGKS   42 (220)
T cd03263          25 VYKGEIFGLLGHNGAGKT   42 (220)
T ss_pred             EcCCcEEEEECCCCCCHH
Confidence            336889999999999985


No 354
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=73.61  E-value=1.2  Score=32.19  Aligned_cols=18  Identities=28%  Similarity=0.278  Sum_probs=15.4

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      +.....++.||+|+|||-
T Consensus        22 ~~~~~~~i~G~NGsGKS~   39 (220)
T PF02463_consen   22 FSPGLNVIVGPNGSGKSN   39 (220)
T ss_dssp             TTSSEEEEEESTTSSHHH
T ss_pred             cCCCCEEEEcCCCCCHHH
Confidence            467799999999999963


No 355
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=73.52  E-value=1.7  Score=32.04  Aligned_cols=18  Identities=17%  Similarity=0.069  Sum_probs=15.4

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|.++.+.||+||||+-
T Consensus        33 ~~Ge~~~l~G~nGsGKST   50 (233)
T PRK11629         33 GEGEMMAIVGSSGSGKST   50 (233)
T ss_pred             cCCcEEEEECCCCCCHHH
Confidence            358899999999999863


No 356
>COG1855 ATPase (PilT family) [General function prediction only]
Probab=73.48  E-value=1.3  Score=39.77  Aligned_cols=15  Identities=13%  Similarity=0.131  Sum_probs=13.1

Q ss_pred             EEecCCCCCCCCCCc
Q psy2779          74 AVAGGRTKCPKPPNT   88 (101)
Q Consensus        74 ll~~G~p~~g~~~~~   88 (101)
                      +|++|+||+||+-|.
T Consensus       266 ILIAG~PGaGKsTFa  280 (604)
T COG1855         266 ILIAGAPGAGKSTFA  280 (604)
T ss_pred             eEEecCCCCChhHHH
Confidence            569999999999875


No 357
>PRK08058 DNA polymerase III subunit delta'; Validated
Probab=73.36  E-value=1.2  Score=35.48  Aligned_cols=36  Identities=14%  Similarity=0.101  Sum_probs=23.2

Q ss_pred             ccc-hHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          39 LVG-QQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        39 lVG-Q~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ++| |+.+.+-   +..+       ++++++  -.++|+.||+|+||+-
T Consensus         7 i~~~q~~~~~~---L~~~-------~~~~~l--~ha~Lf~G~~G~gk~~   43 (329)
T PRK08058          7 LTALQPVVVKM---LQNS-------IAKNRL--SHAYLFEGAKGTGKKA   43 (329)
T ss_pred             HHhhHHHHHHH---HHHH-------HHcCCC--CceEEEECCCCCCHHH
Confidence            456 7777662   2333       333332  4578999999999863


No 358
>KOG3347|consensus
Probab=73.33  E-value=2  Score=33.59  Aligned_cols=20  Identities=10%  Similarity=0.016  Sum_probs=15.5

Q ss_pred             cceEEecCCCCCCCCCCcee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~   90 (101)
                      +--+|++|-|||||+-+.+-
T Consensus         7 ~PNILvtGTPG~GKstl~~~   26 (176)
T KOG3347|consen    7 RPNILVTGTPGTGKSTLAER   26 (176)
T ss_pred             CCCEEEeCCCCCCchhHHHH
Confidence            33478999999999876543


No 359
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=73.31  E-value=1.7  Score=31.81  Aligned_cols=23  Identities=13%  Similarity=0.099  Sum_probs=17.6

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|..+.+.|++||||+-+-.+
T Consensus        34 i~~Ge~~~i~G~nGsGKSTLl~~   56 (214)
T PRK13543         34 VDAGEALLVQGDNGAGKTTLLRV   56 (214)
T ss_pred             ECCCCEEEEEcCCCCCHHHHHHH
Confidence            34688999999999998754433


No 360
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=73.21  E-value=1.7  Score=31.68  Aligned_cols=18  Identities=17%  Similarity=0.006  Sum_probs=15.2

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|.++.+.||+||||+-
T Consensus        24 ~~Ge~~~l~G~nGsGKST   41 (232)
T cd03218          24 KQGEIVGLLGPNGAGKTT   41 (232)
T ss_pred             cCCcEEEEECCCCCCHHH
Confidence            358899999999999863


No 361
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=73.12  E-value=1.6  Score=31.98  Aligned_cols=18  Identities=22%  Similarity=0.340  Sum_probs=15.5

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|.++.+.|++||||+-+
T Consensus        28 ~Ge~~~l~G~nGsGKSTL   45 (238)
T cd03249          28 PGKTVALVGSSGCGKSTV   45 (238)
T ss_pred             CCCEEEEEeCCCCCHHHH
Confidence            689999999999998643


No 362
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=73.11  E-value=1.4  Score=34.27  Aligned_cols=17  Identities=29%  Similarity=0.251  Sum_probs=13.9

Q ss_pred             ccceEEecCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~   86 (101)
                      .+.=+++.|+||+|||=
T Consensus       104 ~~~nl~l~G~~G~GKTh  120 (254)
T COG1484         104 RGENLVLLGPPGVGKTH  120 (254)
T ss_pred             cCCcEEEECCCCCcHHH
Confidence            45668899999999973


No 363
>PRK09165 replicative DNA helicase; Provisional
Probab=73.09  E-value=1.9  Score=36.64  Aligned_cols=23  Identities=17%  Similarity=0.219  Sum_probs=19.3

Q ss_pred             cccccceEEecCCCCCCCCCCce
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .+-.|..++++|+||.|||-|.-
T Consensus       213 G~~~g~livIaarpg~GKT~~al  235 (497)
T PRK09165        213 GLHPSDLIILAGRPSMGKTALAT  235 (497)
T ss_pred             CCCCCceEEEEeCCCCChHHHHH
Confidence            56667889999999999998764


No 364
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=73.08  E-value=1.8  Score=31.28  Aligned_cols=24  Identities=13%  Similarity=0.030  Sum_probs=18.1

Q ss_pred             ccccceEEecCCCCCCCCCCceee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      .-.|..+.+.||+||||+-+-.++
T Consensus        32 i~~Ge~~~l~G~nGsGKStLl~~i   55 (194)
T cd03213          32 AKPGELTAIMGPSGAGKSTLLNAL   55 (194)
T ss_pred             EcCCcEEEEECCCCCCHHHHHHHH
Confidence            336889999999999997544433


No 365
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=73.03  E-value=1.8  Score=31.54  Aligned_cols=19  Identities=16%  Similarity=0.174  Sum_probs=15.8

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      ...|.++.+.|++||||+-
T Consensus        31 i~~Ge~~~l~G~nGsGKST   49 (224)
T TIGR02324        31 VNAGECVALSGPSGAGKST   49 (224)
T ss_pred             ECCCCEEEEECCCCCCHHH
Confidence            3368999999999999863


No 366
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=72.96  E-value=2  Score=31.08  Aligned_cols=19  Identities=21%  Similarity=0.153  Sum_probs=15.8

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      ...|.++.+.|++||||+-
T Consensus        24 i~~Ge~~~l~G~nGsGKST   42 (204)
T PRK13538         24 LNAGELVQIEGPNGAGKTS   42 (204)
T ss_pred             ECCCcEEEEECCCCCCHHH
Confidence            3468899999999999863


No 367
>PRK10908 cell division protein FtsE; Provisional
Probab=72.95  E-value=1.8  Score=31.57  Aligned_cols=22  Identities=18%  Similarity=0.138  Sum_probs=17.3

Q ss_pred             cccceEEecCCCCCCCCCCcee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      -.|.++.+.||+||||+-+-.+
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~~   47 (222)
T PRK10908         26 RPGEMAFLTGHSGAGKSTLLKL   47 (222)
T ss_pred             cCCCEEEEECCCCCCHHHHHHH
Confidence            3688999999999998744433


No 368
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.94  E-value=2.2  Score=31.14  Aligned_cols=21  Identities=14%  Similarity=0.082  Sum_probs=16.9

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .-.|.++.+.||+||||+-+-
T Consensus        25 i~~Ge~~~i~G~nGsGKSTLl   45 (234)
T cd03251          25 IPAGETVALVGPSGSGKSTLV   45 (234)
T ss_pred             EcCCCEEEEECCCCCCHHHHH
Confidence            346889999999999986443


No 369
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=72.87  E-value=1.1  Score=39.79  Aligned_cols=22  Identities=45%  Similarity=0.628  Sum_probs=19.4

Q ss_pred             cccceEEecCCCCCCCCCCceeeeee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMIIDS   94 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~~~~   94 (101)
                      |..+.-+++|+||+||    ||+||.
T Consensus        20 F~~GltVlTGETGAGK----SIiidA   41 (557)
T COG0497          20 FEKGLTVLTGETGAGK----SIIIDA   41 (557)
T ss_pred             ccCCceEEecCCCCcH----hHHHHH
Confidence            6788999999999999    788875


No 370
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=72.86  E-value=1.1  Score=39.11  Aligned_cols=49  Identities=14%  Similarity=0.064  Sum_probs=25.9

Q ss_pred             cCcccchHHHHhhcceeeeccc--ceeeeeccccccccceEEecCCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKS--FQFERCKSHSLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~--~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      -+-+.|...+.+...=+++.-.  -.|.+. ..+ +. +-+|+.||||||||-.
T Consensus       151 ~~di~g~~~~~~~l~~i~~~~~~~~~~~~~-~~~-~~-~gill~G~~G~GKt~~  201 (644)
T PRK10733        151 FADVAGCDEAKEEVAELVEYLREPSRFQKL-GGK-IP-KGVLMVGPPGTGKTLL  201 (644)
T ss_pred             HHHHcCHHHHHHHHHHHHHHhhCHHHHHhc-CCC-CC-CcEEEECCCCCCHHHH
Confidence            3446677777766655555400  000000 001 11 2288999999998754


No 371
>PLN02840 tRNA dimethylallyltransferase
Probab=72.85  E-value=1.8  Score=37.03  Aligned_cols=20  Identities=20%  Similarity=0.037  Sum_probs=15.9

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.+.++++.||||||||-.
T Consensus        18 ~~~~~vi~I~GptgsGKTtl   37 (421)
T PLN02840         18 TKKEKVIVISGPTGAGKSRL   37 (421)
T ss_pred             ccCCeEEEEECCCCCCHHHH
Confidence            33467899999999999753


No 372
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.85  E-value=1.8  Score=32.21  Aligned_cols=19  Identities=21%  Similarity=0.221  Sum_probs=15.7

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        28 ~~Ge~~~l~G~nGsGKSTL   46 (253)
T PRK14267         28 PQNGVFALMGPSGCGKSTL   46 (253)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 373
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=72.82  E-value=1.7  Score=30.59  Aligned_cols=15  Identities=20%  Similarity=0.295  Sum_probs=13.7

Q ss_pred             cceEEecCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKP   85 (101)
Q Consensus        71 g~~ll~~G~p~~g~~   85 (101)
                      |+-+|+.+|||+|||
T Consensus        36 ~~~~li~~~TG~GKT   50 (203)
T cd00268          36 GRDVIGQAQTGSGKT   50 (203)
T ss_pred             CCcEEEECCCCCcHH
Confidence            677899999999998


No 374
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.80  E-value=1.8  Score=31.21  Aligned_cols=22  Identities=14%  Similarity=0.095  Sum_probs=17.2

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ...|.++.+.||+||||+-+-.
T Consensus        21 i~~Ge~~~l~G~nGsGKSTLl~   42 (211)
T cd03298          21 FAQGEITAIVGPSGSGKSTLLN   42 (211)
T ss_pred             EcCCCEEEEECCCCCCHHHHHH
Confidence            3468899999999999864433


No 375
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=72.79  E-value=2.2  Score=31.62  Aligned_cols=21  Identities=14%  Similarity=0.045  Sum_probs=16.8

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .+-.|.++.+.||+||||+-+
T Consensus        22 ~i~~Ge~~~l~G~nGsGKSTL   42 (237)
T TIGR00968        22 EVPTGSLVALLGPSGSGKSTL   42 (237)
T ss_pred             EEcCCCEEEEECCCCCCHHHH
Confidence            344688999999999998643


No 376
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=72.77  E-value=1.8  Score=31.86  Aligned_cols=21  Identities=24%  Similarity=0.245  Sum_probs=16.8

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .+..|..+.+.||+||||+-+
T Consensus        21 ~i~~Ge~~~l~G~nGsGKSTL   41 (232)
T PRK10771         21 TVERGERVAILGPSGAGKSTL   41 (232)
T ss_pred             EEcCCCEEEEECCCCCCHHHH
Confidence            344688999999999998643


No 377
>KOG0990|consensus
Probab=72.74  E-value=1.7  Score=37.01  Aligned_cols=16  Identities=13%  Similarity=0.025  Sum_probs=13.4

Q ss_pred             eEEecCCCCCCCCCCc
Q psy2779          73 RAVAGGRTKCPKPPNT   88 (101)
Q Consensus        73 ~ll~~G~p~~g~~~~~   88 (101)
                      -+|.-||||+||||-+
T Consensus        64 h~L~YgPPGtGktsti   79 (360)
T KOG0990|consen   64 HLLFYGPPGTGKTSTI   79 (360)
T ss_pred             cccccCCCCCCCCCch
Confidence            5788999999999843


No 378
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=72.66  E-value=2.3  Score=30.70  Aligned_cols=23  Identities=22%  Similarity=0.130  Sum_probs=17.6

Q ss_pred             cccccceEEecCCCCCCCCCCce
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..-.|.++.+.|++||||+-+-.
T Consensus        23 ~i~~Ge~~~l~G~nGsGKSTLl~   45 (200)
T PRK13540         23 HLPAGGLLHLKGSNGAGKTTLLK   45 (200)
T ss_pred             EECCCCEEEEECCCCCCHHHHHH
Confidence            33468899999999999864433


No 379
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=72.66  E-value=1.8  Score=37.52  Aligned_cols=21  Identities=33%  Similarity=0.328  Sum_probs=16.9

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .|+++++.||+|+|||-...+
T Consensus       255 ~g~Vi~LvGpnGvGKTTTiaK  275 (484)
T PRK06995        255 RGGVFALMGPTGVGKTTTTAK  275 (484)
T ss_pred             CCcEEEEECCCCccHHHHHHH
Confidence            478999999999999854433


No 380
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=72.50  E-value=1.9  Score=30.59  Aligned_cols=24  Identities=17%  Similarity=0.152  Sum_probs=18.2

Q ss_pred             cccccceEEecCCCCCCCCCCcee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      ....|..+.+.|++||||+-+-.+
T Consensus        23 ~i~~Ge~~~i~G~nGsGKSTLl~~   46 (166)
T cd03223          23 EIKPGDRLLITGPSGTGKSSLFRA   46 (166)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHH
Confidence            344688999999999998754443


No 381
>PRK12338 hypothetical protein; Provisional
Probab=72.50  E-value=1.8  Score=35.67  Aligned_cols=18  Identities=11%  Similarity=-0.031  Sum_probs=14.8

Q ss_pred             cceEEecCCCCCCCCCCc
Q psy2779          71 GGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~   88 (101)
                      -.+++++|+|||||+-..
T Consensus         4 p~ii~i~G~sGsGKST~a   21 (319)
T PRK12338          4 PYVILIGSASGIGKSTIA   21 (319)
T ss_pred             cEEEEEECCCCCCHHHHH
Confidence            468999999999987543


No 382
>TIGR01448 recD_rel helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD.
Probab=72.49  E-value=1.7  Score=38.63  Aligned_cols=25  Identities=20%  Similarity=0.084  Sum_probs=19.1

Q ss_pred             cceEEecCCCCCCCCCCceeeeeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      .+..++.|+||||||.....+++.|
T Consensus       338 ~~~~iitGgpGTGKTt~l~~i~~~~  362 (720)
T TIGR01448       338 HKVVILTGGPGTGKTTITRAIIELA  362 (720)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHH
Confidence            5689999999999997655555444


No 383
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=72.46  E-value=1.2  Score=32.13  Aligned_cols=16  Identities=19%  Similarity=0.131  Sum_probs=11.1

Q ss_pred             eEEecCCCCCCCCCCc
Q psy2779          73 RAVAGGRTKCPKPPNT   88 (101)
Q Consensus        73 ~ll~~G~p~~g~~~~~   88 (101)
                      =+|++|.||+|||=+.
T Consensus        40 h~li~G~tgsGKS~~l   55 (205)
T PF01580_consen   40 HLLIAGATGSGKSTLL   55 (205)
T ss_dssp             SEEEE--TTSSHHHHH
T ss_pred             eEEEEcCCCCCccHHH
Confidence            5789999999987543


No 384
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=72.44  E-value=1.8  Score=31.87  Aligned_cols=19  Identities=21%  Similarity=0.078  Sum_probs=15.9

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.|++||||+-.
T Consensus        25 ~~Ge~~~l~G~nGsGKSTL   43 (240)
T PRK09493         25 DQGEVVVIIGPSGSGKSTL   43 (240)
T ss_pred             cCCcEEEEECCCCCCHHHH
Confidence            3688999999999998643


No 385
>PRK06904 replicative DNA helicase; Validated
Probab=72.39  E-value=2  Score=36.41  Aligned_cols=24  Identities=13%  Similarity=0.054  Sum_probs=20.3

Q ss_pred             ccccccceEEecCCCCCCCCCCce
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      +.+-.|..++++|+||.|||-|.-
T Consensus       216 ~Gl~~G~LiiIaarPg~GKTafal  239 (472)
T PRK06904        216 AGLQPSDLIIVAARPSMGKTTFAM  239 (472)
T ss_pred             hccCCCcEEEEEeCCCCChHHHHH
Confidence            456678899999999999998763


No 386
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.24  E-value=1.8  Score=31.51  Aligned_cols=18  Identities=17%  Similarity=0.082  Sum_probs=15.3

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|..+.+.||+||||+-+
T Consensus        32 ~Ge~~~i~G~nGsGKSTL   49 (202)
T cd03233          32 PGEMVLVLGRPGSGCSTL   49 (202)
T ss_pred             CCcEEEEECCCCCCHHHH
Confidence            588999999999998643


No 387
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.12  E-value=1.9  Score=30.61  Aligned_cols=20  Identities=15%  Similarity=0.094  Sum_probs=16.3

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ....|-++.+.||+|||||-
T Consensus        22 ~i~~G~~~~i~G~nGsGKST   41 (178)
T cd03229          22 NIEAGEIVALLGPSGSGKST   41 (178)
T ss_pred             EEcCCCEEEEECCCCCCHHH
Confidence            34468899999999999863


No 388
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.12  E-value=2.5  Score=29.18  Aligned_cols=20  Identities=20%  Similarity=0.135  Sum_probs=16.4

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ....|..+.+.|++|+||+-
T Consensus        21 ~i~~g~~~~i~G~nGsGKSt   40 (157)
T cd00267          21 TLKAGEIVALVGPNGSGKST   40 (157)
T ss_pred             EEcCCCEEEEECCCCCCHHH
Confidence            44468899999999999863


No 389
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.08  E-value=1.9  Score=31.43  Aligned_cols=19  Identities=21%  Similarity=0.031  Sum_probs=15.8

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-.
T Consensus        24 ~~Ge~~~i~G~nGsGKSTL   42 (220)
T cd03265          24 RRGEIFGLLGPNGAGKTTT   42 (220)
T ss_pred             CCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 390
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=72.05  E-value=1.9  Score=30.71  Aligned_cols=18  Identities=11%  Similarity=-0.051  Sum_probs=15.2

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|..+.+.|++||||+-
T Consensus        24 ~~G~~~~i~G~nGsGKST   41 (182)
T cd03215          24 RAGEIVGIAGLVGNGQTE   41 (182)
T ss_pred             cCCcEEEEECCCCCCHHH
Confidence            358899999999999863


No 391
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=71.93  E-value=1.9  Score=31.28  Aligned_cols=19  Identities=16%  Similarity=0.128  Sum_probs=15.9

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|..+.+.||+||||+-
T Consensus        21 i~~Ge~~~i~G~nGsGKST   39 (213)
T TIGR01277        21 VADGEIVAIMGPSGAGKST   39 (213)
T ss_pred             EeCCcEEEEECCCCCCHHH
Confidence            3369999999999999853


No 392
>PRK06851 hypothetical protein; Provisional
Probab=71.91  E-value=1.7  Score=36.30  Aligned_cols=25  Identities=20%  Similarity=0.108  Sum_probs=18.5

Q ss_pred             cceEEecCCCCCCCCCCceeeeeee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      -+..++.|+|||||+-....+...+
T Consensus       214 ~~~~~i~G~pG~GKstl~~~i~~~a  238 (367)
T PRK06851        214 KNRYFLKGRPGTGKSTMLKKIAKAA  238 (367)
T ss_pred             ceEEEEeCCCCCcHHHHHHHHHHHH
Confidence            4678999999999986555444443


No 393
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=71.90  E-value=1.9  Score=31.90  Aligned_cols=23  Identities=13%  Similarity=0.043  Sum_probs=18.0

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.|..+.+.||+||||+-+-.++
T Consensus        29 ~~Ge~~~i~G~nGsGKSTLl~~l   51 (252)
T PRK14239         29 YPNEITALIGPSGSGKSTLLRSI   51 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHHHH
Confidence            35889999999999987554444


No 394
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=71.72  E-value=2  Score=31.81  Aligned_cols=19  Identities=16%  Similarity=-0.006  Sum_probs=15.8

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        27 ~~Ge~~~i~G~nGsGKSTL   45 (250)
T PRK11264         27 KPGEVVAIIGPSGSGKTTL   45 (250)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 395
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=71.69  E-value=1.9  Score=31.70  Aligned_cols=22  Identities=14%  Similarity=0.045  Sum_probs=17.2

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .-.|.++.+.||+||||+-+-.
T Consensus        28 i~~Ge~~~i~G~nGsGKSTLl~   49 (237)
T PRK11614         28 INQGEIVTLIGANGAGKTTLLG   49 (237)
T ss_pred             EcCCcEEEEECCCCCCHHHHHH
Confidence            3368899999999999874433


No 396
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=71.68  E-value=2  Score=31.73  Aligned_cols=20  Identities=15%  Similarity=0.019  Sum_probs=16.3

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.||+||||+-+
T Consensus        26 i~~Ge~~~l~G~nGsGKSTL   45 (241)
T PRK10895         26 VNSGEIVGLLGPNGAGKTTT   45 (241)
T ss_pred             EcCCcEEEEECCCCCCHHHH
Confidence            34688999999999998643


No 397
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=71.64  E-value=2  Score=31.11  Aligned_cols=21  Identities=24%  Similarity=0.094  Sum_probs=16.8

Q ss_pred             cccceEEecCCCCCCCCCCce
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      -.|.++.+.||+||||+-+-.
T Consensus        28 ~~Ge~~~i~G~nGsGKSTLl~   48 (221)
T cd03244          28 KPGEKVGIVGRTGSGKSSLLL   48 (221)
T ss_pred             CCCCEEEEECCCCCCHHHHHH
Confidence            368899999999999874433


No 398
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=71.47  E-value=2.5  Score=30.37  Aligned_cols=20  Identities=20%  Similarity=0.154  Sum_probs=16.2

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-.|.++.+.||+||||+-
T Consensus        22 ~i~~Ge~~~i~G~nGsGKST   41 (198)
T TIGR01189        22 TLNAGEALQVTGPNGIGKTT   41 (198)
T ss_pred             EEcCCcEEEEECCCCCCHHH
Confidence            34468899999999999953


No 399
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.45  E-value=2  Score=31.85  Aligned_cols=23  Identities=17%  Similarity=0.290  Sum_probs=17.4

Q ss_pred             cccccceEEecCCCCCCCCCCce
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..-.|..+.+.|++||||+-+-.
T Consensus        25 ~i~~Ge~~~i~G~nGsGKSTLl~   47 (250)
T PRK14262         25 KIFKNQITAIIGPSGCGKTTLLR   47 (250)
T ss_pred             eecCCCEEEEECCCCCCHHHHHH
Confidence            33468899999999999864433


No 400
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=71.39  E-value=2  Score=36.93  Aligned_cols=19  Identities=21%  Similarity=0.011  Sum_probs=16.2

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      ...++++++.||+|||||-
T Consensus       203 ~~~~~ii~lvGptGvGKTT  221 (407)
T PRK12726        203 LSNHRIISLIGQTGVGKTT  221 (407)
T ss_pred             ecCCeEEEEECCCCCCHHH
Confidence            3468999999999999984


No 401
>PRK06321 replicative DNA helicase; Provisional
Probab=71.22  E-value=2.3  Score=36.23  Aligned_cols=26  Identities=12%  Similarity=0.022  Sum_probs=21.1

Q ss_pred             cccccceEEecCCCCCCCCCCceeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .+-.|-.++++|+||.|||-|...+.
T Consensus       222 Gl~~G~LiiiaarPgmGKTafal~ia  247 (472)
T PRK06321        222 GFSPSNLMILAARPAMGKTALALNIA  247 (472)
T ss_pred             CCCCCcEEEEEeCCCCChHHHHHHHH
Confidence            56678899999999999998765443


No 402
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=71.12  E-value=2.1  Score=30.30  Aligned_cols=19  Identities=16%  Similarity=0.008  Sum_probs=15.7

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|..+.+.|++||||+-
T Consensus        23 i~~Ge~~~i~G~nGsGKSt   41 (173)
T cd03230          23 VEKGEIYGLLGPNGAGKTT   41 (173)
T ss_pred             EcCCcEEEEECCCCCCHHH
Confidence            3468899999999999853


No 403
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=71.07  E-value=3.2  Score=31.88  Aligned_cols=17  Identities=35%  Similarity=0.464  Sum_probs=14.7

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      |..+.-++.||+||||+
T Consensus        19 ~~~~~~~i~G~nGsGKS   35 (276)
T cd03241          19 FEEGLTVLTGETGAGKS   35 (276)
T ss_pred             eCCCeEEEEcCCCCCHH
Confidence            46778899999999995


No 404
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=71.04  E-value=2  Score=32.95  Aligned_cols=18  Identities=17%  Similarity=0.056  Sum_probs=15.3

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|.++.+.||+||||+-
T Consensus        35 ~~Ge~~~l~G~nGsGKST   52 (289)
T PRK13645         35 KKNKVTCVIGTTGSGKST   52 (289)
T ss_pred             eCCCEEEEECCCCCCHHH
Confidence            358899999999999863


No 405
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=71.03  E-value=0.78  Score=32.52  Aligned_cols=21  Identities=14%  Similarity=0.031  Sum_probs=16.3

Q ss_pred             ceEEecCCCCCCCCCCceeee
Q psy2779          72 GRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      ..+++.|+|||||+.+...+.
T Consensus        42 ~~I~iiG~~g~GKStLl~~l~   62 (204)
T cd01878          42 PTVALVGYTNAGKSTLFNALT   62 (204)
T ss_pred             CeEEEECCCCCCHHHHHHHHh
Confidence            367789999999988765444


No 406
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=71.02  E-value=1.9  Score=31.53  Aligned_cols=14  Identities=21%  Similarity=0.090  Sum_probs=11.3

Q ss_pred             ceEEecCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKP   85 (101)
Q Consensus        72 ~~ll~~G~p~~g~~   85 (101)
                      .-+||.|++||||.
T Consensus        23 ~pVlI~GE~GtGK~   36 (168)
T PF00158_consen   23 LPVLITGETGTGKE   36 (168)
T ss_dssp             S-EEEECSTTSSHH
T ss_pred             CCEEEEcCCCCcHH
Confidence            56789999999974


No 407
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=70.93  E-value=2.1  Score=31.55  Aligned_cols=21  Identities=14%  Similarity=0.069  Sum_probs=16.8

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .|..+.+.|++||||+-+-.+
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~   46 (248)
T PRK09580         26 PGEVHAIMGPNGSGKSTLSAT   46 (248)
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            588999999999998754443


No 408
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=70.91  E-value=2.1  Score=31.44  Aligned_cols=23  Identities=22%  Similarity=0.167  Sum_probs=17.8

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|.++.+.|++||||+-+-.+
T Consensus        25 i~~Ge~~~i~G~nGsGKSTLl~~   47 (237)
T cd03252          25 IKPGEVVGIVGRSGSGKSTLTKL   47 (237)
T ss_pred             EcCCCEEEEECCCCCCHHHHHHH
Confidence            34688999999999999744333


No 409
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=70.78  E-value=1.8  Score=34.65  Aligned_cols=19  Identities=11%  Similarity=-0.011  Sum_probs=15.5

Q ss_pred             cceEEecCCCCCCCCCCce
Q psy2779          71 GGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..++++.|++|||||-...
T Consensus         6 ~~~i~i~G~~GsGKtt~~~   24 (288)
T PRK05416          6 MRLVIVTGLSGAGKSVALR   24 (288)
T ss_pred             ceEEEEECCCCCcHHHHHH
Confidence            4688999999999986544


No 410
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=70.77  E-value=2.1  Score=32.36  Aligned_cols=23  Identities=17%  Similarity=0.037  Sum_probs=18.3

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.|.++.+.|++||||+-+-.++
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~~l   57 (265)
T PRK10575         35 PAGKVTGLIGHNGSGKSTLLKML   57 (265)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHH
Confidence            35889999999999997655444


No 411
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=70.68  E-value=2.1  Score=31.86  Aligned_cols=20  Identities=15%  Similarity=0.174  Sum_probs=16.2

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.|++||||+-+
T Consensus        27 i~~Ge~~~i~G~nGsGKSTL   46 (252)
T PRK14256         27 FPENSVTAIIGPSGCGKSTV   46 (252)
T ss_pred             EcCCCEEEEECCCCCCHHHH
Confidence            34688999999999998643


No 412
>PRK03846 adenylylsulfate kinase; Provisional
Probab=70.65  E-value=2  Score=31.17  Aligned_cols=18  Identities=17%  Similarity=0.032  Sum_probs=15.0

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .+..+.+.|.+||||+-.
T Consensus        23 ~~~~i~i~G~~GsGKSTl   40 (198)
T PRK03846         23 KGVVLWFTGLSGSGKSTV   40 (198)
T ss_pred             CCEEEEEECCCCCCHHHH
Confidence            477899999999999643


No 413
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.
Probab=70.54  E-value=2.5  Score=36.93  Aligned_cols=19  Identities=26%  Similarity=0.316  Sum_probs=16.2

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      |.+++.+|.||+||||+-.
T Consensus        21 f~~~~~~i~G~NGsGKS~l   39 (1179)
T TIGR02168        21 FDKGITGIVGPNGCGKSNI   39 (1179)
T ss_pred             ecCCcEEEECCCCCChhHH
Confidence            5678999999999999743


No 414
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=70.51  E-value=2.2  Score=33.36  Aligned_cols=21  Identities=19%  Similarity=0.175  Sum_probs=16.6

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .|..+++.||+|||||-.-.+
T Consensus        15 ~Gqr~~I~G~~G~GKTTLlr~   35 (249)
T cd01128          15 KGQRGLIVAPPKAGKTTLLQS   35 (249)
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            588889999999999844333


No 415
>CHL00095 clpC Clp protease ATP binding subunit
Probab=70.51  E-value=1.8  Score=38.77  Aligned_cols=16  Identities=13%  Similarity=0.113  Sum_probs=12.7

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      ..-+|+.||||||||-
T Consensus       200 ~~n~lL~G~pGvGKTa  215 (821)
T CHL00095        200 KNNPILIGEPGVGKTA  215 (821)
T ss_pred             cCCeEEECCCCCCHHH
Confidence            3456799999999974


No 416
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=70.46  E-value=2.1  Score=32.77  Aligned_cols=20  Identities=25%  Similarity=0.268  Sum_probs=16.4

Q ss_pred             cccceEEecCCCCCCCCCCc
Q psy2779          69 FRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~   88 (101)
                      -.|.++.+.||+||||+-+-
T Consensus        36 ~~Ge~~~I~G~NGsGKSTLl   55 (257)
T PRK11247         36 PAGQFVAVVGRSGCGKSTLL   55 (257)
T ss_pred             cCCCEEEEECCCCCCHHHHH
Confidence            35889999999999987443


No 417
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=70.44  E-value=2.2  Score=31.09  Aligned_cols=22  Identities=18%  Similarity=0.157  Sum_probs=17.4

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ...|..+.+.||+||||+-+-.
T Consensus        37 i~~Ge~~~i~G~nGsGKSTLl~   58 (226)
T cd03248          37 LHPGEVTALVGPSGSGKSTVVA   58 (226)
T ss_pred             EcCCCEEEEECCCCCCHHHHHH
Confidence            3468899999999999875443


No 418
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=70.43  E-value=2.2  Score=31.71  Aligned_cols=18  Identities=17%  Similarity=0.255  Sum_probs=15.3

Q ss_pred             ccccceEEecCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~   85 (101)
                      .-.|.++.+.|++||||+
T Consensus        24 i~~Ge~~~i~G~nGsGKS   41 (247)
T TIGR00972        24 IPKNQVTALIGPSGCGKS   41 (247)
T ss_pred             ECCCCEEEEECCCCCCHH
Confidence            335889999999999985


No 419
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=70.39  E-value=2.2  Score=31.45  Aligned_cols=18  Identities=28%  Similarity=0.244  Sum_probs=15.3

Q ss_pred             ccccceEEecCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~   85 (101)
                      .-.|.++.+.||+||||+
T Consensus         9 i~~Ge~~~i~G~nGsGKS   26 (230)
T TIGR02770         9 LKRGEVLALVGESGSGKS   26 (230)
T ss_pred             EcCCCEEEEECCCCCCHH
Confidence            336889999999999986


No 420
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=70.38  E-value=2.2  Score=31.65  Aligned_cols=21  Identities=14%  Similarity=0.118  Sum_probs=16.7

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .|.++.+.||+||||+-.-.+
T Consensus        28 ~Ge~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14240         28 ENQVTALIGPSGCGKSTFLRT   48 (250)
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            588999999999998644433


No 421
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=70.30  E-value=2.7  Score=31.95  Aligned_cols=19  Identities=16%  Similarity=0.043  Sum_probs=15.9

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        33 ~~Ge~~~l~G~nGsGKSTL   51 (271)
T PRK13632         33 NEGEYVAILGHNGSGKSTI   51 (271)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3688999999999998643


No 422
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=70.12  E-value=2.4  Score=38.14  Aligned_cols=19  Identities=26%  Similarity=0.324  Sum_probs=16.7

Q ss_pred             cccccceEEecCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~   85 (101)
                      +.|..++-||.||+|+|||
T Consensus        21 ~~f~~gi~lI~G~nGsGKS   39 (908)
T COG0419          21 KLFDSGIFLIVGPNGAGKS   39 (908)
T ss_pred             ecCCCCeEEEECCCCCcHH
Confidence            3578999999999999985


No 423
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=70.01  E-value=2.3  Score=31.51  Aligned_cols=21  Identities=19%  Similarity=0.177  Sum_probs=16.6

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..-.|.++.+.||+||||+-+
T Consensus        23 ~i~~Ge~~~i~G~nGsGKSTL   43 (242)
T cd03295          23 EIAKGEFLVLIGPSGSGKTTT   43 (242)
T ss_pred             EECCCCEEEEECCCCCCHHHH
Confidence            334688999999999998643


No 424
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=69.97  E-value=2.2  Score=31.37  Aligned_cols=19  Identities=21%  Similarity=0.018  Sum_probs=15.7

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.|++||||+-+
T Consensus        26 ~~Ge~~~l~G~nGsGKSTL   44 (242)
T TIGR03411        26 DPGELRVIIGPNGAGKTTM   44 (242)
T ss_pred             cCCcEEEEECCCCCCHHHH
Confidence            3688999999999998643


No 425
>PRK10865 protein disaggregation chaperone; Provisional
Probab=69.96  E-value=1.9  Score=39.21  Aligned_cols=16  Identities=19%  Similarity=0.119  Sum_probs=12.9

Q ss_pred             cceEEecCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPP   86 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~   86 (101)
                      ..-+|+.||||||||-
T Consensus       199 ~~n~lL~G~pGvGKT~  214 (857)
T PRK10865        199 KNNPVLIGEPGVGKTA  214 (857)
T ss_pred             cCceEEECCCCCCHHH
Confidence            4467789999999973


No 426
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=69.92  E-value=2.7  Score=31.17  Aligned_cols=19  Identities=11%  Similarity=-0.144  Sum_probs=15.9

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        29 ~~Ge~~~l~G~nGsGKSTL   47 (255)
T PRK11300         29 REQEIVSLIGPNGAGKTTV   47 (255)
T ss_pred             cCCeEEEEECCCCCCHHHH
Confidence            3688999999999998643


No 427
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=69.83  E-value=2.3  Score=31.01  Aligned_cols=19  Identities=11%  Similarity=-0.066  Sum_probs=15.7

Q ss_pred             ccccceEEecCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~   86 (101)
                      .-.|-.+.+.||+||||+-
T Consensus        23 i~~Ge~~~i~G~nGsGKST   41 (223)
T TIGR03740        23 VPKNSVYGLLGPNGAGKST   41 (223)
T ss_pred             EcCCcEEEEECCCCCCHHH
Confidence            3368899999999999863


No 428
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=69.73  E-value=2.2  Score=31.42  Aligned_cols=18  Identities=17%  Similarity=0.014  Sum_probs=15.1

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|.++.+.|++||||+-+
T Consensus         5 ~Ge~~~l~G~nGsGKSTL   22 (223)
T TIGR03771         5 KGELLGLLGPNGAGKTTL   22 (223)
T ss_pred             CCcEEEEECCCCCCHHHH
Confidence            488999999999998643


No 429
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=69.72  E-value=2.5  Score=31.81  Aligned_cols=18  Identities=11%  Similarity=-0.158  Sum_probs=14.4

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      ..++.++.||+||||+-.
T Consensus        21 ~~~~~~i~G~NGsGKStl   38 (247)
T cd03275          21 FDRFTCIIGPNGSGKSNL   38 (247)
T ss_pred             CCCeEEEECCCCCCHHHH
Confidence            345889999999999643


No 430
>KOG2373|consensus
Probab=69.69  E-value=2.7  Score=37.05  Aligned_cols=24  Identities=33%  Similarity=0.288  Sum_probs=19.8

Q ss_pred             ccccccccceEEecCCCCCCCCCCce
Q psy2779          64 KSHSLFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        64 ~~~~~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      |-|+  .|-.-+++||+|+|||-|-|
T Consensus       268 kGhR--~GElTvlTGpTGsGKTTFls  291 (514)
T KOG2373|consen  268 KGHR--PGELTVLTGPTGSGKTTFLS  291 (514)
T ss_pred             ccCC--CCceEEEecCCCCCceeEeh
Confidence            4455  48889999999999998866


No 431
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=69.52  E-value=1.6  Score=32.32  Aligned_cols=20  Identities=10%  Similarity=-0.147  Sum_probs=16.3

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      ..+++.+.|++|+|||-...
T Consensus        18 ~~~~v~I~G~~G~GKT~LA~   37 (287)
T PF00931_consen   18 EVRVVAIVGMGGIGKTTLAR   37 (287)
T ss_dssp             SSEEEEEEESTTSSHHHHHH
T ss_pred             CeEEEEEEcCCcCCcceeee
Confidence            47899999999999975443


No 432
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=69.44  E-value=2.2  Score=31.83  Aligned_cols=21  Identities=19%  Similarity=0.120  Sum_probs=17.5

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..-.|.++-+.|+.||||+-.
T Consensus        17 ~i~~Ge~~~l~G~sGsGKSTL   37 (226)
T cd03270          17 DIPRNKLVVITGVSGSGKSSL   37 (226)
T ss_pred             ecCCCcEEEEEcCCCCCHHHH
Confidence            344699999999999999865


No 433
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=69.40  E-value=2.5  Score=31.71  Aligned_cols=18  Identities=17%  Similarity=0.073  Sum_probs=15.1

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      |..+...+-||+||||+-
T Consensus        23 ~~~~~~~IvG~NGsGKSt   40 (251)
T cd03273          23 FDPQFNAITGLNGSGKSN   40 (251)
T ss_pred             CCCCeEEEECCCCCCHHH
Confidence            457888899999999963


No 434
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=69.38  E-value=2.3  Score=31.84  Aligned_cols=22  Identities=14%  Similarity=0.131  Sum_probs=16.9

Q ss_pred             ccccceEEecCCCCCCCCCCce
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .-.|.++.+.|++||||+-+-.
T Consensus        35 i~~Ge~~~l~G~nGsGKSTLl~   56 (259)
T PRK14274         35 IPENEVTAIIGPSGCGKSTFIK   56 (259)
T ss_pred             EcCCCEEEEECCCCCCHHHHHH
Confidence            3368899999999999864433


No 435
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=69.27  E-value=2.4  Score=31.81  Aligned_cols=18  Identities=17%  Similarity=0.014  Sum_probs=15.5

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|.++.+.|++||||+-+
T Consensus        31 ~Ge~~~i~G~nGsGKSTL   48 (258)
T PRK11701         31 PGEVLGIVGESGSGKTTL   48 (258)
T ss_pred             CCCEEEEECCCCCCHHHH
Confidence            588999999999998643


No 436
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=69.24  E-value=3  Score=30.31  Aligned_cols=23  Identities=17%  Similarity=0.206  Sum_probs=17.5

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|.++.+.||+||||+-+-.+
T Consensus        24 i~~Ge~~~i~G~nGsGKSTLl~~   46 (218)
T cd03290          24 IPTGQLTMIVGQVGCGKSSLLLA   46 (218)
T ss_pred             EcCCCEEEEECCCCCCHHHHHHH
Confidence            33688999999999998644333


No 437
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=69.24  E-value=2.2  Score=41.04  Aligned_cols=49  Identities=8%  Similarity=-0.058  Sum_probs=29.2

Q ss_pred             cccCcccchHHHHhhc-ceeeecccceeeeeccccccccceEEecCCCCCCCCCCceee
Q psy2779          34 EMAAGLVGQQAAREVS-RAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        34 ~~a~GlVGQ~~AREAa-GIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +..+-|++.++-.+.. .++.+.       ++...  .+.+|++.|+||||||--+-.+
T Consensus       752 YVPD~LPhREeEIeeLasfL~pa-------Ikgsg--pnnvLYIyG~PGTGKTATVK~V  801 (1164)
T PTZ00112        752 VVPKYLPCREKEIKEVHGFLESG-------IKQSG--SNQILYISGMPGTGKTATVYSV  801 (1164)
T ss_pred             cCCCcCCChHHHHHHHHHHHHHH-------HhcCC--CCceEEEECCCCCCHHHHHHHH
Confidence            3445677777655544 344444       22111  3567889999999998654433


No 438
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=69.21  E-value=2.4  Score=31.40  Aligned_cols=19  Identities=21%  Similarity=0.216  Sum_probs=15.8

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus         9 ~~Ge~~~i~G~nGsGKSTL   27 (230)
T TIGR01184         9 QQGEFISLIGHSGCGKSTL   27 (230)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 439
>PHA02653 RNA helicase NPH-II; Provisional
Probab=69.20  E-value=2.5  Score=37.82  Aligned_cols=60  Identities=22%  Similarity=0.195  Sum_probs=37.2

Q ss_pred             cCCCCCCcccccCcccchHHHHhhcceeeecccceeeeeccc----------cccccceEEecCCCCCCCCC
Q psy2779          25 GLKENGEANEMAAGLVGQQAAREVSRAVTWEKSFQFERCKSH----------SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        25 GLde~g~a~~~a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~----------~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ||=+-|+.....+.-+||  .-...|+.=..+.|.-+...|-          ....|+.+|+.|+||||||.
T Consensus       125 g~~~~~n~~~~~~~~~~~--~~~~~~~~~n~~~~~~~~l~~~~~~iQ~qil~~i~~gkdvIv~A~TGSGKTt  194 (675)
T PHA02653        125 GLVEGGNALGIFSNNVGS--KKDTIGILGNPEPFSKIPLASLQPDVQLKIFEAWISRKPVVLTGGTGVGKTS  194 (675)
T ss_pred             hHhhcCceeeeeccCccc--ccccccccCCCCccccccCCchhHHHHHHHHHHHHhCCCEEEECCCCCCchh
Confidence            344567776666666777  3455666644444433222221          12368899999999999995


No 440
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=69.15  E-value=2.4  Score=32.19  Aligned_cols=21  Identities=14%  Similarity=0.052  Sum_probs=16.6

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..-.|.++.+.||+||||+-+
T Consensus        23 ~i~~Ge~~~i~G~nGsGKSTL   43 (271)
T PRK13638         23 DFSLSPVTGLVGANGCGKSTL   43 (271)
T ss_pred             EEcCCCEEEEECCCCCCHHHH
Confidence            334688999999999998643


No 441
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=69.14  E-value=2  Score=33.54  Aligned_cols=20  Identities=20%  Similarity=0.150  Sum_probs=14.9

Q ss_pred             eEEecCCCCCCCCCCceeee
Q psy2779          73 RAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        73 ~ll~~G~p~~g~~~~~~~~~   92 (101)
                      .++++|+||+|||-.-.-++
T Consensus         7 ki~ITG~PGvGKtTl~~ki~   26 (179)
T COG1618           7 KIFITGRPGVGKTTLVLKIA   26 (179)
T ss_pred             EEEEeCCCCccHHHHHHHHH
Confidence            36799999999986554443


No 442
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=69.11  E-value=2.4  Score=30.52  Aligned_cols=19  Identities=26%  Similarity=0.155  Sum_probs=15.9

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..|.++.+.|++||||+-+
T Consensus        32 ~~G~~~~i~G~nGsGKSTL   50 (207)
T cd03369          32 KAGEKIGIVGRTGAGKSTL   50 (207)
T ss_pred             CCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 443
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=69.05  E-value=2.4  Score=32.23  Aligned_cols=19  Identities=21%  Similarity=0.053  Sum_probs=15.8

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        31 ~~Ge~~~l~G~nGsGKSTL   49 (280)
T PRK13649         31 EDGSYTAFIGHTGSGKSTI   49 (280)
T ss_pred             cCCcEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 444
>PRK12608 transcription termination factor Rho; Provisional
Probab=69.03  E-value=2.4  Score=36.01  Aligned_cols=21  Identities=14%  Similarity=0.143  Sum_probs=16.7

Q ss_pred             ccceEEecCCCCCCCCCCcee
Q psy2779          70 RGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .|-..|+.|+||||||-.-.|
T Consensus       132 kGQR~LIvG~pGtGKTTLl~~  152 (380)
T PRK12608        132 KGQRGLIVAPPRAGKTVLLQQ  152 (380)
T ss_pred             CCceEEEECCCCCCHHHHHHH
Confidence            367788999999999865544


No 445
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=68.98  E-value=1.9  Score=35.32  Aligned_cols=17  Identities=12%  Similarity=0.063  Sum_probs=14.5

Q ss_pred             ceEEecCCCCCCCCCCc
Q psy2779          72 GRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~   88 (101)
                      -++|++|++||||++..
T Consensus        93 ~iIlI~G~sgsGKStlA  109 (301)
T PRK04220         93 IIILIGGASGVGTSTIA  109 (301)
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            47899999999999854


No 446
>PRK08506 replicative DNA helicase; Provisional
Probab=68.96  E-value=2.7  Score=35.48  Aligned_cols=29  Identities=10%  Similarity=0.016  Sum_probs=22.6

Q ss_pred             cccccceEEecCCCCCCCCCCceeeeeee
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNTSMIIDSW   95 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~~~~~~~~   95 (101)
                      ..-.|-.++++|+||.|||-|..-+...|
T Consensus       188 G~~~G~LivIaarpg~GKT~fal~ia~~~  216 (472)
T PRK08506        188 GFNKGDLIIIAARPSMGKTTLCLNMALKA  216 (472)
T ss_pred             CCCCCceEEEEcCCCCChHHHHHHHHHHH
Confidence            55568899999999999998876554443


No 447
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=68.87  E-value=1.6  Score=34.77  Aligned_cols=16  Identities=25%  Similarity=0.312  Sum_probs=13.5

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      ....+++.|++||||+
T Consensus        22 ~~~r~vL~G~~GsGKS   37 (309)
T PF10236_consen   22 KNNRYVLTGERGSGKS   37 (309)
T ss_pred             CceEEEEECCCCCCHH
Confidence            3567789999999996


No 448
>KOG0742|consensus
Probab=68.82  E-value=2.4  Score=38.11  Aligned_cols=17  Identities=12%  Similarity=-0.095  Sum_probs=13.8

Q ss_pred             ceEEecCCCCCCCCCCc
Q psy2779          72 GRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~   88 (101)
                      |-+|+.||||||||-|.
T Consensus       385 RNilfyGPPGTGKTm~A  401 (630)
T KOG0742|consen  385 RNILFYGPPGTGKTMFA  401 (630)
T ss_pred             hheeeeCCCCCCchHHH
Confidence            45779999999999653


No 449
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=68.73  E-value=2.7  Score=30.83  Aligned_cols=20  Identities=20%  Similarity=0.117  Sum_probs=16.0

Q ss_pred             cceEEecCCCCCCCCCCcee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~   90 (101)
                      |.++.+.||+||||+-.-..
T Consensus        28 ~~~~~i~G~NGsGKSTll~~   47 (213)
T cd03279          28 NGLFLICGPTGAGKSTILDA   47 (213)
T ss_pred             cCEEEEECCCCCCHHHHHHH
Confidence            66899999999999855433


No 450
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=68.69  E-value=2.3  Score=31.44  Aligned_cols=18  Identities=17%  Similarity=0.069  Sum_probs=15.4

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|+.+|+.|++|+||+-.
T Consensus        13 ~g~gvLi~G~sG~GKStl   30 (149)
T cd01918          13 GGIGVLITGPSGIGKSEL   30 (149)
T ss_pred             CCEEEEEEcCCCCCHHHH
Confidence            588899999999999743


No 451
>PHA02624 large T antigen; Provisional
Probab=68.66  E-value=1  Score=40.79  Aligned_cols=24  Identities=8%  Similarity=0.029  Sum_probs=19.5

Q ss_pred             cccceEEecCCCCCCCCCCceeee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      -.++.+|+.|||+||||-|+.-++
T Consensus       429 PKk~~il~~GPpnTGKTtf~~sLl  452 (647)
T PHA02624        429 PKRRYWLFKGPVNSGKTTLAAALL  452 (647)
T ss_pred             CCCeEEEEECCCCCCHHHHHHHHH
Confidence            357899999999999998875443


No 452
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=68.62  E-value=2.5  Score=31.74  Aligned_cols=21  Identities=14%  Similarity=-0.054  Sum_probs=16.9

Q ss_pred             cccceEEecCCCCCCCCCCce
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      -.|.++.+.|++|||||-+-.
T Consensus        20 ~~Gei~~l~G~nGsGKSTLl~   40 (248)
T PRK03695         20 RAGEILHLVGPNGAGKSTLLA   40 (248)
T ss_pred             cCCCEEEEECCCCCCHHHHHH
Confidence            358899999999999975433


No 453
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=68.61  E-value=2.5  Score=30.63  Aligned_cols=18  Identities=17%  Similarity=0.097  Sum_probs=15.4

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|.++.+.|++||||+-
T Consensus        24 ~~Ge~~~i~G~nGsGKSt   41 (200)
T cd03217          24 KKGEVHALMGPNGSGKST   41 (200)
T ss_pred             CCCcEEEEECCCCCCHHH
Confidence            368899999999999863


No 454
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=68.61  E-value=2.5  Score=31.27  Aligned_cols=23  Identities=26%  Similarity=0.219  Sum_probs=17.7

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|.++.+.||+||||+-+-.+
T Consensus        45 i~~Ge~~~i~G~nGsGKSTLl~~   67 (224)
T cd03220          45 VPRGERIGLIGRNGAGKSTLLRL   67 (224)
T ss_pred             EcCCCEEEEECCCCCCHHHHHHH
Confidence            33688999999999999754433


No 455
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=68.58  E-value=2.6  Score=29.80  Aligned_cols=21  Identities=24%  Similarity=0.145  Sum_probs=16.7

Q ss_pred             cccccceEEecCCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~   87 (101)
                      ..-.|-.+.+.|++||||+-+
T Consensus        22 ~i~~Ge~~~l~G~nGsGKSTL   42 (163)
T cd03216          22 SVRRGEVHALLGENGAGKSTL   42 (163)
T ss_pred             EEeCCCEEEEECCCCCCHHHH
Confidence            344688999999999998643


No 456
>PRK04132 replication factor C small subunit; Provisional
Probab=68.56  E-value=3.3  Score=38.33  Aligned_cols=37  Identities=19%  Similarity=0.157  Sum_probs=24.8

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~   85 (101)
                      .+-+|||+...+-.--.          ++++++..   +++.||||+||.
T Consensus        18 f~dIiGqe~i~~~Lk~~----------i~~~~i~h---~l~~g~~g~~~c   54 (846)
T PRK04132         18 LDDIVGQEHIVKRLKHY----------VKTGSMPH---LLFAGPPGVGKC   54 (846)
T ss_pred             HHHhcCcHHHHHHHHHH----------HHcCCCCe---EEEECCCCCCcc
Confidence            46799999998843332          23333222   569999999994


No 457
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms.  SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes.  The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge.  SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=68.51  E-value=3.8  Score=29.88  Aligned_cols=15  Identities=13%  Similarity=0.014  Sum_probs=12.8

Q ss_pred             cceEEecCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKP   85 (101)
Q Consensus        71 g~~ll~~G~p~~g~~   85 (101)
                      .+..++.||+|+||+
T Consensus        22 ~~~~~i~G~NGsGKS   36 (178)
T cd03239          22 NSFNAIVGPNGSGKS   36 (178)
T ss_pred             CceEEEECCCCCCHH
Confidence            348889999999995


No 458
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=68.47  E-value=2.5  Score=31.50  Aligned_cols=23  Identities=13%  Similarity=0.098  Sum_probs=17.7

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.|.++.+.||+||||+-+-.++
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~~l   52 (253)
T PRK14261         30 PKNRVTALIGPSGCGKSTLLRCF   52 (253)
T ss_pred             CCCcEEEEECCCCCCHHHHHHHH
Confidence            35889999999999986544444


No 459
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=68.38  E-value=2.5  Score=31.90  Aligned_cols=23  Identities=13%  Similarity=0.003  Sum_probs=17.7

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.|.++.+.|++||||+-+-.++
T Consensus        26 ~~Ge~~~i~G~nGsGKSTLl~~i   48 (258)
T PRK13548         26 RPGEVVAILGPNGAGKSTLLRAL   48 (258)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHH
Confidence            35889999999999987544433


No 460
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=68.35  E-value=2.5  Score=32.15  Aligned_cols=18  Identities=28%  Similarity=0.414  Sum_probs=15.4

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|..+.+.||+||||+-.
T Consensus        37 ~Ge~~~i~G~nGsGKSTL   54 (268)
T PRK10419         37 SGETVALLGRSGCGKSTL   54 (268)
T ss_pred             CCCEEEEECCCCCCHHHH
Confidence            588999999999998643


No 461
>PRK08840 replicative DNA helicase; Provisional
Probab=68.34  E-value=2.8  Score=35.61  Aligned_cols=26  Identities=12%  Similarity=0.056  Sum_probs=20.9

Q ss_pred             ccccccceEEecCCCCCCCCCCceee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +.+-.|..++++|+||.|||-|.-.+
T Consensus       212 ~G~~~g~LiviaarPg~GKTafalni  237 (464)
T PRK08840        212 AGLQGSDLIIVAARPSMGKTTFAMNL  237 (464)
T ss_pred             cCCCCCceEEEEeCCCCchHHHHHHH
Confidence            35667899999999999999886433


No 462
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=68.16  E-value=2.6  Score=31.35  Aligned_cols=22  Identities=14%  Similarity=0.024  Sum_probs=17.1

Q ss_pred             cccceEEecCCCCCCCCCCcee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      -.|.++.+.|++|||||-+-.+
T Consensus        45 ~~Ge~~~i~G~NGsGKSTLl~~   66 (236)
T cd03267          45 EKGEIVGFIGPNGAGKTTTLKI   66 (236)
T ss_pred             cCCCEEEEECCCCCCHHHHHHH
Confidence            3688999999999998644333


No 463
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=68.15  E-value=2.5  Score=36.43  Aligned_cols=20  Identities=15%  Similarity=0.042  Sum_probs=15.9

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .+.++++.||+|||||-...
T Consensus       222 ~~~vi~lvGptGvGKTTtaa  241 (432)
T PRK12724        222 QRKVVFFVGPTGSGKTTSIA  241 (432)
T ss_pred             CCeEEEEECCCCCCHHHHHH
Confidence            46788899999999985443


No 464
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage.  When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task.  This CD represents the nucleotide binding domain of RecF.  RecF  belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=68.14  E-value=2.7  Score=32.21  Aligned_cols=17  Identities=29%  Similarity=0.321  Sum_probs=14.5

Q ss_pred             cccceEEecCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~   85 (101)
                      |..+..++.||+|+|||
T Consensus        19 ~~~~~~~i~G~NGsGKS   35 (270)
T cd03242          19 FEPGVTVLVGENAQGKT   35 (270)
T ss_pred             cCCCeEEEECCCCCCHH
Confidence            45678899999999995


No 465
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=68.13  E-value=2.6  Score=31.35  Aligned_cols=19  Identities=16%  Similarity=-0.011  Sum_probs=15.7

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|.++.+.||+||||+-+
T Consensus        27 ~~Ge~~~i~G~nGsGKSTL   45 (241)
T PRK14250         27 EGGAIYTIVGPSGAGKSTL   45 (241)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3588999999999998643


No 466
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=68.13  E-value=2.9  Score=31.36  Aligned_cols=18  Identities=11%  Similarity=0.039  Sum_probs=15.5

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .|+++++.||+|+||+-+
T Consensus        28 ~~~~~~l~G~n~~GKstl   45 (204)
T cd03282          28 SSRFHIITGPNMSGKSTY   45 (204)
T ss_pred             CCcEEEEECCCCCCHHHH
Confidence            478999999999999753


No 467
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=68.11  E-value=3.3  Score=30.73  Aligned_cols=21  Identities=14%  Similarity=0.185  Sum_probs=16.6

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      +..|.++.+.|++||||+-.-
T Consensus        26 i~~Ge~~~i~G~nGsGKSTLl   46 (250)
T PRK14266         26 IPKNSVTALIGPSGCGKSTFI   46 (250)
T ss_pred             EcCCCEEEEECCCCCCHHHHH
Confidence            346889999999999986433


No 468
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=68.09  E-value=2.2  Score=28.64  Aligned_cols=21  Identities=14%  Similarity=-0.078  Sum_probs=16.1

Q ss_pred             ceEEecCCCCCCCCCCceeee
Q psy2779          72 GRAVAGGRTKCPKPPNTSMII   92 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~~~~~   92 (101)
                      ..+++.|++||||+-+..+.+
T Consensus         8 ~~v~v~G~~~~GKSsli~~l~   28 (169)
T cd04114           8 FKIVLIGNAGVGKTCLVRRFT   28 (169)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            457899999999987655544


No 469
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=68.02  E-value=2  Score=39.15  Aligned_cols=15  Identities=13%  Similarity=0.231  Sum_probs=12.2

Q ss_pred             ceEEecCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPP   86 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~   86 (101)
                      .-+|+.||||||||-
T Consensus       209 ~n~lLvG~pGvGKTa  223 (852)
T TIGR03345       209 NNPILTGEAGVGKTA  223 (852)
T ss_pred             CceeEECCCCCCHHH
Confidence            356799999999973


No 470
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.91  E-value=3  Score=30.99  Aligned_cols=19  Identities=16%  Similarity=0.172  Sum_probs=15.9

Q ss_pred             cccccceEEecCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKP   85 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~   85 (101)
                      ....|.++.+.||+||||+
T Consensus        26 ~i~~G~~~~i~G~nGsGKS   44 (251)
T PRK14249         26 DFPERQITAIIGPSGCGKS   44 (251)
T ss_pred             EEcCCCEEEEECCCCCCHH
Confidence            3446889999999999985


No 471
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]
Probab=67.90  E-value=1.7  Score=38.14  Aligned_cols=39  Identities=13%  Similarity=0.050  Sum_probs=29.4

Q ss_pred             cCcccchHHHHhhcceeeecccceeeeeccccccccceEEecCCCCCCCCC
Q psy2779          36 AAGLVGQQAAREVSRAVTWEKSFQFERCKSHSLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        36 a~GlVGQ~~AREAaGIVVdm~~~~~~~~~~~~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+-+|||+.-.++..-.++.           +++.- +-|++||.|+|||-
T Consensus        15 F~evvGQe~v~~~L~nal~~-----------~ri~h-AYlfsG~RGvGKTt   53 (515)
T COG2812          15 FDDVVGQEHVVKTLSNALEN-----------GRIAH-AYLFSGPRGVGKTT   53 (515)
T ss_pred             HHHhcccHHHHHHHHHHHHh-----------Ccchh-hhhhcCCCCcCchh
Confidence            45679999999988777666           33333 45689999999985


No 472
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=67.85  E-value=2.4  Score=31.56  Aligned_cols=21  Identities=10%  Similarity=0.026  Sum_probs=16.6

Q ss_pred             cceEEecCCCCCCCCCCceee
Q psy2779          71 GGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      ..++.+.|++|||||-+..++
T Consensus        33 ~~iigi~G~~GsGKTTl~~~L   53 (229)
T PRK09270         33 RTIVGIAGPPGAGKSTLAEFL   53 (229)
T ss_pred             CEEEEEECCCCCCHHHHHHHH
Confidence            568889999999998765543


No 473
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=67.70  E-value=2.6  Score=32.53  Aligned_cols=20  Identities=20%  Similarity=0.117  Sum_probs=16.2

Q ss_pred             ccceEEecCCCCCCCCCCce
Q psy2779          70 RGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~~~   89 (101)
                      .|.++.+.||+||||+-+-.
T Consensus        26 ~Ge~~~l~G~nGsGKSTLl~   45 (272)
T PRK13547         26 PGRVTALLGRNGAGKSTLLK   45 (272)
T ss_pred             CCCEEEEECCCCCCHHHHHH
Confidence            58899999999999864433


No 474
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=67.70  E-value=2.6  Score=31.66  Aligned_cols=23  Identities=13%  Similarity=0.108  Sum_probs=17.8

Q ss_pred             cccceEEecCCCCCCCCCCceee
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      -.|-++.+.||+||||+-+-.++
T Consensus        37 ~~Ge~~~i~G~nGsGKSTLl~~l   59 (260)
T PRK10744         37 AKNQVTAFIGPSGCGKSTLLRTF   59 (260)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHH
Confidence            36889999999999987554443


No 475
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=67.68  E-value=2.8  Score=34.42  Aligned_cols=20  Identities=20%  Similarity=0.463  Sum_probs=16.5

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-.|.++.+.||+|||||-
T Consensus        41 ~i~~Ge~~~llGpsGsGKST   60 (377)
T PRK11607         41 TIYKGEIFALLGASGCGKST   60 (377)
T ss_pred             EEcCCCEEEEECCCCCcHHH
Confidence            44468999999999999863


No 476
>KOG0064|consensus
Probab=67.62  E-value=2.9  Score=38.36  Aligned_cols=16  Identities=25%  Similarity=0.420  Sum_probs=13.6

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .|--||+.||+||||.
T Consensus       507 ~G~hLLItGPNGCGKS  522 (728)
T KOG0064|consen  507 PGMHLLITGPNGCGKS  522 (728)
T ss_pred             CCceEEEECCCCccHH
Confidence            4778999999999963


No 477
>PLN02748 tRNA dimethylallyltransferase
Probab=67.58  E-value=2.5  Score=36.51  Aligned_cols=17  Identities=24%  Similarity=0.063  Sum_probs=14.5

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      +.++++.|||||||+-.
T Consensus        22 ~~~i~i~GptgsGKs~l   38 (468)
T PLN02748         22 AKVVVVMGPTGSGKSKL   38 (468)
T ss_pred             CCEEEEECCCCCCHHHH
Confidence            66899999999999753


No 478
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.53  E-value=2.7  Score=31.26  Aligned_cols=20  Identities=15%  Similarity=0.290  Sum_probs=16.2

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|.++.+.|++||||+-+
T Consensus        28 i~~Ge~~~I~G~nGsGKSTL   47 (251)
T PRK14244         28 IYKREVTAFIGPSGCGKSTF   47 (251)
T ss_pred             EcCCCEEEEECCCCCCHHHH
Confidence            33588999999999998643


No 479
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=67.51  E-value=2.4  Score=32.93  Aligned_cols=17  Identities=12%  Similarity=0.067  Sum_probs=13.7

Q ss_pred             ceEEecCCCCCCCCCCc
Q psy2779          72 GRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~~~   88 (101)
                      ..+|+.|+||+|||-+.
T Consensus        13 ~~~liyG~~G~GKtt~a   29 (220)
T TIGR01618        13 NMYLIYGKPGTGKTSTI   29 (220)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            55899999999997443


No 480
>KOG1969|consensus
Probab=67.51  E-value=2.9  Score=39.20  Aligned_cols=19  Identities=11%  Similarity=-0.171  Sum_probs=16.1

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -..++|||+||||-|||-.
T Consensus       324 P~kKilLL~GppGlGKTTL  342 (877)
T KOG1969|consen  324 PPKKILLLCGPPGLGKTTL  342 (877)
T ss_pred             CccceEEeecCCCCChhHH
Confidence            3578999999999999853


No 481
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=67.45  E-value=2.6  Score=31.95  Aligned_cols=16  Identities=19%  Similarity=0.167  Sum_probs=14.4

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .|.++.+.||+||||+
T Consensus        38 ~Ge~~~i~G~NGsGKS   53 (267)
T PRK15112         38 EGQTLAIIGENGSGKS   53 (267)
T ss_pred             CCCEEEEEcCCCCCHH
Confidence            5889999999999985


No 482
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=67.40  E-value=2.7  Score=31.84  Aligned_cols=19  Identities=16%  Similarity=0.080  Sum_probs=15.8

Q ss_pred             cccceEEecCCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~   87 (101)
                      -.|-++.+.||+||||+-.
T Consensus        33 ~~Ge~~~I~G~nGsGKSTL   51 (269)
T PRK13648         33 PKGQWTSIVGHNGSGKSTI   51 (269)
T ss_pred             cCCCEEEEECCCCCCHHHH
Confidence            3688999999999998633


No 483
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.32  E-value=2.7  Score=32.01  Aligned_cols=23  Identities=22%  Similarity=0.245  Sum_probs=17.6

Q ss_pred             ccccceEEecCCCCCCCCCCcee
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNTSM   90 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~~~   90 (101)
                      .-.|.++.+.||+||||+-+-.+
T Consensus        36 i~~Ge~~~l~G~nGsGKSTLl~~   58 (269)
T PRK14259         36 IPRGKVTALIGPSGCGKSTVLRS   58 (269)
T ss_pred             EcCCCEEEEECCCCCCHHHHHHH
Confidence            34688999999999998744333


No 484
>PRK10919 ATP-dependent DNA helicase Rep; Provisional
Probab=67.19  E-value=2.6  Score=36.98  Aligned_cols=15  Identities=27%  Similarity=0.268  Sum_probs=11.1

Q ss_pred             ccceEEecCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKP   85 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~   85 (101)
                      .|.+++++| ||||||
T Consensus        15 ~g~~lV~Ag-pGSGKT   29 (672)
T PRK10919         15 TGPCLVLAG-AGSGKT   29 (672)
T ss_pred             CCCEEEEec-CCCCHH
Confidence            366666655 999997


No 485
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=67.15  E-value=2.7  Score=31.53  Aligned_cols=18  Identities=17%  Similarity=0.141  Sum_probs=15.3

Q ss_pred             cccceEEecCCCCCCCCC
Q psy2779          69 FRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~   86 (101)
                      -.|.++.+.||+||||+-
T Consensus        28 ~~Ge~~~i~G~nGsGKST   45 (262)
T PRK09984         28 HHGEMVALLGPSGSGKST   45 (262)
T ss_pred             cCCcEEEEECCCCCCHHH
Confidence            368899999999999863


No 486
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=67.10  E-value=2.8  Score=31.86  Aligned_cols=21  Identities=19%  Similarity=0.077  Sum_probs=16.6

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .-.|.++.+.||+||||+-+-
T Consensus        30 i~~Ge~~~i~G~nGsGKSTLl   50 (269)
T PRK11831         30 VPRGKITAIMGPSGIGKTTLL   50 (269)
T ss_pred             EcCCCEEEEECCCCCCHHHHH
Confidence            335889999999999986443


No 487
>PRK06749 replicative DNA helicase; Provisional
Probab=67.09  E-value=3.5  Score=34.51  Aligned_cols=26  Identities=23%  Similarity=0.208  Sum_probs=20.8

Q ss_pred             ccccccceEEecCCCCCCCCCCceee
Q psy2779          66 HSLFRGGRAVAGGRTKCPKPPNTSMI   91 (101)
Q Consensus        66 ~~~~~g~~ll~~G~p~~g~~~~~~~~   91 (101)
                      +.+-.|-.++++|+||.|||-|.-.+
T Consensus       181 ~Gl~~G~LiiIaarPgmGKTafal~i  206 (428)
T PRK06749        181 CGLQEGDFVVLGARPSMGKTAFALNV  206 (428)
T ss_pred             CCCCCCcEEEEEeCCCCCchHHHHHH
Confidence            45667889999999999999876533


No 488
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=66.71  E-value=2.8  Score=31.38  Aligned_cols=21  Identities=14%  Similarity=0.090  Sum_probs=16.4

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .-.|..+.+.||+||||+-+-
T Consensus        27 i~~Ge~~~i~G~nGsGKSTLl   47 (258)
T PRK14241         27 IEPRSVTAFIGPSGCGKSTVL   47 (258)
T ss_pred             EcCCcEEEEECCCCCCHHHHH
Confidence            336889999999999986433


No 489
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=66.68  E-value=2.9  Score=31.17  Aligned_cols=20  Identities=15%  Similarity=0.346  Sum_probs=16.3

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      ..-.|.++.+.|++||||+-
T Consensus        29 ~i~~Ge~~~i~G~nGsGKST   48 (254)
T PRK14273         29 KILKNSITALIGPSGCGKST   48 (254)
T ss_pred             EEcCCCEEEEECCCCCCHHH
Confidence            33468899999999999864


No 490
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=66.61  E-value=2.9  Score=30.96  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=16.8

Q ss_pred             cccceEEecCCCCCCCCCCce
Q psy2779          69 FRGGRAVAGGRTKCPKPPNTS   89 (101)
Q Consensus        69 ~~g~~ll~~G~p~~g~~~~~~   89 (101)
                      -.|..+.+.|++||||+-+-.
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~   51 (252)
T CHL00131         31 NKGEIHAIMGPNGSGKSTLSK   51 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHH
Confidence            358899999999999974433


No 491
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=66.45  E-value=2.7  Score=33.89  Aligned_cols=18  Identities=17%  Similarity=-0.005  Sum_probs=15.3

Q ss_pred             ccceEEecCCCCCCCCCC
Q psy2779          70 RGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        70 ~g~~ll~~G~p~~g~~~~   87 (101)
                      .+..+.+.|+.||||+=.
T Consensus        21 ~~~~~fv~G~~GtGKs~l   38 (364)
T PF05970_consen   21 EGLNFFVTGPAGTGKSFL   38 (364)
T ss_pred             CCcEEEEEcCCCCChhHH
Confidence            478899999999999744


No 492
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=66.36  E-value=2.6  Score=33.28  Aligned_cols=15  Identities=27%  Similarity=0.217  Sum_probs=12.4

Q ss_pred             ceEEecCCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKPP   86 (101)
Q Consensus        72 ~~ll~~G~p~~g~~~   86 (101)
                      .++=++||||||||-
T Consensus        14 ~~i~v~Gp~GSGKTa   28 (202)
T COG0378          14 LRIGVGGPPGSGKTA   28 (202)
T ss_pred             EEEEecCCCCcCHHH
Confidence            466789999999984


No 493
>KOG0729|consensus
Probab=66.33  E-value=3.2  Score=35.72  Aligned_cols=20  Identities=10%  Similarity=-0.090  Sum_probs=14.7

Q ss_pred             cccccceEEecCCCCCCCCC
Q psy2779          67 SLFRGGRAVAGGRTKCPKPP   86 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~   86 (101)
                      .+---+-+|+-||||||||-
T Consensus       207 gidppkgvllygppgtgktl  226 (435)
T KOG0729|consen  207 GIDPPKGVLLYGPPGTGKTL  226 (435)
T ss_pred             CCCCCCceEEeCCCCCchhH
Confidence            33344557799999999984


No 494
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=66.22  E-value=3  Score=30.98  Aligned_cols=21  Identities=14%  Similarity=0.154  Sum_probs=16.7

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ...|-++.+.|++||||+-.-
T Consensus        28 i~~Ge~~~l~G~nGsGKSTLl   48 (252)
T PRK14255         28 FNQNEITALIGPSGCGKSTYL   48 (252)
T ss_pred             EcCCCEEEEECCCCCCHHHHH
Confidence            346889999999999986443


No 495
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=66.21  E-value=3  Score=31.79  Aligned_cols=22  Identities=18%  Similarity=0.039  Sum_probs=17.2

Q ss_pred             cccccceEEecCCCCCCCCCCc
Q psy2779          67 SLFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        67 ~~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      ..-.|.++.+.||+||||+-+-
T Consensus        46 ~i~~Ge~~~l~G~nGsGKSTLl   67 (269)
T cd03294          46 DVREGEIFVIMGLSGSGKSTLL   67 (269)
T ss_pred             EEcCCCEEEEECCCCCCHHHHH
Confidence            3346889999999999986443


No 496
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=66.21  E-value=3.3  Score=30.58  Aligned_cols=17  Identities=12%  Similarity=0.040  Sum_probs=14.2

Q ss_pred             cceEEecCCCCCCCCCC
Q psy2779          71 GGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        71 g~~ll~~G~p~~g~~~~   87 (101)
                      .++.++.||+|+|||-.
T Consensus        22 ~g~~~i~G~NGsGKTTL   38 (204)
T cd03240          22 SPLTLIVGQNGAGKTTI   38 (204)
T ss_pred             CCeEEEECCCCCCHHHH
Confidence            44899999999999744


No 497
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=66.08  E-value=3.8  Score=31.63  Aligned_cols=14  Identities=14%  Similarity=0.192  Sum_probs=10.5

Q ss_pred             ceEEecCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKP   85 (101)
Q Consensus        72 ~~ll~~G~p~~g~~   85 (101)
                      .++.+.||.|||||
T Consensus        20 ~~v~~~G~AGTGKT   33 (205)
T PF02562_consen   20 DLVIVNGPAGTGKT   33 (205)
T ss_dssp             SEEEEE--TTSSTT
T ss_pred             CeEEEECCCCCcHH
Confidence            46789999999998


No 498
>PRK14087 dnaA chromosomal replication initiation protein; Provisional
Probab=66.06  E-value=2.4  Score=35.64  Aligned_cols=14  Identities=14%  Similarity=0.045  Sum_probs=12.4

Q ss_pred             ceEEecCCCCCCCC
Q psy2779          72 GRAVAGGRTKCPKP   85 (101)
Q Consensus        72 ~~ll~~G~p~~g~~   85 (101)
                      .-|++.|++|||||
T Consensus       142 npl~i~G~~G~GKT  155 (450)
T PRK14087        142 NPLFIYGESGMGKT  155 (450)
T ss_pred             CceEEECCCCCcHH
Confidence            45889999999998


No 499
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=65.94  E-value=3  Score=30.88  Aligned_cols=21  Identities=14%  Similarity=0.078  Sum_probs=16.7

Q ss_pred             ccccceEEecCCCCCCCCCCc
Q psy2779          68 LFRGGRAVAGGRTKCPKPPNT   88 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~~   88 (101)
                      .-.|.++.+.||+||||+-+-
T Consensus        26 i~~Ge~~~i~G~nGsGKSTLl   46 (249)
T PRK14253         26 IPARQVTALIGPSGCGKSTLL   46 (249)
T ss_pred             ecCCCEEEEECCCCCCHHHHH
Confidence            346889999999999986443


No 500
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=65.77  E-value=3  Score=31.71  Aligned_cols=20  Identities=20%  Similarity=0.049  Sum_probs=16.4

Q ss_pred             ccccceEEecCCCCCCCCCC
Q psy2779          68 LFRGGRAVAGGRTKCPKPPN   87 (101)
Q Consensus        68 ~~~g~~ll~~G~p~~g~~~~   87 (101)
                      .-.|..+.+.||+||||+-+
T Consensus        30 i~~Ge~~~l~G~nGsGKSTL   49 (272)
T PRK15056         30 VPGGSIAALVGVNGSGKSTL   49 (272)
T ss_pred             EcCCCEEEEECCCCCCHHHH
Confidence            33688999999999998744


Done!