Query         psy2810
Match_columns 80
No_of_seqs    100 out of 206
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:30:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2810.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2810hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00957 MRP_assoc_pro multi   98.8 7.8E-09 1.7E-13   89.2   5.0   65    6-70      6-70  (1522)
  2 PLN03232 ABC transporter C fam  98.6 4.1E-08   9E-13   84.7   4.0   64    2-69      7-75  (1495)
  3 PLN03130 ABC transporter C fam  98.5 9.7E-08 2.1E-12   83.2   4.1   64    2-69      7-75  (1622)
  4 PF10569 Thiol-ester_cl:  Alpha  38.0      13 0.00028   19.0   0.3   17   24-40     10-26  (31)
  5 PF03373 Octapeptide:  Octapept  34.7      20 0.00043   13.3   0.5    6   74-79      1-6   (8)
  6 TIGR02226 two_anch N-terminal   28.5   1E+02  0.0022   18.2   3.3   26   44-69     17-42  (82)
  7 PF14610 DUF4448:  Protein of u  28.3      45 0.00097   22.9   1.8   30   30-59    159-188 (189)
  8 PF03967 PRCH:  Photosynthetic   27.0      94   0.002   21.2   3.1   26   33-58     13-40  (136)
  9 PF15102 TMEM154:  TMEM154 prot  22.2   1E+02  0.0022   21.2   2.6   48   30-77     58-108 (146)
 10 PF10324 7TM_GPCR_Srw:  Serpent  21.1      98  0.0021   22.1   2.5   28   33-60    201-228 (318)
 11 PF10642 Tom5:  Mitochondrial i  20.4 1.3E+02  0.0028   17.0   2.4   16   37-53     32-47  (49)

No 1  
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP). This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved.
Probab=98.77  E-value=7.8e-09  Score=89.22  Aligned_cols=65  Identities=40%  Similarity=0.871  Sum_probs=55.6

Q ss_pred             cccccCCCCCccCCCCCCcccchhheeehhhHHHHHHHHHHHHHHHHhcCCCCcCcchhhhhhhh
Q psy2810           6 GTKFWDQNLTWNTNEPELTPCFESTVLVWTPCLFLWVFSPLEAYYLVNSKFRDIPWNLLNRSKLD   70 (80)
Q Consensus         6 g~~fwd~~~~~~t~~Pdlt~CFq~TvLvwiPc~fLWi~~P~~~~~l~~s~~~~ip~s~L~~~K~v   70 (80)
                      |+++|+.+.++++..+|||+|||+++++|+|+.++++++|+.+++++++++++.+++.+...|++
T Consensus         6 ~~~~~~~~~~~~~~~~d~t~~f~~~~~~~~p~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~k~~   70 (1522)
T TIGR00957         6 SDPLWDWNVTWHTSNPDFTKCFQNTVLAWVPCFYLWVCFPCYFLYLSRHDRGYIQMTHLNKTKTA   70 (1522)
T ss_pred             CCCCCCCcccCCCCCCCCCccHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCcCCcchHHHHHHH
Confidence            45689887778999999999999999999999999999999999997766666777777666653


No 2  
>PLN03232 ABC transporter C family member; Provisional
Probab=98.58  E-value=4.1e-08  Score=84.69  Aligned_cols=64  Identities=11%  Similarity=0.196  Sum_probs=50.7

Q ss_pred             ccccccc---ccCCCCCccCCCCCCcccchhheeehhhHHHHHHHHHHHHHHH--HhcCCCCcCcchhhhhhh
Q psy2810           2 DEFCGTK---FWDQNLTWNTNEPELTPCFESTVLVWTPCLFLWVFSPLEAYYL--VNSKFRDIPWNLLNRSKL   69 (80)
Q Consensus         2 ~~fCg~~---fwd~~~~~~t~~Pdlt~CFq~TvLvwiPc~fLWi~~P~~~~~l--~~s~~~~ip~s~L~~~K~   69 (80)
                      +.+||+.   ||++...++ ..| +|+|||+++++|+|++|+|+++|.+++++  ++++.++++.  .+..|+
T Consensus         7 ~~~~~~~~~~~~~~~~~~~-~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~   75 (1495)
T PLN03232          7 NWYCKPIAEGFWEKTVDGA-FGA-YTPCAIDSLVMIVSHSVLLGLCFYRIWIILDNAKAQIYVLR--KKYYNC   75 (1495)
T ss_pred             HhhcCCccccCCCcccccc-cCC-CCccHHhhHHHHHHHHHHHHHHHHHHHHHhhccccCCcccc--chHHHH
Confidence            4589654   687776666 788 99999999999999999999999999988  5555666665  555554


No 3  
>PLN03130 ABC transporter C family member; Provisional
Probab=98.50  E-value=9.7e-08  Score=83.19  Aligned_cols=64  Identities=14%  Similarity=0.233  Sum_probs=51.0

Q ss_pred             ccccccc---ccCCCCCccCCCCCCcccchhheeehhhHHHHHHHHHHHHHHHHh--cCCCCcCcchhhhhhh
Q psy2810           2 DEFCGTK---FWDQNLTWNTNEPELTPCFESTVLVWTPCLFLWVFSPLEAYYLVN--SKFRDIPWNLLNRSKL   69 (80)
Q Consensus         2 ~~fCg~~---fwd~~~~~~t~~Pdlt~CFq~TvLvwiPc~fLWi~~P~~~~~l~~--s~~~~ip~s~L~~~K~   69 (80)
                      +.+||+.   ||++...++ ..| +|+|||+++++|+|++|+|+++|.++.++++  ++.++++.  .+..|+
T Consensus         7 ~~~c~~~~~~~~~~~~~~~-~~~-~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~   75 (1622)
T PLN03130          7 DWYCRPVPNGVWAKKVDNA-FGA-YTPCATDSLVINISHLVLLGLCLYRIWLIKKDHKVQRFCLR--SKWYNY   75 (1622)
T ss_pred             hhhcCCCccCCCCcccccc-cCC-CCccHHhhHHHHHHHHHHHHHHHHHHHHhccccccCCcccc--chHHHH
Confidence            5689753   698776666 778 9999999999999999999999999998876  55556655  444444


No 4  
>PF10569 Thiol-ester_cl:  Alpha-macro-globulin thiol-ester bond-forming region;  InterPro: IPR019565 This entry contains serum complement C3 and C4 precursors and alpha-macrogrobulins.  The alpha-macroglobulin (aM) family of proteins includes protease inhibitors [], typified by the human tetrameric a2-macroglobulin (a2M); they belong to the MEROPS proteinase inhibitor family I39, clan IL. These protease inhibitors share several defining properties, which include (i) the ability to inhibit proteases from all catalytic classes, (ii) the presence of a 'bait region' and a thiol ester, (iii) a similar protease inhibitory mechanism and (iv) the inactivation of the inhibitory capacity by reaction of the thiol ester with small primary amines. aM protease inhibitors inhibit by steric hindrance []. The mechanism involves protease cleavage of the bait region, a segment of the aM that is particularly susceptible to proteolytic cleavage, which initiates a conformational change such that the aM collapses about the protease. In the resulting aM-protease complex, the active site of the protease is sterically shielded, thus substantially decreasing access to protein substrates. Two additional events occur as a consequence of bait region cleavage, namely (i) the h-cysteinyl-g-glutamyl thiol ester becomes highly reactive and (ii) a major conformational change exposes a conserved COOH-terminal receptor binding domain [] (RBD). RBD exposure allows the aM protease complex to bind to clearance receptors and be removed from circulation []. Tetrameric, dimeric, and, more recently, monomeric aM protease inhibitors have been identified [, ].  This short highly conserved region of proteinase-binding alpha-macro-globulins contains the cysteine and a glutamine of a thiol-ester bond that is cleaved at the moment of proteinase binding, and mediates the covalent binding of the alpha-macro-globulin to the proteinase. The GCGEQ motif is highly conserved. ; PDB: 2B39_B 2PN5_A 4ACQ_C 1HZF_A 2WIN_H 2I07_B 2ICF_B 2XWJ_D 3G6J_B 2NOJ_C ....
Probab=38.03  E-value=13  Score=19.04  Aligned_cols=17  Identities=24%  Similarity=0.458  Sum_probs=13.5

Q ss_pred             cccchhheeehhhHHHH
Q psy2810          24 TPCFESTVLVWTPCLFL   40 (80)
Q Consensus        24 t~CFq~TvLvwiPc~fL   40 (80)
                      .-|+|||....+|-++.
T Consensus        10 ~GCgEQtm~~~~P~v~~   26 (31)
T PF10569_consen   10 YGCGEQTMSSFAPNVYA   26 (31)
T ss_dssp             -SSTTHHHHHHHHHHHH
T ss_pred             CCcHHHHHHHHhHHHHH
Confidence            57999999999887654


No 5  
>PF03373 Octapeptide:  Octapeptide repeat;  InterPro: IPR005038  This octapeptide repeat is found in several bacterial proteins. The function of this repeat is unknown.; GO: 0019865 immunoglobulin binding
Probab=34.75  E-value=20  Score=13.29  Aligned_cols=6  Identities=67%  Similarity=1.309  Sum_probs=4.6

Q ss_pred             CCCCCC
Q psy2810          74 PGQESN   79 (80)
Q Consensus        74 ~~~~~~   79 (80)
                      ||.|.|
T Consensus         1 PgkeDn    6 (8)
T PF03373_consen    1 PGKEDN    6 (8)
T ss_pred             Cccccc
Confidence            788876


No 6  
>TIGR02226 two_anch N-terminal double-transmembrane domain. This model represents a prokaryotic N-terminal region of about 80 amino acids. The predicted membrane topology by TMHMM puts the N-terminus outside and spans the membrane twice, with a cytosolic region of about 25 amino acids between the two transmembrane regions. Member proteins tend to be between 600 and 1000 amino acids in length.
Probab=28.51  E-value=1e+02  Score=18.23  Aligned_cols=26  Identities=19%  Similarity=0.107  Sum_probs=15.3

Q ss_pred             HHHHHHHHHhcCCCCcCcchhhhhhh
Q psy2810          44 SPLEAYYLVNSKFRDIPWNLLNRSKL   69 (80)
Q Consensus        44 ~P~~~~~l~~s~~~~ip~s~L~~~K~   69 (80)
                      .|+.++..++++++.++++.....+.
T Consensus        17 lplli~l~~r~~~~~~~~~~~~~l~~   42 (82)
T TIGR02226        17 LPLLIHLLRRRPPRPVDFPALRFLRE   42 (82)
T ss_pred             HHHHHHHHhcCCCCceeccchHHHHh
Confidence            56665555566666677766554443


No 7  
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=28.32  E-value=45  Score=22.89  Aligned_cols=30  Identities=17%  Similarity=0.279  Sum_probs=23.1

Q ss_pred             heeehhhHHHHHHHHHHHHHHHHhcCCCCc
Q psy2810          30 TVLVWTPCLFLWVFSPLEAYYLVNSKFRDI   59 (80)
Q Consensus        30 TvLvwiPc~fLWi~~P~~~~~l~~s~~~~i   59 (80)
                      .+.+-+|.++..++.-.+++..+++|+++|
T Consensus       159 ~laI~lPvvv~~~~~~~~~~~~~~R~~Rri  188 (189)
T PF14610_consen  159 ALAIALPVVVVVLALIMYGFFFWNRKKRRI  188 (189)
T ss_pred             eEEEEccHHHHHHHHHHHhhheeeccceec
Confidence            667889999999998888876665555544


No 8  
>PF03967 PRCH:  Photosynthetic reaction centre, H-chain N-terminal region;  InterPro: IPR015810  The photosynthetic apparatus in non-oxygenic bacteria consists of light-harvesting (LH) protein-pigment complexes LH1 and LH2, which use carotenoid and bacteriochlorophyll as primary donors []. LH1 acts as the energy collection hub, temporarily storing it before its transfer to the photosynthetic reaction centre (RC) []. Electrons are transferred from the primary donor via an intermediate acceptor (bacteriopheophytin) to the primary acceptor (quinine Qa), and finally to the secondary acceptor (quinone Qb), resulting in the formation of ubiquinol QbH2. RC uses the excitation energy to shuffle electrons across the membrane, transferring them via ubiquinol to the cytochrome bc1 complex in order to establish a proton gradient across the membrane, which is used by ATP synthetase to form ATP [, , ].  The core complex is anchored in the cell membrane, consisting of one unit of RC surrounded by LH1; in some species there may be additional subunits []. RC consists of three subunits: L (light), M (medium), and H (heavy). Subunits L and M provide the scaffolding for the chromophore, while subunit H contains a cytoplasmic domain []. In Rhodopseudomonas viridis, there is also a non-membranous tetrahaem cytochrome (4Hcyt) subunit on the periplasmic surface.  This entry represents the N-terminal domain of the photosynthetic reaction centre H subunit, which includes the transmembrane domain and part of the cytoplasmic domain [].; GO: 0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, 0019684 photosynthesis, light reaction, 0030077 plasma membrane light-harvesting complex; PDB: 1RZZ_H 1PST_H 2J8D_H 3DUQ_H 1FNP_H 1KBY_H 1E14_H 2HG3_H 1UMX_H 1YST_H ....
Probab=26.95  E-value=94  Score=21.20  Aligned_cols=26  Identities=19%  Similarity=0.249  Sum_probs=17.8

Q ss_pred             ehhhHHHHHHHHHHHHHHHHh--cCCCC
Q psy2810          33 VWTPCLFLWVFSPLEAYYLVN--SKFRD   58 (80)
Q Consensus        33 vwiPc~fLWi~~P~~~~~l~~--s~~~~   58 (80)
                      +-+-..-+|+|.-.+++||++  +|.||
T Consensus        13 Aql~lyaFwiFFagLi~YLrrEdkREGY   40 (136)
T PF03967_consen   13 AQLVLYAFWIFFAGLIYYLRREDKREGY   40 (136)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTSSST
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccccCC
Confidence            334445678888888889996  45554


No 9  
>PF15102 TMEM154:  TMEM154 protein family
Probab=22.18  E-value=1e+02  Score=21.24  Aligned_cols=48  Identities=15%  Similarity=0.240  Sum_probs=21.5

Q ss_pred             heeehhhHHHHHH-HHHHHHHHHHhc--CCCCcCcchhhhhhhhccCCCCC
Q psy2810          30 TVLVWTPCLFLWV-FSPLEAYYLVNS--KFRDIPWNLLNRSKLDQDRPGQE   77 (80)
Q Consensus        30 TvLvwiPc~fLWi-~~P~~~~~l~~s--~~~~ip~s~L~~~K~v~~~~~~~   77 (80)
                      .+.+-||.+-|-+ +.-+.++.++.+  |.+.-|-+.-.....-.+..|+|
T Consensus        58 iLmIlIP~VLLvlLLl~vV~lv~~~kRkr~K~~~ss~gsq~~~qt~e~~~E  108 (146)
T PF15102_consen   58 ILMILIPLVLLVLLLLSVVCLVIYYKRKRTKQEPSSQGSQSALQTYELGSE  108 (146)
T ss_pred             EEEEeHHHHHHHHHHHHHHHheeEEeecccCCCCccccccccccccccCcc
Confidence            5568899655533 333333333322  22222334334433444555554


No 10 
>PF10324 7TM_GPCR_Srw:  Serpentine type 7TM GPCR chemoreceptor Srw;  InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz []. 
Probab=21.12  E-value=98  Score=22.14  Aligned_cols=28  Identities=25%  Similarity=0.303  Sum_probs=22.6

Q ss_pred             ehhhHHHHHHHHHHHHHHHHhcCCCCcC
Q psy2810          33 VWTPCLFLWVFSPLEAYYLVNSKFRDIP   60 (80)
Q Consensus        33 vwiPc~fLWi~~P~~~~~l~~s~~~~ip   60 (80)
                      .-+||+.+-++.-+.+..+++.++++..
T Consensus       201 kiiP~il~~ilti~Li~~Lrk~~~~r~~  228 (318)
T PF10324_consen  201 KIIPCILLPILTILLIIELRKAKKRRKK  228 (318)
T ss_pred             hhhhHHHHHHHHHHHHHHHHhccHhhhc
Confidence            6799999999999999889876655443


No 11 
>PF10642 Tom5:  Mitochondrial import receptor subunit or translocase;  InterPro: IPR019603  This entry represents a short family of yeast proteins. Tom5 is one of three very small translocases of the mitochondrial outer membrane. Tom5 links mitochondrial preprotein receptors to the general import pore []. Although Tom5 has allegedly been identified in vertebrates this could not be confirmed. 
Probab=20.37  E-value=1.3e+02  Score=16.97  Aligned_cols=16  Identities=19%  Similarity=0.534  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHHHh
Q psy2810          37 CLFLWVFSPLEAYYLVN   53 (80)
Q Consensus        37 c~fLWi~~P~~~~~l~~   53 (80)
                      .+.|| ++|+-+.++++
T Consensus        32 a~~Ly-lsP~~~~~vkk   47 (49)
T PF10642_consen   32 AALLY-LSPFAIDFVKK   47 (49)
T ss_pred             HHHHH-HhHHHHHHHHh
Confidence            45666 69998887765


Done!