Diaphorina citri psyllid: psy2802


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MYYFMQMHKDKVFVSSETEGVNKVRSSHGKYAFLIESPRNDYENARQPCDTMKVGNNLDVKGFGVATPIGSPLK
cHHHHHHcccccccccHHHHHHHHHHccccEEEEEEccHHHHHccccccccEEEccccccccEEEEcccccccc
MYYF***HKDK*FVSSETEGVNKVRSSHGKYAFLIESPRNDYENARQPCDTMKVGNNLDVKGFGVATPIG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYYFMQMHKDKVFVSSETEGVNKVRSSHGKYAFLIESPRNDYENARQPCDTMKVGNNLDVKGFGVATPIGSPLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate receptor 4 Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.confidentP19493
Glutamate receptor 2 Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.confidentP23819
Glutamate receptor 1 Non-NMDA (N-methyl-D-aspartate) ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of glutamate are mediated by a variety of receptors that are named according to their selective agonists. May contribute to a sensory discrimination between mechanical and chemical stimuli.confidentP34299

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035235 [BP]ionotropic glutamate receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007215, GO:0050789, GO:0044699
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0032279 [CC]asymmetric synapseprobableGO:0005575, GO:0045202
GO:0004971 [MF]alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activityprobableGO:0038023, GO:0060089, GO:0008066, GO:0003674, GO:0004872, GO:0004871, GO:0004970, GO:0015276, GO:0022803, GO:0005216, GO:0005215, GO:0005230, GO:0022891, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838, GO:0004888
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0030672 [CC]synaptic vesicle membraneprobableGO:0008021, GO:0043229, GO:0045202, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0008179 [MF]adenylate cyclase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0051018 [MF]protein kinase A bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031681 [MF]G-protein beta-subunit bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010226 [BP]response to lithium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0032983 [CC]kainate selective glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0008328, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0060992 [BP]response to fungicideprobableGO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035249 [BP]synaptic transmission, glutamatergicprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0007267, GO:0044763, GO:0023052, GO:0007268, GO:0007270, GO:0007154, GO:0044699, GO:0003008
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0060076 [CC]excitatory synapseprobableGO:0005575, GO:0045202
GO:0051966 [BP]regulation of synaptic transmission, glutamatergicprobableGO:0050804, GO:0044057, GO:0031644, GO:0050794, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789
GO:0030666 [CC]endocytic vesicle membraneprobableGO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0031623 [BP]receptor internalizationprobableGO:0051234, GO:0006898, GO:0006897, GO:0016192, GO:0044260, GO:0006810, GO:0044237, GO:0043170, GO:0071704, GO:0044765, GO:0008150, GO:0008152, GO:0009987, GO:0043112, GO:0051179, GO:0044699
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0045184 [BP]establishment of protein localizationprobableGO:0033036, GO:0008104, GO:0008150, GO:0051179, GO:0051234
GO:0001919 [BP]regulation of receptor recyclingprobableGO:0019222, GO:0060255, GO:0031323, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0050789
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0015277 [MF]kainate selective glutamate receptor activityprobableGO:0038023, GO:0060089, GO:0008066, GO:0003674, GO:0004872, GO:0004871, GO:0004970, GO:0015276, GO:0022803, GO:0005216, GO:0005215, GO:0005230, GO:0022891, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838, GO:0004888
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0032590 [CC]dendrite membraneprobableGO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032839 [CC]dendrite cytoplasmprobableGO:0005737, GO:0032838, GO:0044463, GO:0044464, GO:0030425, GO:0005622, GO:0005575, GO:0097458, GO:0044444, GO:0005623, GO:0043005, GO:0044424, GO:0042995
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0005234 [MF]extracellular-glutamate-gated ion channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005230, GO:0005231, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022803, GO:0022839, GO:0022838, GO:0005216
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0050806 [BP]positive regulation of synaptic transmissionprobableGO:0044057, GO:0031644, GO:0031646, GO:0051240, GO:0010647, GO:0050804, GO:0023056, GO:0050789, GO:0065007, GO:0051239, GO:0023051, GO:0048518, GO:0008150, GO:0051969, GO:0010646, GO:0051971, GO:0050794, GO:0048522
GO:0043083 [CC]synaptic cleftprobableGO:0005575, GO:0044456, GO:0044420, GO:0045202, GO:0031012
GO:0051262 [BP]protein tetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KG2, chain A
Confidence level:very confident
Coverage over the Query: 1-74
View the alignment between query and template
View the model in PyMOL