RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy2803
         (141 letters)



>gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the AMPA receptor.  N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the AMPA
          (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic
          acid) receptor, a member of the glutamate-receptor ion
          channels (iGluRs). AMPA receptors are the major
          mediators of excitatory synaptic transmission in the
          central nervous system.  While this N-terminal domain
          belongs to the periplasmic-binding fold type I
          superfamily, the glutamate-binding domain of the iGluR
          is structurally homologous to the periplasmic-binding
          fold type II. The LIVBP-like domain of iGluRs is
          thought to play a role in the initial assembly of iGluR
          subunits, but it is not well understood how this domain
          is arranged and functions in intact iGluR.  AMPA
          receptors consist of four types of subunits (GluR1,
          GluR2, GluR3, and GluR4) which combine to form a
          tetramer and play an important roles in mediating the
          rapid excitatory synaptic current.
          Length = 382

 Score = 58.5 bits (142), Expect = 5e-11
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHN-QNTTTRRFELQAYVDVINTADAFKLSRL 69
          +G +F+   D+  SAF+FA+  HN    +T  F+L  +VD ++T+D+F L+  
Sbjct: 2  IGGLFDVDEDQEYSAFRFAISQHNTNPNSTAPFKLLPHVDNLDTSDSFALTNA 54


>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the non-NMDA (N-methyl-d-asparate) subtypes
          of ionotropic glutamate receptors.  N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the non-NMDA (N-methyl-d-asparate) subtypes
          of ionotropic glutamate receptors. While this
          N-terminal domain belongs to the periplasmic-binding
          fold type I superfamily, the glutamate-binding domain
          of the iGluR is structurally homologous to the
          periplasmic-binding fold type II. The LIVBP-like domain
          of iGluRs is thought to play a role in the initial
          assembly of iGluR subunits, but it is not well
          understood how this domain is arranged and functions in
          intact iGluR.  Glutamate mediates the majority of
          excitatory synaptic transmission in the central nervous
          system via two broad classes of ionotropic receptors,
          characterized by their response to glutamate agonists:
          N-methyl-d -aspartate (NMDA) and non-NMDA receptors.
          NMDA receptors have intrinsically slow kinetics, are
          highly permeable to Ca2+, and are blocked by
          extracellular Mg2+ in a voltage-dependent manner.
          Non-NMDA receptors have faster kinetics, are most often
          only weakly permeable to Ca2+, and are not blocked by
          extracellular Mg2+. While non-NMDA receptors typically
          mediate excitatory synaptic responses at resting
          membrane potentials, NMDA receptors contribute several
          forms of synaptic plasticity and are thought to play an
          important role in the development of synaptic pathways.
          Non-NMDA receptors include
          alpha-amino-3-hydroxy-5-methyl-4-isoxazole proprionate
          (AMPA) and kainate receptors.
          Length = 324

 Score = 45.7 bits (109), Expect = 1e-06
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHNQN-TTTRRFELQAYVDVINTADAFKLSR 68
          +GAIF++   + + AF+FA+   N N     +F L   +D +NT D+F+L+ 
Sbjct: 2  IGAIFDEDARQEELAFRFAIDRINTNEEILAKFTLVPDIDELNTNDSFELTN 53


>gnl|CDD|107382 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the GluR3 subunit of the AMPA receptor.
          N-terminal leucine/isoleucine/valine-binding protein
          (LIVBP)-like domain of the GluR3 subunit of the AMPA
          (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic
          acid) receptor. The AMPA receptor is a member of the
          glutamate-receptor ion channels (iGluRs) which are the
          major mediators of excitatory synaptic transmission in
          the central nervous system. AMPA receptors are composed
          of four types of subunits (GluR1, GluR2, GluR3, and
          GluR4) which combine to form a tetramer and play an
          important role in mediating the rapid excitatory
          synaptic current. Furthermore, this N-terminal domain
          of the iGluRs has homology with LIVBP, a bacterial
          periplasmic binding protein, as well as with the
          structurally related glutamate-binding domain of the
          G-protein-coupled metabotropic receptors (mGluRs).
          Length = 372

 Score = 37.3 bits (86), Expect = 0.001
 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 18 LGAIFEQGTDEVQSAFKFA--MLTHNQNTTTRRFELQAYVDVINTADAFKLS 67
          +G +F + T +  SAF+FA  +   NQNTT + F L  +VD ++++++F ++
Sbjct: 2  IGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVT 53


>gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the GluR4 subunit of the AMPA receptor.
          N-terminal leucine/isoleucine/valine-binding protein
          (LIVBP)-like domain of the GluR4 subunit of the AMPA
          (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic
          acid) receptor. The AMPA receptor is a member of the
          glutamate-receptor ion channels (iGluRs) which are the
          major mediators of excitatory synaptic transmission in
          the central nervous system. AMPA receptors are composed
          of four types of subunits (GluR1, GluR2, GluR3, and
          GluR4) which combine to form a tetramer and play an
          important role in mediating the rapid excitatory
          synaptic current. Furthermore, this N-terminal domain
          of the iGluRs has homology with LIVBP, a bacterial
          periplasmic binding protein, as well as with the
          structurally related glutamate-binding domain of the
          G-protein-coupled metabotropic receptors (mGluRs).
          Length = 371

 Score = 37.3 bits (86), Expect = 0.001
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHNQ--NTTTRRFELQAYVDVINTADAFKLS 67
          +G +F + TD+  +AF+ A+  HN   N +   F L  +VD I TA++F ++
Sbjct: 2  IGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVT 53


>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the NMDA, AMPA, and kainate receptor subtypes
          of ionotropic glutamate receptors (iGluRs).  N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the NMDA, AMPA, and kainate receptor subtypes
          of ionotropic glutamate receptors (iGluRs). While this
          N-terminal domain belongs to the periplasmic-binding
          fold type I superfamily, the glutamate-binding domain
          of the iGluR is structurally homologous to the
          periplasmic-binding fold type II. The LIVBP-like domain
          of iGluRs is thought to play a role in the initial
          assembly of iGluR subunits, but it is not well
          understood how this domain is arranged and functions in
          intact iGluR. Glutamate mediates the majority of
          excitatory synaptic transmission in the central nervous
          system via two broad classes of ionotropic receptors
          characterized by their response to glutamate agonists:
          N-methyl-aspartate (NMDA) and non-NMDA receptors. NMDA
          receptors have intrinsically slow kinetics, are highly
          permeable to Ca2+, and are blocked by extracellular
          Mg2+ in a voltage-dependent manner. On the other hand,
          non-NMDA receptors have faster kinetics, are weakly
          permeable to Ca2+, and are not blocked by extracellular
          Mg2+. While non-NMDA receptors typically mediate
          excitatory synaptic responses at resting membrane
          potentials, NMDA receptors contribute to several forms
          of synaptic plasticity and are suggested to play an
          important role in the development of synaptic pathways.
          Length = 328

 Score = 35.2 bits (81), Expect = 0.006
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHNQN-TTTRRFELQAYVDVINTADAFKLSR 68
          +GAIF++   + + AF+ A+   N         +L   V  +NT D F L R
Sbjct: 2  IGAIFDRDARKEELAFRAAIDALNTENLNALPTKLSVEVVEVNTNDPFSLLR 53


>gnl|CDD|107384 cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the GluR2 subunit of the AMPA receptor.
          N-terminal leucine/isoleucine/valine-binding protein
          (LIVBP)-like domain of the GluR2 subunit of the AMPA
          (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic
          acid) receptor. The AMPA receptor is a member of the
          glutamate-receptor ion channels (iGluRs) which are the
          major mediators of excitatory synaptic transmission in
          the central nervous system. AMPA receptors are composed
          of four types of subunits (GluR1, GluR2, GluR3, and
          GluR4) which combine to form a tetramer and play an
          important role in mediating the rapid excitatory
          synaptic current. Furthermore, this N-terminal domain
          of the iGluRs has homology with LIVBP, a bacterial
          periplasmic binding protein, as well as with the
          structurally related glutamate-binding domain of the
          G-protein-coupled metabotropic receptors (mGluRs).
          Length = 370

 Score = 31.1 bits (70), Expect = 0.17
 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLS 67
          +G +F +G D+  SAF+  M+      +T  F L  ++D +  A++F ++
Sbjct: 2  IGGLFPRGADQEYSAFRVGMVQF----STSEFRLTPHIDNLEVANSFAVT 47


>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in
           the putative elicitor-responsive gene.  In plants
           elicitor-responsive proteins are triggered in response
           to specific elicitor molecules such as glycolproteins,
           peptides, carbohydrates and lipids. A host of defensive
           responses are also triggered resulting in localized cell
           death.  Antimicrobial secondary metabolites, such as
           phytoalexins, or defense-related proteins, including
           pathogenesis-related (PR) proteins  are also produced.
           There is a single C2 domain present here.  C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members have a type-II
           topology.
          Length = 124

 Score = 28.8 bits (65), Expect = 0.59
 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 4/45 (8%)

Query: 96  GFEPKFTESFGVFCPEPQSKFDLSLILRQSIIMVDLKLFSQSDCI 140
           G  P++ E F      P    D  LILR   IM D   FS  D I
Sbjct: 44  GRNPEWNEKFKFTVEYPGWGGDTKLILR---IM-DKDNFSDDDFI 84


>gnl|CDD|212564 cd11674, lambda-1, inner capsid protein lambda-1 or VP3.  The
           reovirus inner capsid protein lambda-1 displays
           nucleoside triphosphate phosphohydrolase (NTPase),
           RNA-5'-triphosphatase (RTPase), and RNA helicase
           activity and may play a role in the transcription of the
           virus genome, the unwinding or reannealing of
           double-stranded RNA during RNA synthesis. The RTPase
           activity constitutes the first step in the capping of
           RNA, resulting in a 5'-diphosphorylated RNA plus-strand.
           lambda1 is an Orthoreovirus core protein, VP3 is the
           homologous core protein in Aquareoviruses.
          Length = 1166

 Score = 28.2 bits (63), Expect = 1.8
 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%)

Query: 50  ELQAYVDVINTADAFKLSRLSIRKMLVTNLMSLHSSPNLI 89
            + A+ D   T DA  L    IR+M +  L S+H  P  I
Sbjct: 337 AVSAWADTYETCDALTLY---IREMYLLRLRSMHLDPAQI 373


>gnl|CDD|107385 cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal
          leucine/isoleucine/valine-binding protein (LIVBP)-like
          domain of the GluR1 subunit of the AMPA receptor.
          N-terminal leucine/isoleucine/valine-binding protein
          (LIVBP)-like domain of the GluR1 subunit of the AMPA
          (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic
          acid) receptor. The AMPA receptor is a member of the
          glutamate-receptor ion channels (iGluRs) which are the
          major mediators of excitatory synaptic transmission in
          the central nervous system. AMPA receptors are composed
          of four types of subunits (GluR1, GluR2, GluR3, and
          GluR4) which combine to form a tetramer and play an
          important role in mediating the rapid excitatory
          synaptic current. Furthermore, this N-terminal domain
          of the iGluRs has homology with LIVBP, a bacterial
          periplasmic binding protein, as well as with the
          structurally related glutamate-binding domain of the
          G-protein-coupled metabotropic receptors (mGluRs).
          Length = 364

 Score = 27.2 bits (60), Expect = 2.9
 Identities = 11/50 (22%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 18 LGAIFEQGTDEVQSAFKFAMLTHNQNTTTRRFELQAYVDVINTADAFKLS 67
          +G +F     +  +AF+FA+    +       +L   +D++N +D+F+++
Sbjct: 2  IGGLFPNQQSQEHAAFRFALSQLTEPP-----KLLPQIDIVNISDSFEMT 46


>gnl|CDD|99962 cd03786, GT1_UDP-GlcNAc_2-Epimerase, Bacterial members of the
           UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase  family are
           known to catalyze the reversible interconversion of
           UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The
           enzyme serves to produce an activated form of ManNAc
           residues (UDP-ManNAc) for use in the biosynthesis of a
           variety of cell surface polysaccharides; The mammalian
           enzyme is bifunctional, catalyzing both the inversion of
           stereochemistry at C-2 and the hydrolysis of the
           UDP-sugar linkage to generate free ManNAc. It also
           catalyzes the phosphorylation of ManNAc to generate
           ManNAc 6-phosphate, a precursor to salic acids. In
           mammals, sialic acids are found at the termini of
           oligosaccharides in a large variety of cell surface
           glycoconjugates and are key mediators of cell-cell
           recognition events. Mutations in human members of this
           family have been associated with Sialuria, a rare
           disease caused by the disorders of sialic acid
           metabolism. This family belongs to the GT-B structural
           superfamily of glycoslytransferases, which have
           characteristic N- and C-terminal domains each containing
           a typical Rossmann fold. The two domains have high
           structural homology despite minimal sequence homology.
           The large cleft that separates the two domains includes
           the catalytic center and permits a high degree of
           flexibility.
          Length = 363

 Score = 26.7 bits (60), Expect = 4.4
 Identities = 8/64 (12%), Positives = 19/64 (29%), Gaps = 5/64 (7%)

Query: 66  LSRLSIRKMLVTNLMSLHSSPNLINFMTRLGFEPKFTESFGVFCPEPQSKFDLSLILRQS 125
           L+ L+   + V       + P +                  V    P       L+L+ +
Sbjct: 224 LAELAEEDVPVVFPNHPRTRPRIREAGLEFLGHHPN-----VLLISPLGYLYFLLLLKNA 278

Query: 126 IIMV 129
            +++
Sbjct: 279 DLVL 282


>gnl|CDD|182523 PRK10530, PRK10530, pyridoxal phosphate (PLP) phosphatase;
           Provisional.
          Length = 272

 Score = 25.8 bits (57), Expect = 9.3
 Identities = 9/31 (29%), Positives = 13/31 (41%), Gaps = 1/31 (3%)

Query: 22  FEQGTDEVQSAFKFAMLTHNQNTTTRRFELQ 52
             Q   +V + +KFA LTH      + F   
Sbjct: 145 LAQAARQVNAIWKFA-LTHEDLPQLQHFAKH 174


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.326    0.137    0.389 

Gapped
Lambda     K      H
   0.267   0.0680    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,812,663
Number of extensions: 581302
Number of successful extensions: 582
Number of sequences better than 10.0: 1
Number of HSP's gapped: 577
Number of HSP's successfully gapped: 19
Length of query: 141
Length of database: 10,937,602
Length adjustment: 87
Effective length of query: 54
Effective length of database: 7,078,804
Effective search space: 382255416
Effective search space used: 382255416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (24.7 bits)