Diaphorina citri psyllid: psy2801


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MIQNVFFVSVCNQFSRGVFSMLGAVSPDSFDTFHSYSNTFQMPFITPWFPEKVLAPSSGFLDYAISMRPDYHQAIIDTVKYYGWKNIIYMYDSHDEMFYEGSPEFLRVFCHEKLNISVWNRNLCNI
ccccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHcccccccECcccccccccccccccccEEECcccHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHccccEEEEEEEEEcccc
**QNVFFVSVCNQFSRGVFSMLGAVSPDSFDTFHSYSNTFQMPFITPWFPEKVLAPSSGFLDYAISMRPDYHQAIIDTVKYYGWKNIIYMYDSHDEMFYEGSPEFLRVFCHEKLNISVWNRNLC**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQNVFFVSVCNQFSRGVFSMLGAVSPDSFDTFHSYSNTFQMPFITPWFPEKVLAPSSGFLDYAISMRPDYHQAIIDTVKYYGWKNIIYMYDSHDEMFYEGSPEFLRVFCHEKLNISVWNRNLCNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate receptor 1 Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.confidentQ03445

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008328 [CC]ionotropic glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0004971 [MF]alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activityprobableGO:0038023, GO:0060089, GO:0008066, GO:0003674, GO:0004872, GO:0004871, GO:0004970, GO:0015276, GO:0022803, GO:0005216, GO:0005215, GO:0005230, GO:0022891, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838, GO:0004888
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0035235 [BP]ionotropic glutamate receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007215, GO:0050789, GO:0044699
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0097060 [CC]synaptic membraneprobableGO:0005575, GO:0044456, GO:0016020, GO:0045202
GO:0032279 [CC]asymmetric synapseprobableGO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KG2, chain A
Confidence level:very confident
Coverage over the Query: 7-112
View the alignment between query and template
View the model in PyMOL