RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy2788
(161 letters)
>gnl|CDD|117593 pfam09027, GTPase_binding, GTPase binding. The GTPase binding
domain binds to the G protein Cdc42, inhibiting both its
intrinsic and stimulated GTPase activity. The domain is
largely unstructured in the absence of Cdc42.
Length = 66
Score = 50.7 bits (121), Expect = 2e-09
Identities = 23/46 (50%), Positives = 28/46 (60%), Gaps = 3/46 (6%)
Query: 91 DISRPLRNSVIHTGHGDPWGKS-WGSPSHIDPMYLNNPMDPPDILG 135
DIS PL+N IHTG GD +S WG P + +YL MDPPD+
Sbjct: 7 DISVPLKNGFIHTGQGDSNPRSCWGFPDEFENLYLG--MDPPDMAY 50
>gnl|CDD|212914 cd11981, SH3_VAV3_1, First Src homology 3 domain of VAV3 protein.
VAV3 is ubiquitously expressed and functions as a
phosphorylation-dependent guanine nucleotide exchange
factor (GEF) for RhoA, RhoG, and Rac1. It has been
implicated to function in the hematopoietic, bone,
cerebellar, and cardiovascular systems. VAV3 is
essential in axon guidance in neurons that control
blood pressure and respiration. It is overexpressed in
prostate cancer cells and it plays a role in regulating
androgen receptor transcriptional activity. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The SH3 domain of VAV is involved in the
localization of proteins to specific sites within the
cell, by interacting with proline-rich sequences within
target proteins. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 62
Score = 41.8 bits (98), Expect = 4e-06
Identities = 15/41 (36%), Positives = 24/41 (58%)
Query: 43 LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
L GD I ++ DP +W+G+NL+T +G FP + + P
Sbjct: 22 LNAQIGDTIEVLYADPHSLFWQGRNLTTGELGFFPSDAVKP 62
>gnl|CDD|212765 cd11831, SH3_VAV_1, First Src homology 3 domain of VAV proteins.
VAV proteins function both as cytoplasmic guanine
nucleotide exchange factors (GEFs) for Rho GTPases and
scaffold proteins and they play important roles in cell
signaling by coupling cell surface receptors to various
effector functions. They play key roles in processes
that require cytoskeletal reorganization including
immune synapse formation, phagocytosis, cell spreading,
and platelet aggregation, among others. Vertebrates
have three VAV proteins (VAV1, VAV2, and VAV3). VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The SH3 domain of VAV is involved in the
localization of proteins to specific sites within the
cell, by interacting with proline-rich sequences within
target proteins. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 62
Score = 39.9 bits (93), Expect = 2e-05
Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)
Query: 28 MKATQNCHEI-----DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMD 82
M QN H L + GD + +++GD E WW+G+N++T +G FP + +
Sbjct: 2 MVVMQNYHGNPPPPGAGGPVLTLQTGDVVELLKGDAESPWWEGRNVATREVGYFPSSSVK 61
Query: 83 P 83
P
Sbjct: 62 P 62
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains. Src homology 3 (SH3)
domains bind to target proteins through sequences
containing proline and hydrophobic amino acids.
Pro-containing polypeptides may bind to SH3 domains in
2 different binding orientations.
Length = 56
Score = 39.4 bits (93), Expect = 3e-05
Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 2/42 (4%)
Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
+ +L GD I ++E + WWKG+ G+FP N
Sbjct: 14 QDPDELSFKKGDIITVLE-KSDDGWWKGRLGRG-KEGLFPSN 53
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily. Src Homology 3
(SH3) domains are protein interaction domains that bind
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. Thus, they
are referred to as proline-recognition domains (PRDs).
SH3 domains are less selective and show more diverse
specificity compared to other PRDs. They have been
shown to bind peptide sequences that lack the PxxP
motif; examples include the PxxDY motif of Eps8 and the
RKxxYxxY sequence in SKAP55. SH3 domain containing
proteins play versatile and diverse roles in the cell,
including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies, among others. Many members of this
superfamily are adaptor proteins that associate with a
number of protein partners, facilitating complex
formation and signal transduction.
Length = 51
Score = 37.4 bits (88), Expect = 2e-04
Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
++ +L GD I ++E D + WW+G+ G+FP N
Sbjct: 11 QDDDELSFKKGDIITVLEKDDD-GWWEGELNGG-REGLFPAN 50
>gnl|CDD|212912 cd11979, SH3_VAV1_1, First Src homology 3 domain of VAV1 protein.
VAV1 is expressed predominantly in the hematopoietic
system and it plays an important role in the
development and activation of B and T cells. It is
activated by tyrosine phosphorylation to function as a
guanine nucleotide exchange factor (GEF) for Rho
GTPases following cell surface receptor activation,
triggering various effects such as cytoskeletal
reorganization, transcription regulation, cell cycle
progression, and calcium mobilization. It also serves
as a scaffold protein and has been shown to interact
with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
gene, ZAP-70, SLP76, and Syk, among others. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The first SH3 domain of Vav1 has been shown to
bind the adaptor protein Grb2. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 63
Score = 36.5 bits (84), Expect = 4e-04
Identities = 16/41 (39%), Positives = 26/41 (63%)
Query: 43 LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
L ++ GD + + + + E +WW+G+N ST IG FP N + P
Sbjct: 22 LRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKP 62
>gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like
proteins. This subfamily includes the Saccharomyces
cerevisiae proteins BOI1 and BOI2, and similar
proteins. They contain an N-terminal SH3 domain, a
Sterile alpha motif (SAM), and a Pleckstrin homology
(PH) domain at the C-terminus. BOI1 and BOI2 interact
with the SH3 domain of Bem1p, a protein involved in bud
formation. They promote polarized cell growth and
participates in the NoCut signaling pathway, which is
involved in the control of cytokinesis. SH3 domains
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs; they play a
role in the regulation of enzymes by intramolecular
interactions, changing the subcellular localization of
signal pathway components and mediate multiprotein
complex assemblies.
Length = 55
Score = 36.2 bits (84), Expect = 6e-04
Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)
Query: 40 EGKLYIDAGDQIVIIEGDPECH--WWKGQNLSTFNIGMFPRN 79
E +L + GD+I +IE D E W+ G+NL T G+FP
Sbjct: 13 EDELTLKPGDKIELIEDDEEFGDGWYLGRNLRTGETGLFPVV 54
>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine
Kinase. Lck is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
Lck is expressed in T-cells and natural killer cells.
It plays a critical role in T-cell maturation,
activation, and T-cell receptor (TCR) signaling. Lck
phosphorylates ITAM (immunoreceptor tyr activation
motif) sequences on several subunits of TCRs, leading
to the activation of different second messenger
cascades. Phosphorylated ITAMs serve as binding sites
for other signaling factor such as Syk and ZAP-70,
leading to their activation and propagation of
downstream events. In addition, Lck regulates
drug-induced apoptosis by interfering with the
mitochondrial death pathway. The apototic role of Lck
is independent of its primary function in T-cell
signaling. Src kinases contain an N-terminal SH4 domain
with a myristoylation site, followed by SH3 and SH2
domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr. They are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
The SH3 domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 36.0 bits (83), Expect = 6e-04
Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
+E +G L + G+++ I+E E WWK Q+L+T G P N
Sbjct: 8 YEPSHDGDLGFEKGEKLRILEQSGE--WWKAQSLTTGQEGFIPFN 50
>gnl|CDD|212913 cd11980, SH3_VAV2_1, First Src homology 3 domain of VAV2 protein.
VAV2 is widely expressed and functions as a guanine
nucleotide exchange factor (GEF) for RhoA, RhoB and
RhoG and also activates Rac1 and Cdc42. It is
implicated in many cellular and physiological functions
including blood pressure control, eye development,
neurite outgrowth and branching, EGFR endocytosis and
degradation, and cell cluster morphology, among others.
It has been reported to associate with Nek3. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The SH3 domain of VAV is involved in the
localization of proteins to specific sites within the
cell, by interacting with proline-rich sequences within
target proteins. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 60
Score = 35.7 bits (82), Expect = 0.001
Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 3/59 (5%)
Query: 28 MKATQNCH-EIDEEGK--LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
M A QN H GK L GD I ++ GDP+ WW+G+ L T G FP + + P
Sbjct: 2 MVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLLQTKKSGYFPSSSVKP 60
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain. SH3 (Src homology 3) domains are
often indicative of a protein involved in signal
transduction related to cytoskeletal organisation.
First described in the Src cytoplasmic tyrosine kinase.
The structure is a partly opened beta barrel.
Length = 47
Score = 35.2 bits (82), Expect = 0.001
Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 2/39 (5%)
Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
E +L GD I+++E + WWKG+ G+ P
Sbjct: 10 EPDELSFKKGDIIIVLE-KSDDGWWKGRLK-GGKEGLIP 46
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin
and related proteins. This subfamily includes
cortactin, Abp1 (actin-binding protein 1),
hematopoietic lineage cell-specific protein 1 (HS1),
and similar proteins. These proteins are involved in
regulating actin dynamics through direct or indirect
interaction with the Arp2/3 complex, which is required
to initiate actin polymerization. They all contain at
least one C-terminal SH3 domain. Cortactin and HS1 bind
Arp2/3 and actin through an N-terminal region that
contains an acidic domain and several copies of a
repeat domain found in cortactin and HS1. Abp1 binds
actin via an N-terminal actin-depolymerizing factor
(ADF) homology domain. Yeast Abp1 binds Arp2/3 directly
through two acidic domains. Mammalian Abp1 does not
directly interact with Arp2/3; instead, it regulates
actin dynamics indirectly by interacting with dynamin
and WASP family proteins. The C-terminal region of
these proteins acts as an adaptor or scaffold that can
connect membrane trafficking and signaling proteins
that bind the SH3 domain within the actin network. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 35.0 bits (81), Expect = 0.001
Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
++ E+ ++ GD I IE E WW G N + G+FP N
Sbjct: 8 YQAAEDNEISFVEGDIITQIEQIDE-GWWLGVN-AKGQKGLFPAN 50
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth
factor receptor-bound protein 2. GRB2 is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. It is
ubiquitously expressed in all tissues throughout
development and is important in cell cycle progression,
motility, morphogenesis, and angiogenesis. In
lymphocytes, GRB2 is associated with antigen receptor
signaling components. GRB2 contains an N-terminal SH3
domain, a central SH2 domain, and a C-terminal SH3
domain. The C-terminal SH3 domain of GRB2 binds to Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, as well as to the proline-rich C-terminus
of FGRF2. SH3 domains are protein interaction domains
that typically bind to proline-rich ligands with
moderate affinity and selectivity, preferentially to
PxxP motifs. They play versatile and diverse roles in
the cell including the regulation of enzymes, changing
the subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 34.8 bits (80), Expect = 0.002
Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)
Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
E+G+L GD I +++ + + +WWKG GMFPRN + P
Sbjct: 12 EDGELGFRRGDFIEVMD-NSDPNWWKGACHG--QTGMFPRNYVTP 53
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like
Protein Tyrosine Kinases. Src subfamily members
include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, Yes,
and Brk. Src (or c-Src) proteins are cytoplasmic (or
non-receptor) PTKs which are anchored to the plasma
membrane. They contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). However,
Brk lacks the N-terminal myristoylation sites. Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. They were identified as the first
proto-oncogene products, and they regulate cell
adhesion, invasion, and motility in cancer cells, and
tumor vasculature, contributing to cancer progression
and metastasis. Src kinases are overexpressed in a
variety of human cancers, making them attractive
targets for therapy. They are also implicated in acute
inflammatory responses and osteoclast function. Src,
Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
Hck, Fgr, Lyn, and Brk show a limited expression
pattern. This subfamily also includes Drosophila
Src42A, Src oncogene at 42A (also known as Dsrc41)
which accumulates at sites of cell-cell or cell-matrix
adhesion, and participates in Drosphila development and
wound healing. It has been shown to promote tube
elongation in the tracheal system, is essential for
proper cell-cell matching during dorsal closure, and
regulates cell-cell contacts in developing Drosophila
eyes. The SH3 domain of Src kinases contributes to
substrate recruitment by binding adaptor
proteins/substrates, and regulation of kinase activity
through an intramolecular interaction. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 34.1 bits (79), Expect = 0.003
Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
+ L GD++ I++ D + WW ++LST G P N
Sbjct: 13 DDDLSFKKGDRLQILD-DSDGDWWLARHLSTGKEGYIPSN 51
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing
Adaptor Molecules. STAMs were discovered as proteins
that are highly phosphorylated following cytokine and
growth factor stimulation. They function in cytokine
signaling and surface receptor degradation, as well as
regulate Golgi morphology. They associate with many
proteins including Jak2 and Jak3 tyrosine kinases, Hrs,
AMSH, and UBPY. STAM adaptor proteins contain VHS
(Vps27, Hrs, STAM homology), ubiquitin interacting
(UIM), and SH3 domains. There are two vertebrate STAMs,
STAM1 and STAM2, which may be functionally redundant;
vertebrate STAMs contain ITAM motifs. They are part of
the endosomal sorting complex required for transport
(ESCRT-0). STAM2 deficiency in mice did not cause any
obvious abnormality, while STAM1 deficiency resulted in
growth retardation. Loss of both STAM1 and STAM2 in
mice proved lethal, indicating that STAMs are important
for embryonic development. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 33.2 bits (76), Expect = 0.006
Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
E E+ +L AG+ I +++ D + +WWKG N G+FP N
Sbjct: 10 EAAEDNELTFKAGEIITVLD-DSDPNWWKGSNHR--GEGLFPAN 50
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing
Adaptor Molecule 2. STAM2, also called EAST (Epidermal
growth factor receptor-associated protein with SH3 and
TAM domain) or Hbp (Hrs binding protein), is part of
the endosomal sorting complex required for transport
(ESCRT-0). It plays a role in sorting mono-ubiquinated
endosomal cargo for trafficking to the lysosome for
degradation. It is also involved in the regulation of
exocytosis. STAMs were discovered as proteins that are
highly phosphorylated following cytokine and growth
factor stimulation. They function in cytokine signaling
and surface receptor degradation, as well as regulate
Golgi morphology. They associate with many proteins
including Jak2 and Jak3 tyrosine kinases, Hrs, AMSH,
and UBPY. STAM adaptor proteins contain VHS (Vps27,
Hrs, STAM homology), ubiquitin interacting (UIM), and
SH3 domains. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 33.1 bits (75), Expect = 0.007
Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 3/46 (6%)
Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 81
E E+ +L G+ I++++ D + +WWKG+N +G+FP N +
Sbjct: 11 EAVEDNELTFKHGEIIIVLD-DSDANWWKGENHR--GVGLFPSNFV 53
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing
Adaptor Molecule 1. STAM1 is part of the endosomal
sorting complex required for transport (ESCRT-0) and is
involved in sorting ubiquitinated cargo proteins from
the endosome. It may also be involved in the regulation
of IL2 and GM-CSF mediated signaling, and has been
implicated in neural cell survival. STAMs were
discovered as proteins that are highly phosphorylated
following cytokine and growth factor stimulation. They
function in cytokine signaling and surface receptor
degradation, as well as regulate Golgi morphology. They
associate with many proteins including Jak2 and Jak3
tyrosine kinases, Hrs, AMSH, and UBPY. STAM adaptor
proteins contain VHS (Vps27, Hrs, STAM homology),
ubiquitin interacting (UIM), and SH3 domains. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 32.6 bits (74), Expect = 0.010
Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%)
Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 81
E E+ +L AGD I I++ D + +WWKG+ + G+FP N +
Sbjct: 10 EAAEDNELTFKAGDIITILD-DSDPNWWKGE--TPQGTGLFPSNFV 52
>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C
and Casein kinase Substrate in Neurons 1 (PACSIN1) and
PACSIN 2. PACSIN 1 or Syndapin I (Synaptic
dynamin-associated protein I) is expressed specifically
in the brain and is localized in neurites and synaptic
boutons. It binds the brain-specific proteins dynamin
I, synaptojanin, synapsin I, and neural Wiskott-Aldrich
syndrome protein (nWASP), and functions as a link
between the cytoskeletal machinery and synaptic vesicle
endocytosis. PACSIN 1 interacts with huntingtin and may
be implicated in the neuropathology of Huntington's
disease. PACSIN 2 or Syndapin II is expressed
ubiquitously and is involved in the regulation of
tubulin polymerization. It associates with Golgi
membranes and forms a complex with dynamin II which is
crucial in promoting vesicle formation from the
trans-Golgi network. PACSINs act as regulators of
cytoskeletal and membrane dynamics. Vetebrates harbor
three isoforms with distinct expression patterns and
specific functions. PACSINs contain an N-terminal F-BAR
domain and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 32.6 bits (74), Expect = 0.012
Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
++ E+ +L AGD++ +E + E W KG+ L + +G++P N ++P
Sbjct: 9 YDGQEQDELSFKAGDELTKLEDEDEQGWCKGR-LDSGQVGLYPANYVEP 56
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
GRB2-related adaptor protein. GRAP is a GRB-2 like
adaptor protein that is highly expressed in lymphoid
tissues. It acts as a negative regulator of T cell
receptor (TCR)-induced lymphocyte proliferation by
downregulating the signaling to the Ras/ERK pathway. It
has been identified as a regulator of TGFbeta signaling
in diabetic kidney tubules and may have a role in the
pathogenesis of the disease. GRAP contains an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. The C-terminal SH3 domains
(SH3c) of the related proteins, GRB2 and GRAP2, have
been shown to bind to classical PxxP motif ligands, as
well as to non-classical motifs. GRB2 SH3c binds Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, while the SH3c of GRAP2 binds to the
phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 31.3 bits (71), Expect = 0.028
Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 3/46 (6%)
Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
++ +L GD I +++ P+ +WW+G+ + +G FPRN + P
Sbjct: 11 EDPSQLSFRRGDIIEVLDC-PDPNWWRGR--ISGRVGFFPRNYVHP 53
>gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting
proteins 1 and 2, and similar domains. JNK-interacting
proteins (JIPs) function as scaffolding proteins for
c-Jun N-terminal kinase (JNK) signaling pathways. They
bind to components of Mitogen-activated protein kinase
(MAPK) pathways such as JNK, MKK, and several MAP3Ks
such as MLK and DLK. There are four JIPs (JIP1-4); all
contain a JNK binding domain. JIP1 and JIP2 also
contain SH3 and Phosphotyrosine-binding (PTB) domains.
Both are highly expressed in the brain and pancreatic
beta-cells. JIP1 functions as an adaptor linking motor
to cargo during axonal transport and also is involved
in regulating insulin secretion. JIP2 form complexes
with fibroblast growth factor homologous factors
(FHFs), which facilitates activation of the p38delta
MAPK. The SH3 domain of JIP1 homodimerizes at the
interface usually involved in proline-rich ligand
recognition, despite the lack of this motif in the
domain itself. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 30.7 bits (70), Expect = 0.045
Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
HE DE + +D GD + + + + + W +G NL T G+FP
Sbjct: 12 HE-DE---IELDIGDPVYVEQ-EADDLWCEGTNLRTGQRGIFP 49
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or
SH3C) of Intersectin-1. Intersectin-1 (ITSN1) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN1 localizes in membranous
organelles, CCPs, the Golgi complex, and may be
involved in the cell membrane trafficking system. It
exists in alternatively spliced short and long
isoforms. The short isoform contains two Eps15 homology
domains (EH1 and EH2), a coiled-coil region and five
SH3 domains (SH3A-E), while the long isoform, in
addition, contains RhoGEF (also called Dbl-homologous
or DH), Pleckstrin homology (PH) and C2 domains. The
third SH3 domain (or SH3C) of ITSN1 has been shown to
bind many proteins including dynamin1/2, CIN85, c-Cbl,
SHIP2, Reps1, synaptojanin-1, and WNK, among others.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 52
Score = 30.7 bits (69), Expect = 0.045
Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
+E +E+G L GD I++ + D + WW G G+FP N + P
Sbjct: 8 YESNEQGDLTFQQGDVILVTKKDGD--WWTGT--VGDKTGVFPSNYVRP 52
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 1, an E3 ubiquitin-protein
ligase. SH3RF1 is also called POSH (Plenty of SH3s) or
SH3MD2 (SH3 multiple domains protein 2). It is a
scaffold protein that acts as an E3 ubiquitin-protein
ligase. It plays a role in calcium homeostasis through
the control of the ubiquitin domain protein Herp. It
may also have a role in regulating death receptor
mediated and JNK mediated apoptosis. SH3RF1 also
enhances the ubiquitination of ROMK1 potassium channel
resulting in its increased endocytosis. It contains an
N-terminal RING finger domain and four SH3 domains.
This model represents the third SH3 domain, located in
the middle, of SH3RF1. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 30.7 bits (69), Expect = 0.046
Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 5/47 (10%)
Query: 39 EEGKLYIDAGDQIVIIEGDPECH--WWKGQNLSTFNIGMFPRNIMDP 83
+E +L + G+ ++ E C W+KG ++ T IG+FP N + P
Sbjct: 12 KEDELELRKGEMFLVFE---RCQDGWFKGTSMHTSKIGVFPGNYVAP 55
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C)
of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The third SH3 domain (or SH3C) of
ITSN1 has been shown to bind many proteins including
dynamin1/2, CIN85, c-Cbl, SHIP2, Reps1, synaptojanin-1,
and WNK, among others. The SH3C of ITSN2 has been shown
to bind the K15 protein of Kaposi's sarcoma-associated
herpesvirus. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 52
Score = 30.1 bits (68), Expect = 0.076
Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%)
Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
E +E G L +AGD I++ + D E WW G G+FP N + P
Sbjct: 9 ESNEPGDLTFNAGDVILVTKKDGE--WWTGTIGD--RTGIFPSNYVRP 52
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9
and similar proteins. Sorting nexins (SNXs) are Phox
homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNXs differ from each
other in their lipid-binding specificity, subcellular
localization and specific function in the endocytic
pathway. This subfamily consists of SH3 domain
containing SNXs including SNX9, SNX18, SNX33, and
similar proteins. SNX9 is localized to plasma membrane
endocytic sites and acts primarily in clathrin-mediated
endocytosis, while SNX18 is localized to peripheral
endosomal structures, and acts in a trafficking pathway
that is clathrin-independent but relies on AP-1 and
PACS1. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 29.6 bits (67), Expect = 0.11
Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Query: 41 GKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
G+L + AG+ + I D W +G+N S +G+FP
Sbjct: 14 GELSLRAGEVLTITRQDVGDGWLEGRN-SRGEVGLFP 49
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and
similar fungal proteins. This family is composed of
the Saccharomyces cerevisiae proteins, Ysc84p (also
called LAS17-binding protein 4, Lsb4p) and Lsb3p, and
similar fungal proteins. They contain an N-terminal
SYLF domain (also called DUF500) and a C-terminal SH3
domain. Ysc84p localizes to actin patches and plays an
important in actin polymerization during endocytosis.
The N-terminal domain of both Ysc84p and Lsb3p can bind
and bundle actin filaments. A study of the yeast SH3
domain interactome predicts that the SH3 domains of
Lsb3p and Lsb4p may function as molecular hubs for the
assembly of endocytic complexes. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 29.7 bits (67), Expect = 0.11
Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 3/46 (6%)
Query: 38 DEEGKLYIDAGDQIVIIE-GDPECHWWKGQNLSTFNIGMFPRNIMD 82
++ G L GD I I++ D + WW G+ G+FP N ++
Sbjct: 11 EQPGDLAFQKGDIITILKKSDSQNDWWTGR--IGGREGIFPANYVE 54
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
Growth factor receptor-bound protein 2 (GRB2) and
related proteins. This family includes the adaptor
protein GRB2 and related proteins including Drosophila
melanogaster Downstream of receptor kinase (DRK),
Caenorhabditis elegans Sex muscle abnormal protein 5
(Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
and similar proteins. Family members contain an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. GRAP2 plays
an important role in T cell receptor (TCR) signaling by
promoting the formation of the SLP-76:LAT complex,
which couples the TCR to the Ras pathway. GRAP acts as
a negative regulator of T cell receptor (TCR)-induced
lymphocyte proliferation by downregulating the
signaling to the Ras/ERK pathway. The C-terminal SH3
domains (SH3c) of GRB2 and GRAP2 have been shown to
bind to classical PxxP motif ligands, as well as to
non-classical motifs. GRB2 SH3c binds Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, while the SH3c of GRAP2 binds to the
phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 29.5 bits (67), Expect = 0.11
Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 5/46 (10%)
Query: 39 EEGKLYIDAGDQIVIIE-GDPECHWWKGQNLSTFNIGMFPRNIMDP 83
E G+L GD I +++ DP WWKG+ +G+FP N + P
Sbjct: 12 EPGELEFRRGDIITVLDSSDP--DWWKGE--LRGRVGIFPANYVQP 53
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 1 (SH3RF1), SH3RF3, and similar
domains. SH3RF1 (or POSH) and SH3RF3 (or POSH2) are
scaffold proteins that function as E3 ubiquitin-protein
ligases. They contain an N-terminal RING finger domain
and four SH3 domains. This model represents the third
SH3 domain, located in the middle of SH3RF1 and SH3RF3,
and similar domains. SH3RF1 plays a role in calcium
homeostasis through the control of the ubiquitin domain
protein Herp. It may also have a role in regulating
death receptor mediated and JNK mediated apoptosis.
SH3RF3 interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 29.3 bits (66), Expect = 0.15
Identities = 10/22 (45%), Positives = 14/22 (63%)
Query: 62 WWKGQNLSTFNIGMFPRNIMDP 83
W+KG +L T G+FP N + P
Sbjct: 34 WFKGTSLRTGQSGVFPGNYVQP 55
>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate
aminotransferase; Validated.
Length = 425
Score = 30.9 bits (71), Expect = 0.22
Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%)
Query: 22 RLTPAVMKATQNCHEIDEEGKLYID--AG 48
R P V + DE+GK YID AG
Sbjct: 19 RSFPVVFDKAKGSWLYDEDGKEYIDFFAG 47
>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein
Tyrosine Kinases. The Tec (Tyrosine kinase expressed
in hepatocellular carcinoma) subfamily is composed of
Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and
similar proteins. They are cytoplasmic (or nonreceptor)
tyr kinases containing Src homology protein interaction
domains (SH3, SH2) N-terminal to the catalytic tyr
kinase domain. Most Tec subfamily members (except Rlk)
also contain an N-terminal pleckstrin homology (PH)
domain, which binds the products of PI3K and allows
membrane recruitment and activation. In addition, some
members contain the Tec homology (TH) domain, which
contains proline-rich and zinc-binding regions. Tec
kinases are expressed mainly by haematopoietic cells,
although Tec and Bmx are also found in endothelial
cells. B-cells express Btk and Tec, while T-cells
express Itk, Txk, and Tec. Collectively, Tec kinases
are expressed in a variety of myeloid cells such as
mast cells, platelets, macrophages, and dendritic
cells. Each Tec kinase shows a distinct cell-type
pattern of expression. The function of Tec kinases in
lymphoid cells have been studied extensively. They play
important roles in the development, differentiation,
maturation, regulation, survival, and function of
B-cells and T-cells. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 28.8 bits (65), Expect = 0.24
Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
E G L ++ G++ V+++ D HWW+ ++ N G P N
Sbjct: 12 EPGDLPLEKGEEYVVLD-DSNEHWWRARD-KNGNEGYIPSN 50
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal
endocytic adaptor protein Sla1p. Sla1p facilitates
endocytosis by playing a role as an adaptor protein in
coupling components of the actin cytoskeleton to the
endocytic machinery. It interacts with Abp1p, Las17p
and Pan1p, which are activator proteins of
actin-related protein 2/3 (Arp2/3). Sla1p contains
multiple domains including three SH3 domains, a SAM
(sterile alpha motif) domain, and a Sla1 homology
domain 1 (SHD1), which binds to the NPFXD motif that is
found in many integral membrane proteins such as the
Golgi-localized Arf-binding protein Lsb5p and the
P4-ATPases, Drs2p and Dnf1p. The third SH3 domain of
Sla1p can bind ubiquitin while retaining the ability to
bind proline-rich ligands; monoubiquitination of target
proteins signals internalization and sorting through
the endocytic pathway. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 28.4 bits (64), Expect = 0.29
Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%)
Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
DE L + GD + I++ WW +N+ST G+ P + ++
Sbjct: 15 DE---LTVKEGDVVYILDDKKSKDWWMVENVSTGKEGVVPASYIEI 57
>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C
and Casein kinase Substrate in Neurons 3 (PACSIN3).
PACSIN 3 or Syndapin III (Synaptic dynamin-associated
protein III) is expressed ubiquitously and regulates
glucose uptake in adipocytes through its role in GLUT1
trafficking. It also modulates the subcellular
localization and stimulus-specific function of the
cation channel TRPV4. PACSINs act as regulators of
cytoskeletal and membrane dynamics. Vetebrates harbor
three isoforms with distinct expression patterns and
specific functions. PACSINs contain an N-terminal F-BAR
domain and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 28.4 bits (63), Expect = 0.31
Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
E +L AG++++ I + E W KG+ L + IG++P N
Sbjct: 14 EADELSFKAGEELLKIGEEDEQGWCKGR-LLSGRIGLYPAN 53
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and
similar domains. Bzz1 (or Bzz1p) is a
WASP/Las17-interacting protein involved in endocytosis
and trafficking to the vacuole. It physically interacts
with type I myosins and functions in the early steps of
endocytosis. Together with other proteins, it induces
membrane scission in yeast. Bzz1 contains an N-terminal
F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
central coiled-coil, and two C-terminal SH3 domains.
This model represents the second C-terminal SH3 domain.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 51
Score = 27.8 bits (62), Expect = 0.43
Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQ-NLSTFNIGMFPRN 79
+E + ++ I GD+I +I GD W G+ N G+FP +
Sbjct: 8 YEAQGDDEISIRVGDRIAVIRGDDGSGWTYGEINGVK---GLFPTS 50
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain
of VAV1 protein. VAV1 is expressed predominantly in
the hematopoietic system and it plays an important role
in the development and activation of B and T cells. It
is activated by tyrosine phosphorylation to function as
a guanine nucleotide exchange factor (GEF) for Rho
GTPases following cell surface receptor activation,
triggering various effects such as cytoskeletal
reorganization, transcription regulation, cell cycle
progression, and calcium mobilization. It also serves
as a scaffold protein and has been shown to interact
with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
gene, ZAP-70, SLP76, and Syk, among others. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The C-terminal SH3 domain of Vav1 interacts
with a wide variety of proteins including cytoskeletal
regulators (zyxin), RNA-binding proteins (Sam68),
transcriptional regulators, viral proteins, and dynamin
2. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 27.6 bits (61), Expect = 0.67
Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMD 82
+ +L + GD I I+ + WW+G+ +G FP N ++
Sbjct: 12 DRSELSLKEGDIIKILNKKGQQGWWRGEIYG--RVGWFPANYVE 53
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of
Dynamin Binding Protein, also called Tuba. DNMBP or
Tuba is a cdc42-specific guanine nucleotide exchange
factor (GEF) that contains four N-terminal SH3 domains,
a central RhoGEF [or Dbl homology (DH)] domain followed
by a Bin/Amphiphysin/Rvs (BAR) domain, and two
C-terminal SH3 domains. It provides a functional link
between dynamin and key regulatory proteins of the
actin cytoskeleton. It plays an important role in
regulating cell junction configuration. The four
N-terminal SH3 domains of DNMBP binds the GTPase
dynamin, which plays an important role in the fission
of endocytic vesicles. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 51
Score = 26.9 bits (60), Expect = 0.87
Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 9/46 (19%)
Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKG--QNLSTFNIGMFPRN 79
++DEE L GD +V I G + W++G G+FP
Sbjct: 11 QLDEELDLR--EGD-VVTITGILDKGWFRGELNGRR----GIFPEG 49
>gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine
Kinase. Lyn is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
Lyn is expressed in B lymphocytes and myeloid cells. It
exhibits both positive and negative regulatory roles in
B cell receptor (BCR) signaling. Lyn, as well as Fyn
and Blk, promotes B cell activation by phosphorylating
ITAMs (immunoreceptor tyr activation motifs) in CD19
and in Ig components of BCR. It negatively regulates
signaling by its unique ability to phosphorylate ITIMs
(immunoreceptor tyr inhibition motifs) in cell surface
receptors like CD22 and CD5. Lyn also plays an
important role in G-CSF receptor signaling by
phosphorylating a variety of adaptor molecules. Src
kinases contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 27.3 bits (60), Expect = 0.91
Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
E L G+++ +IE E WWK ++L+T G P N
Sbjct: 13 EDDLSFKKGEKLKVIEEHGE--WWKARSLTTKKEGFIPSN 50
>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine
Kinase. Blk is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
It is expressed specifically in B-cells and is involved
in pre-BCR (B-cell receptor) signaling. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 27.1 bits (60), Expect = 0.92
Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
E L + G+++ +++ D E WW ++L+T G P N
Sbjct: 13 ERDLQLKKGEKLQVLKSDGE--WWLAKSLTTGKEGYIPSN 50
>gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional.
Length = 443
Score = 28.8 bits (65), Expect = 1.2
Identities = 11/26 (42%), Positives = 14/26 (53%)
Query: 22 RLTPAVMKATQNCHEIDEEGKLYIDA 47
R T V A + + ID GK Y+DA
Sbjct: 10 RATLPVAVAGEGIYLIDATGKRYLDA 35
>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine
Kinase. Src (or c-Src) is a cytoplasmic (or
non-receptor) PTK and is the vertebrate homolog of the
oncogenic protein (v-Src) from Rous sarcoma virus.
Together with other Src subfamily proteins, it is
involved in signaling pathways that regulate cytokine
and growth factor responses, cytoskeleton dynamics,
cell proliferation, survival, and differentiation. Src
also play a role in regulating cell adhesion, invasion,
and motility in cancer cells, and tumor vasculature,
contributing to cancer progression and metastasis.
Elevated levels of Src kinase activity have been
reported in a variety of human cancers. Several
inhibitors of Src have been developed as anti-cancer
drugs. Src is also implicated in acute inflammatory
responses and osteoclast function. Src kinases contain
an N-terminal SH4 domain with a myristoylation site,
followed by SH3 and SH2 domains, a tyr kinase domain,
and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 27.0 bits (59), Expect = 1.2
Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
+E E L G+++ I+ + E WW +L+T G P N + P
Sbjct: 8 YESRTETDLSFKKGERLQIVN-NTEGDWWLAHSLTTGQTGYIPSNYVAP 55
>gnl|CDD|218168 pfam04602, Arabinose_trans, Mycobacterial cell wall arabinan
synthesis protein. Arabinosyltransferase is involved in
arabinogalactan (AG) biosynthesis pathway in
mycobacteria. AG is a component of the macromolecular
assembly of the mycolyl-AG-peptidoglycan complex of the
cell wall. This enzyme has important clinical
applications as it is believed to be the target of the
antimycobacterial drug Ethambutol.
Length = 1075
Score = 29.0 bits (65), Expect = 1.2
Identities = 12/28 (42%), Positives = 14/28 (50%)
Query: 96 LRNSVIHTGHGDPWGKSWGSPSHIDPMY 123
LR S I T D W + WGS DP+
Sbjct: 1021 LRASTISTYLRDDWYRDWGSLERYDPLV 1048
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk
Protein Tyrosine Kinases. Fyn and Yrk (Yes-related
kinase) are members of the Src subfamily of proteins,
which are cytoplasmic (or non-receptor) PTKs. Fyn,
together with Lck, plays a critical role in T-cell
signal transduction by phosphorylating ITAM
(immunoreceptor tyr activation motif) sequences on
T-cell receptors, ultimately leading to the
proliferation and differentiation of T-cells. In
addition, Fyn is involved in the myelination of
neurons, and is implicated in Alzheimer's and
Parkinson's diseases. Yrk has been detected only in
chickens. It is primarily found in neuronal and
epithelial cells and in macrophages. It may play a role
in inflammation and in response to injury. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 26.9 bits (59), Expect = 1.3
Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 7/52 (13%)
Query: 35 HEIDEEGKLYIDAGDQIVII---EGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
+E E L G++ I+ EGD WW+ ++L+T G P N + P
Sbjct: 9 YEARTEDDLSFHKGEKFQILNSSEGD----WWEARSLTTGETGYIPSNYVAP 56
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The fifth SH3 domain (or SH3E) of
ITSN1 has been shown to bind many protein partners
including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
N-WASP, and synaptojanin-1, among others. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 26.6 bits (59), Expect = 1.5
Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 4/36 (11%)
Query: 49 DQIVIIEGDPECHWWKGQ-NLSTFNIGMFPRNIMDP 83
I+ + + WW+G+ N T G+FP N ++P
Sbjct: 21 GDIINVLSKDDPDWWRGELNGQT---GLFPSNYVEP 53
>gnl|CDD|236720 PRK10577, PRK10577, iron-hydroxamate transporter permease subunit;
Provisional.
Length = 668
Score = 28.3 bits (64), Expect = 2.3
Identities = 7/24 (29%), Positives = 13/24 (54%), Gaps = 6/24 (25%)
Query: 126 NPMDPPDILGLTTQGSQNGGATVA 149
NP+ P++LG++ GA +
Sbjct: 424 NPLASPEVLGIS------SGAGLG 441
>gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional.
Length = 451
Score = 28.1 bits (63), Expect = 2.5
Identities = 9/30 (30%), Positives = 16/30 (53%)
Query: 23 LTPAVMKATQNCHEIDEEGKLYIDAGDQIV 52
+ P V+ + + D EG+ Y+D Q+V
Sbjct: 34 INPMVIAGAEGSYVWDYEGRRYLDFSSQLV 63
>gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting
protein 2. JNK-interacting protein 2 (JIP2) is also
called Mitogen-activated protein kinase 8-interacting
protein 2 (MAPK8IP2) or Islet-brain-2 (IB2). It is
widely expressed in the brain, where it forms complexes
with fibroblast growth factor homologous factors
(FHFs), which facilitates activation of the p38delta
MAPK. JIP2 is enriched in postsynaptic densities and
may play a role in motor and cognitive function. In
addition to a JNK binding domain, JIP2 also contains
SH3 and Phosphotyrosine-binding (PTB) domains. The SH3
domain of the related protein JIP1 homodimerizes at the
interface usually involved in proline-rich ligand
recognition, despite the lack of this motif in the
domain itself. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 25.7 bits (56), Expect = 3.5
Identities = 12/38 (31%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
E +L +D D + ++E + + +W++G N+ T G+FP
Sbjct: 13 EDELELDVDDPL-LVEAEEDDYWYRGYNMRTGERGIFP 49
>gnl|CDD|212713 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain of Insulin
Receptor tyrosine kinase Substrate p53, Brain-specific
Angiogenesis Inhibitor 1-Associated Protein 2
(BAIAP2)-Like proteins, and similar proteins. Proteins
in this family include IRSp53, BAIAP2L1, BAIAP2L2, and
similar proteins. They all contain an
Inverse-Bin/Amphiphysin/Rvs (I-BAR) or IMD domain in
addition to the SH3 domain. IRSp53, also known as
BAIAP2, is a scaffolding protein that takes part in
many signaling pathways including Cdc42-induced
filopodia formation, Rac-mediated lamellipodia
extension, and spine morphogenesis. IRSp53 exists as
multiple splicing variants that differ mainly at the
C-termini. BAIAP2L1, also called IRTKS (Insulin
Receptor Tyrosine Kinase Substrate), serves as a
substrate for the insulin receptor and binds the small
GTPase Rac. It plays a role in regulating the actin
cytoskeleton and colocalizes with F-actin, cortactin,
VASP, and vinculin. IRSp53 and IRTKS also mediate the
recruitment of effector proteins Tir and EspFu, which
regulate host cell actin reorganization, to bacterial
attachment sites. BAIAP2L2 co-localizes with clathrin
plaques but its function has not been determined. The
SH3 domains of IRSp53 and IRTKS have been shown to bind
the proline-rich C-terminus of EspFu. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 57
Score = 25.4 bits (56), Expect = 4.1
Identities = 13/43 (30%), Positives = 20/43 (46%)
Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
H E +L + GD I ++ +P W G+N + G FP
Sbjct: 9 HAAGGETQLSFEEGDVITLLGPEPRDGWHYGENERSGRRGWFP 51
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine
Kinase. Yes (or c-Yes) is a member of the Src
subfamily of proteins, which are cytoplasmic (or
non-receptor) PTKs. c-Yes kinase is the cellular
homolog of the oncogenic protein (v-Yes) encoded by the
Yamaguchi 73 and Esh sarcoma viruses. It displays
functional overlap with other Src subfamily members,
particularly Src. It also shows some unique functions
such as binding to occludins, transmembrane proteins
that regulate extracellular interactions in tight
junctions. Yes also associates with a number of
proteins in different cell types that Src does not
interact with, like JAK2 and gp130 in pre-adipocytes,
and Pyk2 in treated pulmonary vein endothelial cells.
Although the biological function of Yes remains
unclear, it appears to have a role in regulating
cell-cell interactions and vesicle trafficking in
polarized cells. Src kinases contain an N-terminal SH4
domain with a myristoylation site, followed by SH3 and
SH2 domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr. They are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
The SH3 domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 25.4 bits (55), Expect = 4.7
Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
Query: 43 LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
L G++ II + E WW+ ++++T G P N + P
Sbjct: 17 LSFKKGERFQIIN-NTEGDWWEARSIATGKNGYIPSNYVAP 56
>gnl|CDD|118162 pfam09627, PrgU, PrgU-like protein. This hypothetical protein of
125 residues is expressed in bacteria but is thought to
be plasmid in origin. It forms a six beta-strand barrel
with three accompanying alpha helices and is probably a
homo-dimer in the cell. It may be involved in
pheromone-inducible conjugation.
Length = 122
Score = 26.2 bits (57), Expect = 4.9
Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%)
Query: 32 QNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQPDD 91
+N HEID ++I + + +E DPE + +NL F + MF I P++R+ +D
Sbjct: 44 ENIHEID---TIHIIKNGKSLALEVDPEKSIFGFENLGRFEVPMF--FIETPIKREAFED 98
Query: 92 I 92
I
Sbjct: 99 I 99
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 2. SH3RF2 is also called POSHER
(POSH-eliminating RING protein) or HEPP1 (heart protein
phosphatase 1-binding protein). It acts as an
anti-apoptotic regulator of the JNK pathway by binding
to and promoting the degradation of SH3RF1 (or POSH), a
scaffold protein that is required for pro-apoptotic JNK
activation. It may also play a role in cardiac
functions together with protein phosphatase 1. SH3RF2
contains an N-terminal RING finger domain and three SH3
domains. This model represents the third SH3 domain,
located in the middle, of SH3RF2. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 25.1 bits (55), Expect = 5.1
Identities = 9/22 (40%), Positives = 14/22 (63%)
Query: 62 WWKGQNLSTFNIGMFPRNIMDP 83
W +G +L T +G+FP N + P
Sbjct: 34 WLRGLSLVTGRVGIFPSNYVSP 55
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain. SH3 (Src homology 3)
domains are often indicative of a protein involved in
signal transduction related to cytoskeletal
organisation. First described in the Src cytoplasmic
tyrosine kinase. The structure is a partly opened beta
barrel.
Length = 53
Score = 24.7 bits (55), Expect = 6.1
Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 4/54 (7%)
Query: 28 MKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 81
+ + D L + GD + +++ D WW+G+ G+ P + +
Sbjct: 2 GRVIFDYVATDPNE-LSLKKGDVVKVLDKDDN-GWWEGERGGRR--GLVPSSYV 51
>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase
expressed in hepatocellular carcinoma). Tec is a
cytoplasmic (or nonreceptor) tyr kinase containing Src
homology protein interaction domains (SH3, SH2)
N-terminal to the catalytic tyr kinase domain. It also
contains an N-terminal pleckstrin homology (PH) domain,
which binds the products of PI3K and allows membrane
recruitment and activation, and the Tec homology (TH)
domain, which contains proline-rich and zinc-binding
regions. It is more widely-expressed than other Tec
subfamily kinases. Tec is found in endothelial cells,
both B- and T-cells, and a variety of myeloid cells
including mast cells, erythroid cells, platelets,
macrophages and neutrophils. Tec is a key component of
T-cell receptor (TCR) signaling, and is important in
TCR-stimulated proliferation, IL-2 production and
phospholipase C-gamma1 activation. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 24.8 bits (54), Expect = 6.3
Identities = 9/25 (36%), Positives = 18/25 (72%), Gaps = 1/25 (4%)
Query: 43 LYIDAGDQIVIIEGDPECHWWKGQN 67
L ++ G++ VI+E + + HWWK ++
Sbjct: 17 LRLETGEEYVILEKN-DVHWWKARD 40
>gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related
aminotransferases [Amino acid transport and
metabolism].
Length = 447
Score = 26.8 bits (60), Expect = 6.9
Identities = 7/31 (22%), Positives = 12/31 (38%)
Query: 21 YRLTPAVMKATQNCHEIDEEGKLYIDAGDQI 51
P V+ + + D +G Y+D I
Sbjct: 35 RFRFPLVIVRAEGAYLYDVDGNEYLDFLSGI 65
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase.
CSK is a cytoplasmic (or nonreceptor) tyr kinase
containing the Src homology domains, SH3 and SH2,
N-terminal to the catalytic tyr kinase domain. They
negatively regulate the activity of Src kinases that
are anchored to the plasma membrane. To inhibit Src
kinases, CSK is translocated to the membrane via
binding to specific transmembrane proteins, G-proteins,
or adaptor proteins near the membrane. CSK catalyzes
the tyr phosphorylation of the regulatory C-terminal
tail of Src kinases, resulting in their inactivation.
It is expressed in a wide variety of tissues and plays
a role, as a regulator of Src, in cell proliferation,
survival, and differentiation, and consequently, in
cancer development and progression. In addition, CSK
also shows Src-independent functions. It is a critical
component in G-protein signaling, and plays a role in
cytoskeletal reorganization and cell migration. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 24.6 bits (54), Expect = 7.0
Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%)
Query: 48 GDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
GD + I+ + +W+K +N GM P N
Sbjct: 23 GDILTIVAVTKDPNWYKAKN-KDGREGMIPAN 53
>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3
domain, ankyrin repeat and PH domain containing protein
2. ASAP2 is also called DDEF2 (Development and
Differentiation Enhancing Factor 2), AMAP2, centaurin
beta-3, or PAG3. It mediates the functions of Arf
GTPases vial dual mechanisms: it exhibits GTPase
activating protein (GAP) activity towards class I
(Arf1) and II (Arf5) Arfs; and it binds class III Arfs
(GTP-Arf6) stably without GAP activity. It binds
paxillin and is implicated in Fcgamma receptor-mediated
phagocytosis in macrophages and in cell migration.
ASAP2 contains an N-terminal BAR domain, followed by a
Pleckstrin homology (PH) domain, an Arf GAP domain,
ankyrin (ANK) repeats, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 24.5 bits (53), Expect = 7.9
Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%)
Query: 28 MKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQ 66
+KA NC D +L G+ I+I++G+ + WW G
Sbjct: 2 VKALYNC-VADNPDELTFSEGE-IIIVDGEEDKEWWIGH 38
>gnl|CDD|223490 COG0413, PanB, Ketopantoate hydroxymethyltransferase [Coenzyme
metabolism].
Length = 268
Score = 26.4 bits (59), Expect = 8.2
Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 17/61 (27%)
Query: 15 TLKDCLYRLTPAVMKATQNC----------HEIDEE------GKLYIDAGDQIVIIEGDP 58
TL+D +Y T AV + N +E+ E +L +AG V +EG
Sbjct: 59 TLEDMIY-HTKAVRRGAPNAFVVADLPFGSYEVSPEQALKNAARLMKEAGADAVKLEGGE 117
Query: 59 E 59
E
Sbjct: 118 E 118
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
Phosphotransferases. Tyrosine-specific kinase subfamily.
Length = 257
Score = 26.3 bits (59), Expect = 8.3
Identities = 7/15 (46%), Positives = 10/15 (66%)
Query: 6 NPAERPKFSTLKDCL 20
+P +RP FS L + L
Sbjct: 243 DPEDRPTFSELVEIL 257
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
Kinase, Activated Cdc42-associated kinase. Protein
Tyrosine Kinase (PTK) family; Activated Cdc42-associated
kinase (Ack) subfamily; catalytic (c) domain. Ack
subfamily members include Ack1, thirty-eight-negative
kinase 1 (Tnk1), and similar proteins. The PTKc family
is part of a larger superfamily that includes the
catalytic domains of other kinases such as protein
serine/threonine kinases, RIO kinases, and
phosphoinositide 3-kinase (PI3K). PTKs catalyze the
transfer of the gamma-phosphoryl group from ATP to
tyrosine (tyr) residues in protein substrates. Ack
subfamily members are cytoplasmic (or nonreceptor) tyr
kinases containing an N-terminal catalytic domain, an
SH3 domain, a Cdc42-binding CRIB domain, and a
proline-rich region. They are mainly expressed in brain
and skeletal tissues and are involved in the regulation
of cell adhesion and growth, receptor degradation, and
axonal guidance. Ack1 is also associated with
androgen-independent prostate cancer progression. Tnk1
regulates TNFalpha signaling and may play an important
role in cell death.
Length = 257
Score = 26.2 bits (58), Expect = 9.5
Identities = 8/17 (47%), Positives = 12/17 (70%)
Query: 4 TKNPAERPKFSTLKDCL 20
NPA+RP F+ L++ L
Sbjct: 239 AHNPADRPTFAALREFL 255
>gnl|CDD|177331 PHA02004, PHA02004, capsid protein.
Length = 332
Score = 26.0 bits (57), Expect = 9.6
Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
Query: 110 GKSWGSPSHIDPMYLNNPMDPPDILGLTTQGSQNGGATV-AHRS--TERRKRKM 160
+ +P+H++P + + ++ + GLT + N V AHR KR +
Sbjct: 137 AAAMDAPAHLEPAFSDGVLEKATLTGLTAKAEANADKIVRAHRRGVETLIKRDL 190
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.317 0.135 0.433
Gapped
Lambda K H
0.267 0.0813 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 8,324,229
Number of extensions: 750816
Number of successful extensions: 717
Number of sequences better than 10.0: 1
Number of HSP's gapped: 716
Number of HSP's successfully gapped: 65
Length of query: 161
Length of database: 10,937,602
Length adjustment: 89
Effective length of query: 72
Effective length of database: 6,990,096
Effective search space: 503286912
Effective search space used: 503286912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (24.8 bits)