RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy2788
         (161 letters)



>gnl|CDD|117593 pfam09027, GTPase_binding, GTPase binding.  The GTPase binding
           domain binds to the G protein Cdc42, inhibiting both its
           intrinsic and stimulated GTPase activity. The domain is
           largely unstructured in the absence of Cdc42.
          Length = 66

 Score = 50.7 bits (121), Expect = 2e-09
 Identities = 23/46 (50%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 91  DISRPLRNSVIHTGHGDPWGKS-WGSPSHIDPMYLNNPMDPPDILG 135
           DIS PL+N  IHTG GD   +S WG P   + +YL   MDPPD+  
Sbjct: 7   DISVPLKNGFIHTGQGDSNPRSCWGFPDEFENLYLG--MDPPDMAY 50


>gnl|CDD|212914 cd11981, SH3_VAV3_1, First Src homology 3 domain of VAV3 protein.
           VAV3 is ubiquitously expressed and functions as a
          phosphorylation-dependent guanine nucleotide exchange
          factor (GEF) for RhoA, RhoG, and Rac1. It has been
          implicated to function in the hematopoietic, bone,
          cerebellar, and cardiovascular systems. VAV3 is
          essential in axon guidance in neurons that control
          blood pressure and respiration. It is overexpressed in
          prostate cancer cells and it plays a role in regulating
          androgen receptor transcriptional activity. VAV
          proteins contain several domains that enable their
          function: N-terminal calponin homology (CH), acidic,
          RhoGEF (also called Dbl-homologous or DH), Pleckstrin
          Homology (PH), C1 (zinc finger), SH2, and two SH3
          domains. The SH3 domain of VAV is involved in the
          localization of proteins to specific sites within the
          cell, by interacting with proline-rich sequences within
          target proteins. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 62

 Score = 41.8 bits (98), Expect = 4e-06
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 43 LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          L    GD I ++  DP   +W+G+NL+T  +G FP + + P
Sbjct: 22 LNAQIGDTIEVLYADPHSLFWQGRNLTTGELGFFPSDAVKP 62


>gnl|CDD|212765 cd11831, SH3_VAV_1, First Src homology 3 domain of VAV proteins. 
          VAV proteins function both as cytoplasmic guanine
          nucleotide exchange factors (GEFs) for Rho GTPases and
          scaffold proteins and they play important roles in cell
          signaling by coupling cell surface receptors to various
          effector functions. They play key roles in processes
          that require cytoskeletal reorganization including
          immune synapse formation, phagocytosis, cell spreading,
          and platelet aggregation, among others. Vertebrates
          have three VAV proteins (VAV1, VAV2, and VAV3). VAV
          proteins contain several domains that enable their
          function: N-terminal calponin homology (CH), acidic,
          RhoGEF (also called Dbl-homologous or DH), Pleckstrin
          Homology (PH), C1 (zinc finger), SH2, and two SH3
          domains. The SH3 domain of VAV is involved in the
          localization of proteins to specific sites within the
          cell, by interacting with proline-rich sequences within
          target proteins. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 62

 Score = 39.9 bits (93), Expect = 2e-05
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 28 MKATQNCHEI-----DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMD 82
          M   QN H            L +  GD + +++GD E  WW+G+N++T  +G FP + + 
Sbjct: 2  MVVMQNYHGNPPPPGAGGPVLTLQTGDVVELLKGDAESPWWEGRNVATREVGYFPSSSVK 61

Query: 83 P 83
          P
Sbjct: 62 P 62


>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains.  Src homology 3 (SH3)
          domains bind to target proteins through sequences
          containing proline and hydrophobic amino acids.
          Pro-containing polypeptides may bind to SH3 domains in
          2 different binding orientations.
          Length = 56

 Score = 39.4 bits (93), Expect = 3e-05
 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 2/42 (4%)

Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
           +  +L    GD I ++E   +  WWKG+       G+FP N
Sbjct: 14 QDPDELSFKKGDIITVLE-KSDDGWWKGRLGRG-KEGLFPSN 53


>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily.  Src Homology 3
          (SH3) domains are protein interaction domains that bind
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. Thus, they
          are referred to as proline-recognition domains (PRDs).
          SH3 domains are less selective and show more diverse
          specificity compared to other PRDs. They have been
          shown to bind peptide sequences that lack the PxxP
          motif; examples include the PxxDY motif of Eps8 and the
          RKxxYxxY sequence in SKAP55. SH3 domain containing
          proteins play versatile and diverse roles in the cell,
          including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies, among others. Many members of this
          superfamily are adaptor proteins that associate with a
          number of protein partners, facilitating complex
          formation and signal transduction.
          Length = 51

 Score = 37.4 bits (88), Expect = 2e-04
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
           ++ +L    GD I ++E D +  WW+G+       G+FP N
Sbjct: 11 QDDDELSFKKGDIITVLEKDDD-GWWEGELNGG-REGLFPAN 50


>gnl|CDD|212912 cd11979, SH3_VAV1_1, First Src homology 3 domain of VAV1 protein.
           VAV1 is expressed predominantly in the hematopoietic
          system and it plays an important role in the
          development and activation of B and T cells. It is
          activated by tyrosine phosphorylation to function as a
          guanine nucleotide exchange factor (GEF) for Rho
          GTPases following cell surface receptor activation,
          triggering various effects such as cytoskeletal
          reorganization, transcription regulation, cell cycle
          progression, and calcium mobilization. It also serves
          as a scaffold protein and has been shown to interact
          with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
          gene, ZAP-70, SLP76, and Syk, among others. VAV
          proteins contain several domains that enable their
          function: N-terminal calponin homology (CH), acidic,
          RhoGEF (also called Dbl-homologous or DH), Pleckstrin
          Homology (PH), C1 (zinc finger), SH2, and two SH3
          domains. The first SH3 domain of Vav1 has been shown to
          bind the adaptor protein Grb2. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 63

 Score = 36.5 bits (84), Expect = 4e-04
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 43 LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          L ++ GD + + + + E +WW+G+N ST  IG FP N + P
Sbjct: 22 LRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKP 62


>gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like
          proteins.  This subfamily includes the Saccharomyces
          cerevisiae proteins BOI1 and BOI2, and similar
          proteins. They contain an N-terminal SH3 domain, a
          Sterile alpha motif (SAM), and a Pleckstrin homology
          (PH) domain at the C-terminus. BOI1 and BOI2 interact
          with the SH3 domain of Bem1p, a protein involved in bud
          formation. They promote polarized cell growth and
          participates in the NoCut signaling pathway, which is
          involved in the control of cytokinesis. SH3 domains
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs; they play a
          role in the regulation of enzymes by intramolecular
          interactions, changing the subcellular localization of
          signal pathway components and mediate multiprotein
          complex assemblies.
          Length = 55

 Score = 36.2 bits (84), Expect = 6e-04
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 40 EGKLYIDAGDQIVIIEGDPECH--WWKGQNLSTFNIGMFPRN 79
          E +L +  GD+I +IE D E    W+ G+NL T   G+FP  
Sbjct: 13 EDELTLKPGDKIELIEDDEEFGDGWYLGRNLRTGETGLFPVV 54


>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine
          Kinase.  Lck is a member of the Src subfamily of
          proteins, which are cytoplasmic (or non-receptor) PTKs.
          Lck is expressed in T-cells and natural killer cells.
          It plays a critical role in T-cell maturation,
          activation, and T-cell receptor (TCR) signaling. Lck
          phosphorylates ITAM (immunoreceptor tyr activation
          motif) sequences on several subunits of TCRs, leading
          to the activation of different second messenger
          cascades. Phosphorylated ITAMs serve as binding sites
          for other signaling factor such as Syk and ZAP-70,
          leading to their activation and propagation of
          downstream events. In addition, Lck regulates
          drug-induced apoptosis by interfering with the
          mitochondrial death pathway. The apototic role of Lck
          is independent of its primary function in T-cell
          signaling. Src kinases contain an N-terminal SH4 domain
          with a myristoylation site, followed by SH3 and SH2
          domains, a tyr kinase domain, and a regulatory
          C-terminal region containing a conserved tyr. They are
          activated by autophosphorylation at the tyr kinase
          domain, but are negatively regulated by phosphorylation
          at the C-terminal tyr by Csk (C-terminal Src Kinase).
          The SH3 domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 36.0 bits (83), Expect = 6e-04
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          +E   +G L  + G+++ I+E   E  WWK Q+L+T   G  P N
Sbjct: 8  YEPSHDGDLGFEKGEKLRILEQSGE--WWKAQSLTTGQEGFIPFN 50


>gnl|CDD|212913 cd11980, SH3_VAV2_1, First Src homology 3 domain of VAV2 protein.
           VAV2 is widely expressed and functions as a guanine
          nucleotide exchange factor (GEF) for RhoA, RhoB and
          RhoG and also activates Rac1 and Cdc42. It is
          implicated in many cellular and physiological functions
          including blood pressure control, eye development,
          neurite outgrowth and branching, EGFR endocytosis and
          degradation, and cell cluster morphology, among others.
          It has been reported to associate with Nek3. VAV
          proteins contain several domains that enable their
          function: N-terminal calponin homology (CH), acidic,
          RhoGEF (also called Dbl-homologous or DH), Pleckstrin
          Homology (PH), C1 (zinc finger), SH2, and two SH3
          domains. The SH3 domain of VAV is involved in the
          localization of proteins to specific sites within the
          cell, by interacting with proline-rich sequences within
          target proteins. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 60

 Score = 35.7 bits (82), Expect = 0.001
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 28 MKATQNCH-EIDEEGK--LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          M A QN H      GK  L    GD I ++ GDP+  WW+G+ L T   G FP + + P
Sbjct: 2  MVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLLQTKKSGYFPSSSVKP 60


>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain.  SH3 (Src homology 3) domains are
          often indicative of a protein involved in signal
          transduction related to cytoskeletal organisation.
          First described in the Src cytoplasmic tyrosine kinase.
          The structure is a partly opened beta barrel.
          Length = 47

 Score = 35.2 bits (82), Expect = 0.001
 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 2/39 (5%)

Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
          E  +L    GD I+++E   +  WWKG+       G+ P
Sbjct: 10 EPDELSFKKGDIIIVLE-KSDDGWWKGRLK-GGKEGLIP 46


>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin
          and related proteins.  This subfamily includes
          cortactin, Abp1 (actin-binding protein 1),
          hematopoietic lineage cell-specific protein 1 (HS1),
          and similar proteins. These proteins are involved in
          regulating actin dynamics through direct or indirect
          interaction with the Arp2/3 complex, which is required
          to initiate actin polymerization. They all contain at
          least one C-terminal SH3 domain. Cortactin and HS1 bind
          Arp2/3 and actin through an N-terminal region that
          contains an acidic domain and several copies of a
          repeat domain found in cortactin and HS1. Abp1 binds
          actin via an N-terminal actin-depolymerizing factor
          (ADF) homology domain. Yeast Abp1 binds Arp2/3 directly
          through two acidic domains. Mammalian Abp1 does not
          directly interact with Arp2/3; instead, it regulates
          actin dynamics indirectly by interacting with dynamin
          and WASP family proteins. The C-terminal region of
          these proteins acts as an adaptor or scaffold that can
          connect membrane trafficking and signaling proteins
          that bind the SH3 domain within the actin network. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 35.0 bits (81), Expect = 0.001
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          ++  E+ ++    GD I  IE   E  WW G N +    G+FP N
Sbjct: 8  YQAAEDNEISFVEGDIITQIEQIDE-GWWLGVN-AKGQKGLFPAN 50


>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth
          factor receptor-bound protein 2.  GRB2 is a critical
          signaling molecule that regulates the Ras pathway by
          linking tyrosine kinases to the Ras guanine nucleotide
          releasing protein Sos (son of sevenless), which
          converts Ras to the active GTP-bound state. It is
          ubiquitously expressed in all tissues throughout
          development and is important in cell cycle progression,
          motility, morphogenesis, and angiogenesis. In
          lymphocytes, GRB2 is associated with antigen receptor
          signaling components. GRB2 contains an N-terminal SH3
          domain, a central SH2 domain, and a C-terminal SH3
          domain. The C-terminal SH3 domain of GRB2 binds to Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, as well as to the proline-rich C-terminus
          of FGRF2. SH3 domains are protein interaction domains
          that typically bind to proline-rich ligands with
          moderate affinity and selectivity, preferentially to
          PxxP motifs. They play versatile and diverse roles in
          the cell including the regulation of enzymes, changing
          the subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 34.8 bits (80), Expect = 0.002
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          E+G+L    GD I +++ + + +WWKG        GMFPRN + P
Sbjct: 12 EDGELGFRRGDFIEVMD-NSDPNWWKGACHG--QTGMFPRNYVTP 53


>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like
          Protein Tyrosine Kinases.  Src subfamily members
          include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, Yes,
          and Brk. Src (or c-Src) proteins are cytoplasmic (or
          non-receptor) PTKs which are anchored to the plasma
          membrane. They contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). However,
          Brk lacks the N-terminal myristoylation sites. Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. They were identified as the first
          proto-oncogene products, and they regulate cell
          adhesion, invasion, and motility in cancer cells, and
          tumor vasculature, contributing to cancer progression
          and metastasis. Src kinases are overexpressed in a
          variety of human cancers, making them attractive
          targets for therapy. They are also implicated in acute
          inflammatory responses and osteoclast function. Src,
          Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
          Hck, Fgr, Lyn, and Brk show a limited expression
          pattern. This subfamily also includes Drosophila
          Src42A, Src oncogene at 42A (also known as Dsrc41)
          which accumulates at sites of cell-cell or cell-matrix
          adhesion, and participates in Drosphila development and
          wound healing. It has been shown to promote tube
          elongation in the tracheal system, is essential for
          proper cell-cell matching during dorsal closure, and
          regulates cell-cell contacts in developing Drosophila
          eyes. The SH3 domain of Src kinases contributes to
          substrate recruitment by binding adaptor
          proteins/substrates, and regulation of kinase activity
          through an intramolecular interaction. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 52

 Score = 34.1 bits (79), Expect = 0.003
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          +  L    GD++ I++ D +  WW  ++LST   G  P N
Sbjct: 13 DDDLSFKKGDRLQILD-DSDGDWWLARHLSTGKEGYIPSN 51


>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing
          Adaptor Molecules.  STAMs were discovered as proteins
          that are highly phosphorylated following cytokine and
          growth factor stimulation. They function in cytokine
          signaling and surface receptor degradation, as well as
          regulate Golgi morphology. They associate with many
          proteins including Jak2 and Jak3 tyrosine kinases, Hrs,
          AMSH, and UBPY. STAM adaptor proteins contain VHS
          (Vps27, Hrs, STAM homology), ubiquitin interacting
          (UIM), and SH3 domains. There are two vertebrate STAMs,
          STAM1 and STAM2, which may be functionally redundant;
          vertebrate STAMs contain ITAM motifs. They are part of
          the endosomal sorting complex required for transport
          (ESCRT-0). STAM2 deficiency in mice did not cause any
          obvious abnormality, while STAM1 deficiency resulted in
          growth retardation. Loss of both STAM1 and STAM2 in
          mice proved lethal, indicating that STAMs are important
          for embryonic development. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 33.2 bits (76), Expect = 0.006
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          E  E+ +L   AG+ I +++ D + +WWKG N      G+FP N
Sbjct: 10 EAAEDNELTFKAGEIITVLD-DSDPNWWKGSNHR--GEGLFPAN 50


>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing
          Adaptor Molecule 2.  STAM2, also called EAST (Epidermal
          growth factor receptor-associated protein with SH3 and
          TAM domain) or Hbp (Hrs binding protein), is part of
          the endosomal sorting complex required for transport
          (ESCRT-0). It plays a role in sorting mono-ubiquinated
          endosomal cargo for trafficking to the lysosome for
          degradation. It is also involved in the regulation of
          exocytosis. STAMs were discovered as proteins that are
          highly phosphorylated following cytokine and growth
          factor stimulation. They function in cytokine signaling
          and surface receptor degradation, as well as regulate
          Golgi morphology. They associate with many proteins
          including Jak2 and Jak3 tyrosine kinases, Hrs, AMSH,
          and UBPY. STAM adaptor proteins contain VHS (Vps27,
          Hrs, STAM homology), ubiquitin interacting (UIM), and
          SH3 domains. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 57

 Score = 33.1 bits (75), Expect = 0.007
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 81
          E  E+ +L    G+ I++++ D + +WWKG+N     +G+FP N +
Sbjct: 11 EAVEDNELTFKHGEIIIVLD-DSDANWWKGENHR--GVGLFPSNFV 53


>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing
          Adaptor Molecule 1.  STAM1 is part of the endosomal
          sorting complex required for transport (ESCRT-0) and is
          involved in sorting ubiquitinated cargo proteins from
          the endosome. It may also be involved in the regulation
          of IL2 and GM-CSF mediated signaling, and has been
          implicated in neural cell survival. STAMs were
          discovered as proteins that are highly phosphorylated
          following cytokine and growth factor stimulation. They
          function in cytokine signaling and surface receptor
          degradation, as well as regulate Golgi morphology. They
          associate with many proteins including Jak2 and Jak3
          tyrosine kinases, Hrs, AMSH, and UBPY. STAM adaptor
          proteins contain VHS (Vps27, Hrs, STAM homology),
          ubiquitin interacting (UIM), and SH3 domains. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 32.6 bits (74), Expect = 0.010
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 81
          E  E+ +L   AGD I I++ D + +WWKG+  +    G+FP N +
Sbjct: 10 EAAEDNELTFKAGDIITILD-DSDPNWWKGE--TPQGTGLFPSNFV 52


>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C
          and Casein kinase Substrate in Neurons 1 (PACSIN1) and
          PACSIN 2.  PACSIN 1 or Syndapin I (Synaptic
          dynamin-associated protein I) is expressed specifically
          in the brain and is localized in neurites and synaptic
          boutons. It binds the brain-specific proteins dynamin
          I, synaptojanin, synapsin I, and neural Wiskott-Aldrich
          syndrome protein (nWASP), and functions as a link
          between the cytoskeletal machinery and synaptic vesicle
          endocytosis. PACSIN 1 interacts with huntingtin and may
          be implicated in the neuropathology of Huntington's
          disease. PACSIN 2 or Syndapin II is expressed
          ubiquitously and is involved in the regulation of
          tubulin polymerization. It associates with Golgi
          membranes and forms a complex with dynamin II which is
          crucial in promoting vesicle formation from the
          trans-Golgi network. PACSINs act as regulators of
          cytoskeletal and membrane dynamics. Vetebrates harbor
          three isoforms with distinct expression patterns and
          specific functions. PACSINs contain an N-terminal F-BAR
          domain and a C-terminal SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 56

 Score = 32.6 bits (74), Expect = 0.012
 Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          ++  E+ +L   AGD++  +E + E  W KG+ L +  +G++P N ++P
Sbjct: 9  YDGQEQDELSFKAGDELTKLEDEDEQGWCKGR-LDSGQVGLYPANYVEP 56


>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
          GRB2-related adaptor protein.  GRAP is a GRB-2 like
          adaptor protein that is highly expressed in lymphoid
          tissues. It acts as a negative regulator of T cell
          receptor (TCR)-induced lymphocyte proliferation by
          downregulating the signaling to the Ras/ERK pathway. It
          has been identified as a regulator of TGFbeta signaling
          in diabetic kidney tubules and may have a role in the
          pathogenesis of the disease. GRAP contains an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. The C-terminal SH3 domains
          (SH3c) of the related proteins, GRB2 and GRAP2, have
          been shown to bind to classical PxxP motif ligands, as
          well as to non-classical motifs. GRB2 SH3c binds Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, while the SH3c of GRAP2 binds to the
          phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 31.3 bits (71), Expect = 0.028
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          ++  +L    GD I +++  P+ +WW+G+   +  +G FPRN + P
Sbjct: 11 EDPSQLSFRRGDIIEVLDC-PDPNWWRGR--ISGRVGFFPRNYVHP 53


>gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting
          proteins 1 and 2, and similar domains.  JNK-interacting
          proteins (JIPs) function as scaffolding proteins for
          c-Jun N-terminal kinase (JNK) signaling pathways. They
          bind to components of Mitogen-activated protein kinase
          (MAPK) pathways such as JNK, MKK, and several MAP3Ks
          such as MLK and DLK. There are four JIPs (JIP1-4); all
          contain a JNK binding domain. JIP1 and JIP2 also
          contain SH3 and Phosphotyrosine-binding (PTB) domains.
          Both are highly expressed in the brain and pancreatic
          beta-cells. JIP1 functions as an adaptor linking motor
          to cargo during axonal transport and also is involved
          in regulating insulin secretion. JIP2 form complexes
          with fibroblast growth factor homologous factors
          (FHFs), which facilitates activation of the p38delta
          MAPK. The SH3 domain of JIP1 homodimerizes at the
          interface usually involved in proline-rich ligand
          recognition, despite the lack of this motif in the
          domain itself. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 30.7 bits (70), Expect = 0.045
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
          HE DE   + +D GD + + + + +  W +G NL T   G+FP
Sbjct: 12 HE-DE---IELDIGDPVYVEQ-EADDLWCEGTNLRTGQRGIFP 49


>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or
          SH3C) of Intersectin-1.  Intersectin-1 (ITSN1) is an
          adaptor protein that functions in exo- and endocytosis,
          actin cytoskeletal reorganization, and signal
          transduction. It plays a role in clathrin-coated pit
          (CCP) formation. It binds to many proteins through its
          multidomain structure and facilitate the assembly of
          multimeric complexes. ITSN1 localizes in membranous
          organelles, CCPs, the Golgi complex, and may be
          involved in the cell membrane trafficking system. It
          exists in alternatively spliced short and long
          isoforms. The short isoform contains two Eps15 homology
          domains (EH1 and EH2), a coiled-coil region and five
          SH3 domains (SH3A-E), while the long isoform, in
          addition, contains RhoGEF (also called Dbl-homologous
          or DH), Pleckstrin homology (PH) and C2 domains. The
          third SH3 domain (or SH3C) of ITSN1 has been shown to
          bind many proteins including dynamin1/2, CIN85, c-Cbl,
          SHIP2, Reps1, synaptojanin-1, and WNK, among others.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 52

 Score = 30.7 bits (69), Expect = 0.045
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          +E +E+G L    GD I++ + D +  WW G        G+FP N + P
Sbjct: 8  YESNEQGDLTFQQGDVILVTKKDGD--WWTGT--VGDKTGVFPSNYVRP 52


>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain
          containing ring finger 1, an E3 ubiquitin-protein
          ligase.  SH3RF1 is also called POSH (Plenty of SH3s) or
          SH3MD2 (SH3 multiple domains protein 2). It is a
          scaffold protein that acts as an E3 ubiquitin-protein
          ligase. It plays a role in calcium homeostasis through
          the control of the ubiquitin domain protein Herp. It
          may also have a role in regulating death receptor
          mediated and JNK mediated apoptosis. SH3RF1 also
          enhances the ubiquitination of ROMK1 potassium channel
          resulting in its increased endocytosis. It contains an
          N-terminal RING finger domain and four SH3 domains.
          This model represents the third SH3 domain, located in
          the middle, of SH3RF1. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 30.7 bits (69), Expect = 0.046
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 39 EEGKLYIDAGDQIVIIEGDPECH--WWKGQNLSTFNIGMFPRNIMDP 83
          +E +L +  G+  ++ E    C   W+KG ++ T  IG+FP N + P
Sbjct: 12 KEDELELRKGEMFLVFE---RCQDGWFKGTSMHTSKIGVFPGNYVAP 55


>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C)
          of Intersectin.  Intersectins (ITSNs) are adaptor
          proteins that function in exo- and endocytosis, actin
          cytoskeletal reorganization, and signal transduction.
          They are essential for initiating clathrin-coated pit
          formation. They bind to many proteins through their
          multidomain structure and facilitate the assembly of
          multimeric complexes. Vertebrates contain two ITSN
          proteins, ITSN1 and ITSN2, which exist in alternatively
          spliced short and long isoforms. The short isoforms
          contain two Eps15 homology domains (EH1 and EH2), a
          coiled-coil region and five SH3 domains (SH3A-E), while
          the long isoforms, in addition, contain RhoGEF (also
          called Dbl-homologous or DH), Pleckstrin homology (PH)
          and C2 domains. ITSN1 and ITSN2 are both widely
          expressed, with variations depending on tissue type and
          stage of development. The third SH3 domain (or SH3C) of
          ITSN1 has been shown to bind many proteins including
          dynamin1/2, CIN85, c-Cbl, SHIP2, Reps1, synaptojanin-1,
          and WNK, among others. The SH3C of ITSN2 has been shown
          to bind the K15 protein of Kaposi's sarcoma-associated
          herpesvirus. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 52

 Score = 30.1 bits (68), Expect = 0.076
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          E +E G L  +AGD I++ + D E  WW G        G+FP N + P
Sbjct: 9  ESNEPGDLTFNAGDVILVTKKDGE--WWTGTIGD--RTGIFPSNYVRP 52


>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9
          and similar proteins.  Sorting nexins (SNXs) are Phox
          homology (PX) domain containing proteins that are
          involved in regulating membrane traffic and protein
          sorting in the endosomal system. SNXs differ from each
          other in their lipid-binding specificity, subcellular
          localization and specific function in the endocytic
          pathway. This subfamily consists of SH3 domain
          containing SNXs including SNX9, SNX18, SNX33, and
          similar proteins. SNX9 is localized to plasma membrane
          endocytic sites and acts primarily in clathrin-mediated
          endocytosis, while SNX18 is localized to peripheral
          endosomal structures, and acts in a trafficking pathway
          that is clathrin-independent but relies on AP-1 and
          PACS1. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 29.6 bits (67), Expect = 0.11
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 41 GKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
          G+L + AG+ + I   D    W +G+N S   +G+FP
Sbjct: 14 GELSLRAGEVLTITRQDVGDGWLEGRN-SRGEVGLFP 49


>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and
          similar fungal proteins.  This family is composed of
          the Saccharomyces cerevisiae proteins, Ysc84p (also
          called LAS17-binding protein 4, Lsb4p) and Lsb3p, and
          similar fungal proteins. They contain an N-terminal
          SYLF domain (also called DUF500) and a C-terminal SH3
          domain. Ysc84p localizes to actin patches and plays an
          important in actin polymerization during endocytosis.
          The N-terminal domain of both Ysc84p and Lsb3p can bind
          and bundle actin filaments. A study of the yeast SH3
          domain interactome predicts that the SH3 domains of
          Lsb3p and Lsb4p may function as molecular hubs for the
          assembly of endocytic complexes. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 55

 Score = 29.7 bits (67), Expect = 0.11
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 38 DEEGKLYIDAGDQIVIIE-GDPECHWWKGQNLSTFNIGMFPRNIMD 82
          ++ G L    GD I I++  D +  WW G+       G+FP N ++
Sbjct: 11 EQPGDLAFQKGDIITILKKSDSQNDWWTGR--IGGREGIFPANYVE 54


>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
          Growth factor receptor-bound protein 2 (GRB2) and
          related proteins.  This family includes the adaptor
          protein GRB2 and related proteins including Drosophila
          melanogaster Downstream of receptor kinase (DRK),
          Caenorhabditis elegans Sex muscle abnormal protein 5
          (Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
          and similar proteins. Family members contain an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
          signaling molecule that regulates the Ras pathway by
          linking tyrosine kinases to the Ras guanine nucleotide
          releasing protein Sos (son of sevenless), which
          converts Ras to the active GTP-bound state. GRAP2 plays
          an important role in T cell receptor (TCR) signaling by
          promoting the formation of the SLP-76:LAT complex,
          which couples the TCR to the Ras pathway. GRAP acts as
          a negative regulator of T cell receptor (TCR)-induced
          lymphocyte proliferation by downregulating the
          signaling to the Ras/ERK pathway. The C-terminal SH3
          domains (SH3c) of GRB2 and GRAP2 have been shown to
          bind to classical PxxP motif ligands, as well as to
          non-classical motifs. GRB2 SH3c binds Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, while the SH3c of GRAP2 binds to the
          phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 29.5 bits (67), Expect = 0.11
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 39 EEGKLYIDAGDQIVIIE-GDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          E G+L    GD I +++  DP   WWKG+      +G+FP N + P
Sbjct: 12 EPGELEFRRGDIITVLDSSDP--DWWKGE--LRGRVGIFPANYVQP 53


>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain
          containing ring finger 1 (SH3RF1), SH3RF3, and similar
          domains.  SH3RF1 (or POSH) and SH3RF3 (or POSH2) are
          scaffold proteins that function as E3 ubiquitin-protein
          ligases. They contain an N-terminal RING finger domain
          and four SH3 domains. This model represents the third
          SH3 domain, located in the middle of SH3RF1 and SH3RF3,
          and similar domains. SH3RF1 plays a role in calcium
          homeostasis through the control of the ubiquitin domain
          protein Herp. It may also have a role in regulating
          death receptor mediated and JNK mediated apoptosis.
          SH3RF3 interacts with p21-activated kinase 2 (PAK2) and
          GTP-loaded Rac1. It may play a role in regulating JNK
          mediated apoptosis in certain conditions. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 29.3 bits (66), Expect = 0.15
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 62 WWKGQNLSTFNIGMFPRNIMDP 83
          W+KG +L T   G+FP N + P
Sbjct: 34 WFKGTSLRTGQSGVFPGNYVQP 55


>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate
          aminotransferase; Validated.
          Length = 425

 Score = 30.9 bits (71), Expect = 0.22
 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%)

Query: 22 RLTPAVMKATQNCHEIDEEGKLYID--AG 48
          R  P V    +     DE+GK YID  AG
Sbjct: 19 RSFPVVFDKAKGSWLYDEDGKEYIDFFAG 47


>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein
          Tyrosine Kinases.  The Tec (Tyrosine kinase expressed
          in hepatocellular carcinoma) subfamily is composed of
          Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and
          similar proteins. They are cytoplasmic (or nonreceptor)
          tyr kinases containing Src homology protein interaction
          domains (SH3, SH2) N-terminal to the catalytic tyr
          kinase domain. Most Tec subfamily members (except Rlk)
          also contain an N-terminal pleckstrin homology (PH)
          domain, which binds the products of PI3K and allows
          membrane recruitment and activation. In addition, some
          members contain the Tec homology (TH) domain, which
          contains proline-rich and zinc-binding regions. Tec
          kinases are expressed mainly by haematopoietic cells,
          although Tec and Bmx are also found in endothelial
          cells. B-cells express Btk and Tec, while T-cells
          express Itk, Txk, and Tec. Collectively, Tec kinases
          are expressed in a variety of myeloid cells such as
          mast cells, platelets, macrophages, and dendritic
          cells. Each Tec kinase shows a distinct cell-type
          pattern of expression. The function of Tec kinases in
          lymphoid cells have been studied extensively. They play
          important roles in the development, differentiation,
          maturation, regulation, survival, and function of
          B-cells and T-cells. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 28.8 bits (65), Expect = 0.24
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          E G L ++ G++ V+++ D   HWW+ ++    N G  P N
Sbjct: 12 EPGDLPLEKGEEYVVLD-DSNEHWWRARD-KNGNEGYIPSN 50


>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal
          endocytic adaptor protein Sla1p.  Sla1p facilitates
          endocytosis by playing a role as an adaptor protein in
          coupling components of the actin cytoskeleton to the
          endocytic machinery. It interacts with Abp1p, Las17p
          and Pan1p, which are activator proteins of
          actin-related protein 2/3 (Arp2/3). Sla1p contains
          multiple domains including three SH3 domains, a SAM
          (sterile alpha motif) domain, and a Sla1 homology
          domain 1 (SHD1), which binds to the NPFXD motif that is
          found in many integral membrane proteins such as the
          Golgi-localized Arf-binding protein Lsb5p and the
          P4-ATPases, Drs2p and Dnf1p. The third SH3 domain of
          Sla1p can bind ubiquitin while retaining the ability to
          bind proline-rich ligands; monoubiquitination of target
          proteins signals internalization and sorting through
          the endocytic pathway. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 28.4 bits (64), Expect = 0.29
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 38 DEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          DE   L +  GD + I++      WW  +N+ST   G+ P + ++ 
Sbjct: 15 DE---LTVKEGDVVYILDDKKSKDWWMVENVSTGKEGVVPASYIEI 57


>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C
          and Casein kinase Substrate in Neurons 3 (PACSIN3).
          PACSIN 3 or Syndapin III (Synaptic dynamin-associated
          protein III) is expressed ubiquitously and regulates
          glucose uptake in adipocytes through its role in GLUT1
          trafficking. It also modulates the subcellular
          localization and stimulus-specific function of the
          cation channel TRPV4. PACSINs act as regulators of
          cytoskeletal and membrane dynamics. Vetebrates harbor
          three isoforms with distinct expression patterns and
          specific functions. PACSINs contain an N-terminal F-BAR
          domain and a C-terminal SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 56

 Score = 28.4 bits (63), Expect = 0.31
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          E  +L   AG++++ I  + E  W KG+ L +  IG++P N
Sbjct: 14 EADELSFKAGEELLKIGEEDEQGWCKGR-LLSGRIGLYPAN 53


>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and
          similar domains.  Bzz1 (or Bzz1p) is a
          WASP/Las17-interacting protein involved in endocytosis
          and trafficking to the vacuole. It physically interacts
          with type I myosins and functions in the early steps of
          endocytosis. Together with other proteins, it induces
          membrane scission in yeast. Bzz1 contains an N-terminal
          F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
          central coiled-coil, and two C-terminal SH3 domains.
          This model represents the second C-terminal SH3 domain.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 51

 Score = 27.8 bits (62), Expect = 0.43
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQ-NLSTFNIGMFPRN 79
          +E   + ++ I  GD+I +I GD    W  G+ N      G+FP +
Sbjct: 8  YEAQGDDEISIRVGDRIAVIRGDDGSGWTYGEINGVK---GLFPTS 50


>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain
          of VAV1 protein.  VAV1 is expressed predominantly in
          the hematopoietic system and it plays an important role
          in the development and activation of B and T cells. It
          is activated by tyrosine phosphorylation to function as
          a guanine nucleotide exchange factor (GEF) for Rho
          GTPases following cell surface receptor activation,
          triggering various effects such as cytoskeletal
          reorganization, transcription regulation, cell cycle
          progression, and calcium mobilization. It also serves
          as a scaffold protein and has been shown to interact
          with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
          gene, ZAP-70, SLP76, and Syk, among others. VAV
          proteins contain several domains that enable their
          function: N-terminal calponin homology (CH), acidic,
          RhoGEF (also called Dbl-homologous or DH), Pleckstrin
          Homology (PH), C1 (zinc finger), SH2, and two SH3
          domains. The C-terminal SH3 domain of Vav1 interacts
          with a wide variety of proteins including cytoskeletal
          regulators (zyxin), RNA-binding proteins (Sam68),
          transcriptional regulators, viral proteins, and dynamin
          2. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 27.6 bits (61), Expect = 0.67
 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 39 EEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMD 82
          +  +L +  GD I I+    +  WW+G+      +G FP N ++
Sbjct: 12 DRSELSLKEGDIIKILNKKGQQGWWRGEIYG--RVGWFPANYVE 53


>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of
          Dynamin Binding Protein, also called Tuba.  DNMBP or
          Tuba is a cdc42-specific guanine nucleotide exchange
          factor (GEF) that contains four N-terminal SH3 domains,
          a central RhoGEF [or Dbl homology (DH)] domain followed
          by a Bin/Amphiphysin/Rvs (BAR) domain, and two
          C-terminal SH3 domains. It provides a functional link
          between dynamin and key regulatory proteins of the
          actin cytoskeleton. It plays an important role in
          regulating cell junction configuration. The four
          N-terminal SH3 domains of DNMBP binds the GTPase
          dynamin, which plays an important role in the fission
          of endocytic vesicles. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 51

 Score = 26.9 bits (60), Expect = 0.87
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 9/46 (19%)

Query: 36 EIDEEGKLYIDAGDQIVIIEGDPECHWWKG--QNLSTFNIGMFPRN 79
          ++DEE  L    GD +V I G  +  W++G          G+FP  
Sbjct: 11 QLDEELDLR--EGD-VVTITGILDKGWFRGELNGRR----GIFPEG 49


>gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine
          Kinase.  Lyn is a member of the Src subfamily of
          proteins, which are cytoplasmic (or non-receptor) PTKs.
          Lyn is expressed in B lymphocytes and myeloid cells. It
          exhibits both positive and negative regulatory roles in
          B cell receptor (BCR) signaling. Lyn, as well as Fyn
          and Blk, promotes B cell activation by phosphorylating
          ITAMs (immunoreceptor tyr activation motifs) in CD19
          and in Ig components of BCR. It negatively regulates
          signaling by its unique ability to phosphorylate ITIMs
          (immunoreceptor tyr inhibition motifs) in cell surface
          receptors like CD22 and CD5. Lyn also plays an
          important role in G-CSF receptor signaling by
          phosphorylating a variety of adaptor molecules. Src
          kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 27.3 bits (60), Expect = 0.91
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          E  L    G+++ +IE   E  WWK ++L+T   G  P N
Sbjct: 13 EDDLSFKKGEKLKVIEEHGE--WWKARSLTTKKEGFIPSN 50


>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine
          Kinase.  Blk is a member of the Src subfamily of
          proteins, which are cytoplasmic (or non-receptor) PTKs.
          It is expressed specifically in B-cells and is involved
          in pre-BCR (B-cell receptor) signaling. Src kinases
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 27.1 bits (60), Expect = 0.92
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          E  L +  G+++ +++ D E  WW  ++L+T   G  P N
Sbjct: 13 ERDLQLKKGEKLQVLKSDGE--WWLAKSLTTGKEGYIPSN 50


>gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional.
          Length = 443

 Score = 28.8 bits (65), Expect = 1.2
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 22 RLTPAVMKATQNCHEIDEEGKLYIDA 47
          R T  V  A +  + ID  GK Y+DA
Sbjct: 10 RATLPVAVAGEGIYLIDATGKRYLDA 35


>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine
          Kinase.  Src (or c-Src) is a cytoplasmic (or
          non-receptor) PTK and is the vertebrate homolog of the
          oncogenic protein (v-Src) from Rous sarcoma virus.
          Together with other Src subfamily proteins, it is
          involved in signaling pathways that regulate cytokine
          and growth factor responses, cytoskeleton dynamics,
          cell proliferation, survival, and differentiation. Src
          also play a role in regulating cell adhesion, invasion,
          and motility in cancer cells, and tumor vasculature,
          contributing to cancer progression and metastasis.
          Elevated levels of Src kinase activity have been
          reported in a variety of human cancers. Several
          inhibitors of Src have been developed as anti-cancer
          drugs. Src is also implicated in acute inflammatory
          responses and osteoclast function. Src kinases contain
          an N-terminal SH4 domain with a myristoylation site,
          followed by SH3 and SH2 domains, a tyr kinase domain,
          and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 27.0 bits (59), Expect = 1.2
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          +E   E  L    G+++ I+  + E  WW   +L+T   G  P N + P
Sbjct: 8  YESRTETDLSFKKGERLQIVN-NTEGDWWLAHSLTTGQTGYIPSNYVAP 55


>gnl|CDD|218168 pfam04602, Arabinose_trans, Mycobacterial cell wall arabinan
            synthesis protein.  Arabinosyltransferase is involved in
            arabinogalactan (AG) biosynthesis pathway in
            mycobacteria. AG is a component of the macromolecular
            assembly of the mycolyl-AG-peptidoglycan complex of the
            cell wall. This enzyme has important clinical
            applications as it is believed to be the target of the
            antimycobacterial drug Ethambutol.
          Length = 1075

 Score = 29.0 bits (65), Expect = 1.2
 Identities = 12/28 (42%), Positives = 14/28 (50%)

Query: 96   LRNSVIHTGHGDPWGKSWGSPSHIDPMY 123
            LR S I T   D W + WGS    DP+ 
Sbjct: 1021 LRASTISTYLRDDWYRDWGSLERYDPLV 1048


>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk
          Protein Tyrosine Kinases.  Fyn and Yrk (Yes-related
          kinase) are members of the Src subfamily of proteins,
          which are cytoplasmic (or non-receptor) PTKs. Fyn,
          together with Lck, plays a critical role in T-cell
          signal transduction by phosphorylating ITAM
          (immunoreceptor tyr activation motif) sequences on
          T-cell receptors, ultimately leading to the
          proliferation and differentiation of T-cells. In
          addition, Fyn is involved in the myelination of
          neurons, and is implicated in Alzheimer's and
          Parkinson's diseases. Yrk has been detected only in
          chickens. It is primarily found in neuronal and
          epithelial cells and in macrophages. It may play a role
          in inflammation and in response to injury. Src kinases
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 26.9 bits (59), Expect = 1.3
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 35 HEIDEEGKLYIDAGDQIVII---EGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          +E   E  L    G++  I+   EGD    WW+ ++L+T   G  P N + P
Sbjct: 9  YEARTEDDLSFHKGEKFQILNSSEGD----WWEARSLTTGETGYIPSNYVAP 56


>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
          of Intersectin.  Intersectins (ITSNs) are adaptor
          proteins that function in exo- and endocytosis, actin
          cytoskeletal reorganization, and signal transduction.
          They are essential for initiating clathrin-coated pit
          formation. They bind to many proteins through their
          multidomain structure and facilitate the assembly of
          multimeric complexes. Vertebrates contain two ITSN
          proteins, ITSN1 and ITSN2, which exist in alternatively
          spliced short and long isoforms. The short isoforms
          contain two Eps15 homology domains (EH1 and EH2), a
          coiled-coil region and five SH3 domains (SH3A-E), while
          the long isoforms, in addition, contain RhoGEF (also
          called Dbl-homologous or DH), Pleckstrin homology (PH)
          and C2 domains. ITSN1 and ITSN2 are both widely
          expressed, with variations depending on tissue type and
          stage of development. The fifth SH3 domain (or SH3E) of
          ITSN1 has been shown to bind many protein partners
          including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
          N-WASP, and synaptojanin-1, among others. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 26.6 bits (59), Expect = 1.5
 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 49 DQIVIIEGDPECHWWKGQ-NLSTFNIGMFPRNIMDP 83
            I+ +    +  WW+G+ N  T   G+FP N ++P
Sbjct: 21 GDIINVLSKDDPDWWRGELNGQT---GLFPSNYVEP 53


>gnl|CDD|236720 PRK10577, PRK10577, iron-hydroxamate transporter permease subunit;
           Provisional.
          Length = 668

 Score = 28.3 bits (64), Expect = 2.3
 Identities = 7/24 (29%), Positives = 13/24 (54%), Gaps = 6/24 (25%)

Query: 126 NPMDPPDILGLTTQGSQNGGATVA 149
           NP+  P++LG++       GA + 
Sbjct: 424 NPLASPEVLGIS------SGAGLG 441


>gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional.
          Length = 451

 Score = 28.1 bits (63), Expect = 2.5
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 23 LTPAVMKATQNCHEIDEEGKLYIDAGDQIV 52
          + P V+   +  +  D EG+ Y+D   Q+V
Sbjct: 34 INPMVIAGAEGSYVWDYEGRRYLDFSSQLV 63


>gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting
          protein 2.  JNK-interacting protein 2 (JIP2) is also
          called Mitogen-activated protein kinase 8-interacting
          protein 2 (MAPK8IP2) or Islet-brain-2 (IB2). It is
          widely expressed in the brain, where it forms complexes
          with fibroblast growth factor homologous factors
          (FHFs), which facilitates activation of the p38delta
          MAPK. JIP2 is enriched in postsynaptic densities and
          may play a role in motor and cognitive function. In
          addition to a JNK binding domain, JIP2 also contains
          SH3 and Phosphotyrosine-binding (PTB) domains. The SH3
          domain of the related protein JIP1 homodimerizes at the
          interface usually involved in proline-rich ligand
          recognition, despite the lack of this motif in the
          domain itself. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 25.7 bits (56), Expect = 3.5
 Identities = 12/38 (31%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 40 EGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
          E +L +D  D + ++E + + +W++G N+ T   G+FP
Sbjct: 13 EDELELDVDDPL-LVEAEEDDYWYRGYNMRTGERGIFP 49


>gnl|CDD|212713 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain of Insulin
          Receptor tyrosine kinase Substrate p53, Brain-specific
          Angiogenesis Inhibitor 1-Associated Protein 2
          (BAIAP2)-Like proteins, and similar proteins.  Proteins
          in this family include IRSp53, BAIAP2L1, BAIAP2L2, and
          similar proteins. They all contain an
          Inverse-Bin/Amphiphysin/Rvs (I-BAR) or IMD domain in
          addition to the SH3 domain. IRSp53, also known as
          BAIAP2, is a scaffolding protein that takes part in
          many signaling pathways including Cdc42-induced
          filopodia formation, Rac-mediated lamellipodia
          extension, and spine morphogenesis. IRSp53 exists as
          multiple splicing variants that differ mainly at the
          C-termini. BAIAP2L1, also called IRTKS (Insulin
          Receptor Tyrosine Kinase Substrate), serves as a
          substrate for the insulin receptor and binds the small
          GTPase Rac. It plays a role in regulating the actin
          cytoskeleton and colocalizes with F-actin, cortactin,
          VASP, and vinculin. IRSp53 and IRTKS also mediate the
          recruitment of effector proteins Tir and EspFu, which
          regulate host cell actin reorganization, to bacterial
          attachment sites. BAIAP2L2 co-localizes with clathrin
          plaques but its function has not been determined. The
          SH3 domains of IRSp53 and IRTKS have been shown to bind
          the proline-rich C-terminus of EspFu. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 57

 Score = 25.4 bits (56), Expect = 4.1
 Identities = 13/43 (30%), Positives = 20/43 (46%)

Query: 35 HEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFP 77
          H    E +L  + GD I ++  +P   W  G+N  +   G FP
Sbjct: 9  HAAGGETQLSFEEGDVITLLGPEPRDGWHYGENERSGRRGWFP 51


>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine
          Kinase.  Yes (or c-Yes) is a member of the Src
          subfamily of proteins, which are cytoplasmic (or
          non-receptor) PTKs. c-Yes kinase is the cellular
          homolog of the oncogenic protein (v-Yes) encoded by the
          Yamaguchi 73 and Esh sarcoma viruses. It displays
          functional overlap with other Src subfamily members,
          particularly Src. It also shows some unique functions
          such as binding to occludins, transmembrane proteins
          that regulate extracellular interactions in tight
          junctions. Yes also associates with a number of
          proteins in different cell types that Src does not
          interact with, like JAK2 and gp130 in pre-adipocytes,
          and Pyk2 in treated pulmonary vein endothelial cells.
          Although the biological function of Yes remains
          unclear, it appears to have a role in regulating
          cell-cell interactions and vesicle trafficking in
          polarized cells. Src kinases contain an N-terminal SH4
          domain with a myristoylation site, followed by SH3 and
          SH2 domains, a tyr kinase domain, and a regulatory
          C-terminal region containing a conserved tyr. They are
          activated by autophosphorylation at the tyr kinase
          domain, but are negatively regulated by phosphorylation
          at the C-terminal tyr by Csk (C-terminal Src Kinase).
          The SH3 domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 58

 Score = 25.4 bits (55), Expect = 4.7
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 43 LYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDP 83
          L    G++  II  + E  WW+ ++++T   G  P N + P
Sbjct: 17 LSFKKGERFQIIN-NTEGDWWEARSIATGKNGYIPSNYVAP 56


>gnl|CDD|118162 pfam09627, PrgU, PrgU-like protein.  This hypothetical protein of
          125 residues is expressed in bacteria but is thought to
          be plasmid in origin. It forms a six beta-strand barrel
          with three accompanying alpha helices and is probably a
          homo-dimer in the cell. It may be involved in
          pheromone-inducible conjugation.
          Length = 122

 Score = 26.2 bits (57), Expect = 4.9
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 32 QNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIMDPMRRKQPDD 91
          +N HEID    ++I    + + +E DPE   +  +NL  F + MF   I  P++R+  +D
Sbjct: 44 ENIHEID---TIHIIKNGKSLALEVDPEKSIFGFENLGRFEVPMF--FIETPIKREAFED 98

Query: 92 I 92
          I
Sbjct: 99 I 99


>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain
          containing ring finger 2.  SH3RF2 is also called POSHER
          (POSH-eliminating RING protein) or HEPP1 (heart protein
          phosphatase 1-binding protein). It acts as an
          anti-apoptotic regulator of the JNK pathway by binding
          to and promoting the degradation of SH3RF1 (or POSH), a
          scaffold protein that is required for pro-apoptotic JNK
          activation. It may also play a role in cardiac
          functions together with protein phosphatase 1. SH3RF2
          contains an N-terminal RING finger domain and three SH3
          domains. This model represents the third SH3 domain,
          located in the middle, of SH3RF2. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 55

 Score = 25.1 bits (55), Expect = 5.1
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 62 WWKGQNLSTFNIGMFPRNIMDP 83
          W +G +L T  +G+FP N + P
Sbjct: 34 WLRGLSLVTGRVGIFPSNYVSP 55


>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain.  SH3 (Src homology 3)
          domains are often indicative of a protein involved in
          signal transduction related to cytoskeletal
          organisation. First described in the Src cytoplasmic
          tyrosine kinase. The structure is a partly opened beta
          barrel.
          Length = 53

 Score = 24.7 bits (55), Expect = 6.1
 Identities = 10/54 (18%), Positives = 22/54 (40%), Gaps = 4/54 (7%)

Query: 28 MKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQNLSTFNIGMFPRNIM 81
           +   +    D    L +  GD + +++ D    WW+G+       G+ P + +
Sbjct: 2  GRVIFDYVATDPNE-LSLKKGDVVKVLDKDDN-GWWEGERGGRR--GLVPSSYV 51


>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase
          expressed in hepatocellular carcinoma).  Tec is a
          cytoplasmic (or nonreceptor) tyr kinase containing Src
          homology protein interaction domains (SH3, SH2)
          N-terminal to the catalytic tyr kinase domain. It also
          contains an N-terminal pleckstrin homology (PH) domain,
          which binds the products of PI3K and allows membrane
          recruitment and activation, and the Tec homology (TH)
          domain, which contains proline-rich and zinc-binding
          regions. It is more widely-expressed than other Tec
          subfamily kinases. Tec is found in endothelial cells,
          both B- and T-cells, and a variety of myeloid cells
          including mast cells, erythroid cells, platelets,
          macrophages and neutrophils. Tec is a key component of
          T-cell receptor (TCR) signaling, and is important in
          TCR-stimulated proliferation, IL-2 production and
          phospholipase C-gamma1 activation. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 56

 Score = 24.8 bits (54), Expect = 6.3
 Identities = 9/25 (36%), Positives = 18/25 (72%), Gaps = 1/25 (4%)

Query: 43 LYIDAGDQIVIIEGDPECHWWKGQN 67
          L ++ G++ VI+E + + HWWK ++
Sbjct: 17 LRLETGEEYVILEKN-DVHWWKARD 40


>gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related
          aminotransferases [Amino acid transport and
          metabolism].
          Length = 447

 Score = 26.8 bits (60), Expect = 6.9
 Identities = 7/31 (22%), Positives = 12/31 (38%)

Query: 21 YRLTPAVMKATQNCHEIDEEGKLYIDAGDQI 51
              P V+   +  +  D +G  Y+D    I
Sbjct: 35 RFRFPLVIVRAEGAYLYDVDGNEYLDFLSGI 65


>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase.
           CSK is a cytoplasmic (or nonreceptor) tyr kinase
          containing the Src homology domains, SH3 and SH2,
          N-terminal to the catalytic tyr kinase domain. They
          negatively regulate the activity of Src kinases that
          are anchored to the plasma membrane. To inhibit Src
          kinases, CSK is translocated to the membrane via
          binding to specific transmembrane proteins, G-proteins,
          or adaptor proteins near the membrane. CSK catalyzes
          the tyr phosphorylation of the regulatory C-terminal
          tail of Src kinases, resulting in their inactivation.
          It is expressed in a wide variety of tissues and plays
          a role, as a regulator of Src, in cell proliferation,
          survival, and differentiation, and consequently, in
          cancer development and progression. In addition, CSK
          also shows Src-independent functions. It is a critical
          component in G-protein signaling, and plays a role in
          cytoskeletal reorganization and cell migration. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 24.6 bits (54), Expect = 7.0
 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%)

Query: 48 GDQIVIIEGDPECHWWKGQNLSTFNIGMFPRN 79
          GD + I+    + +W+K +N      GM P N
Sbjct: 23 GDILTIVAVTKDPNWYKAKN-KDGREGMIPAN 53


>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3
          domain, ankyrin repeat and PH domain containing protein
          2.  ASAP2 is also called DDEF2 (Development and
          Differentiation Enhancing Factor 2), AMAP2, centaurin
          beta-3, or PAG3. It mediates the functions of Arf
          GTPases vial dual mechanisms: it exhibits GTPase
          activating protein (GAP) activity towards class I
          (Arf1) and II (Arf5) Arfs; and it binds class III Arfs
          (GTP-Arf6) stably without GAP activity. It binds
          paxillin and is implicated in Fcgamma receptor-mediated
          phagocytosis in macrophages and in cell migration.
          ASAP2 contains an N-terminal BAR domain, followed by a
          Pleckstrin homology (PH) domain, an Arf GAP domain,
          ankyrin (ANK) repeats, and a C-terminal SH3 domain. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 56

 Score = 24.5 bits (53), Expect = 7.9
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 28 MKATQNCHEIDEEGKLYIDAGDQIVIIEGDPECHWWKGQ 66
          +KA  NC   D   +L    G+ I+I++G+ +  WW G 
Sbjct: 2  VKALYNC-VADNPDELTFSEGE-IIIVDGEEDKEWWIGH 38


>gnl|CDD|223490 COG0413, PanB, Ketopantoate hydroxymethyltransferase [Coenzyme
           metabolism].
          Length = 268

 Score = 26.4 bits (59), Expect = 8.2
 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 17/61 (27%)

Query: 15  TLKDCLYRLTPAVMKATQNC----------HEIDEE------GKLYIDAGDQIVIIEGDP 58
           TL+D +Y  T AV +   N           +E+  E       +L  +AG   V +EG  
Sbjct: 59  TLEDMIY-HTKAVRRGAPNAFVVADLPFGSYEVSPEQALKNAARLMKEAGADAVKLEGGE 117

Query: 59  E 59
           E
Sbjct: 118 E 118


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
           Phosphotransferases. Tyrosine-specific kinase subfamily.
          Length = 257

 Score = 26.3 bits (59), Expect = 8.3
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 6   NPAERPKFSTLKDCL 20
           +P +RP FS L + L
Sbjct: 243 DPEDRPTFSELVEIL 257


>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
           Kinase, Activated Cdc42-associated kinase.  Protein
           Tyrosine Kinase (PTK) family; Activated Cdc42-associated
           kinase (Ack) subfamily; catalytic (c) domain. Ack
           subfamily members include Ack1, thirty-eight-negative
           kinase 1 (Tnk1), and similar proteins. The PTKc family
           is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Ack
           subfamily members are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal catalytic domain, an
           SH3 domain, a Cdc42-binding CRIB domain, and a
           proline-rich region. They are mainly expressed in brain
           and skeletal tissues and are involved in the regulation
           of cell adhesion and growth, receptor degradation, and
           axonal guidance. Ack1 is also associated with
           androgen-independent  prostate cancer progression. Tnk1
           regulates TNFalpha signaling and may play an important
           role in cell death.
          Length = 257

 Score = 26.2 bits (58), Expect = 9.5
 Identities = 8/17 (47%), Positives = 12/17 (70%)

Query: 4   TKNPAERPKFSTLKDCL 20
             NPA+RP F+ L++ L
Sbjct: 239 AHNPADRPTFAALREFL 255


>gnl|CDD|177331 PHA02004, PHA02004, capsid protein.
          Length = 332

 Score = 26.0 bits (57), Expect = 9.6
 Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 110 GKSWGSPSHIDPMYLNNPMDPPDILGLTTQGSQNGGATV-AHRS--TERRKRKM 160
             +  +P+H++P + +  ++   + GLT +   N    V AHR       KR +
Sbjct: 137 AAAMDAPAHLEPAFSDGVLEKATLTGLTAKAEANADKIVRAHRRGVETLIKRDL 190


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.317    0.135    0.433 

Gapped
Lambda     K      H
   0.267   0.0813    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 8,324,229
Number of extensions: 750816
Number of successful extensions: 717
Number of sequences better than 10.0: 1
Number of HSP's gapped: 716
Number of HSP's successfully gapped: 65
Length of query: 161
Length of database: 10,937,602
Length adjustment: 89
Effective length of query: 72
Effective length of database: 6,990,096
Effective search space: 503286912
Effective search space used: 503286912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (24.8 bits)