Diaphorina citri psyllid: psy2830

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---

MVKLPRPNSANAEVYFGLILIPTSNPGLQSQAGGYLRIMRYVAAYLLAALGGKENPAQGDVEKILSSVGIESDAEKLKIVLKELNGKNLEEIIAAGKEKLASMPSGGGAVSASAGAAAPAAAAEEGKKEEKKAEKKEESDASDDDMGFGVWEARTNGKKELTEDTNPIRMGKKNIPRSQKWDS

cccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc

***********AEVYFGLILIPTSNPGLQSQAGGYLRIMRYVAAYLLAALGGKENPAQGDVEKILSSVGIESDAEKLKIVLKELNGKNLEEIIAAGKEKLAS********************************************GFGVWEARTNGK****E********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVKLPRPNSANAEVYFGLILIPTSNPGLQSQAGGYLRIMRYVAAYLLAALGGKENPAQGDVEKILSSVGIESDAEKLKIVLKELNGKNLEEIIAAGKEKLASMPSGGGAVSASAGAAAPAAAAEEGKKEEKKAEKKEESDASDDDMGFGVWEARTNGKKELTEDTNPIRMGKKNIPRSQKWDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S acidic ribosomal protein P2	Plays an important role in the elongation step of protein synthesis.	confident	Q29315
60S acidic ribosomal protein P2	Plays an important role in the elongation step of protein synthesis.	confident	P42899
60S acidic ribosomal protein P2	Plays an important role in the elongation step of protein synthesis.	confident	O01725

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022625 [CC]	cytosolic large ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0008150 [BP]	biological_process	probable
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LBF, chain B
Confidence level:confident
Coverage over the Query: 38-107
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3iz5, chain v		very confident	Alignment \| Template Structure