Query         psy284
Match_columns 139
No_of_seqs    149 out of 1059
Neff          9.5 
Searched_HMMs 46136
Date          Fri Aug 16 18:14:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy284.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/284hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9 6.5E-23 1.4E-27  151.3   1.6   99   36-139   332-436 (468)
  2 KOG1044|consensus               99.9 1.4E-22   3E-27  154.2   3.2  123    9-138   101-226 (670)
  3 KOG1701|consensus               99.8 2.8E-22 6.2E-27  147.9  -3.1   95   37-138   273-368 (468)
  4 KOG4577|consensus               99.8 3.3E-22 7.1E-27  141.2  -3.2  101   34-139    29-129 (383)
  5 KOG2272|consensus               99.8 3.7E-20   8E-25  128.8  -0.9   97   35-138   192-288 (332)
  6 KOG2272|consensus               99.7 6.5E-20 1.4E-24  127.6  -2.0   96   37-138    11-107 (332)
  7 KOG1703|consensus               99.6 4.4E-17 9.6E-22  126.1   1.0   98   36-138   361-458 (479)
  8 KOG1703|consensus               99.6 1.4E-15 3.1E-20  117.7   3.3   97   36-138   301-397 (479)
  9 PF00412 LIM:  LIM domain;  Int  99.5 2.4E-14 5.2E-19   80.4   4.7   57   41-99      1-58  (58)
 10 KOG1044|consensus               99.3 4.7E-12   1E-16   97.3   4.8   92   31-139     9-100 (670)
 11 KOG1700|consensus               99.2   5E-12 1.1E-16   87.6   0.3   99   37-138     6-143 (200)
 12 smart00132 LIM Zinc-binding do  99.0 3.2E-10 6.9E-15   58.2   2.9   36  104-139     1-36  (39)
 13 PF00412 LIM:  LIM domain;  Int  99.0   3E-10 6.4E-15   63.6   2.8   35  105-139     1-35  (58)
 14 smart00132 LIM Zinc-binding do  98.6 2.6E-08 5.6E-13   50.9   2.5   36   40-75      1-37  (39)
 15 KOG4577|consensus               98.3   2E-07 4.3E-12   66.9   0.8   64   38-101    92-156 (383)
 16 KOG0490|consensus               98.0 3.4E-07 7.4E-12   64.8  -2.7   91   44-138     2-94  (235)
 17 KOG1700|consensus               97.8 3.8E-06 8.3E-11   58.4   0.2   65   33-99    103-167 (200)
 18 KOG1702|consensus               97.6 6.9E-06 1.5E-10   56.5  -1.9   59   38-98      4-62  (264)
 19 PF08394 Arc_trans_TRASH:  Arch  93.4    0.06 1.3E-06   27.0   1.6   29  105-133     1-29  (37)
 20 PF10367 Vps39_2:  Vacuolar sor  91.8    0.13 2.9E-06   31.7   2.0   29  104-132    80-108 (109)
 21 PF14446 Prok-RING_1:  Prokaryo  89.5    0.25 5.3E-06   27.0   1.4   28  104-131     7-36  (54)
 22 PF09943 DUF2175:  Uncharacteri  87.3    0.25 5.4E-06   30.5   0.6   29  104-132     4-32  (101)
 23 PF07754 DUF1610:  Domain of un  87.1    0.43 9.3E-06   21.5   1.2   15  105-119     1-15  (24)
 24 PF13920 zf-C3HC4_3:  Zinc fing  86.9     1.5 3.2E-05   23.2   3.5   44   67-113     4-48  (50)
 25 PF09943 DUF2175:  Uncharacteri  84.5    0.35 7.7E-06   29.9   0.3   31   40-70      4-35  (101)
 26 PF10367 Vps39_2:  Vacuolar sor  83.5    0.94   2E-05   27.8   2.0   32   36-67     76-108 (109)
 27 smart00504 Ubox Modified RING   83.2     2.1 4.6E-05   23.4   3.2   46   66-114     2-47  (63)
 28 KOG0320|consensus               82.0     1.2 2.5E-05   30.5   2.0   52   62-114   128-179 (187)
 29 KOG1813|consensus               81.3    0.79 1.7E-05   33.8   1.1   46   66-114   242-287 (313)
 30 PF10235 Cript:  Microtubule-as  80.5       1 2.2E-05   27.3   1.2   43   60-114    39-81  (90)
 31 PF11781 RRN7:  RNA polymerase   77.8     1.3 2.9E-05   22.0   1.0   23   66-94      9-31  (36)
 32 PF13923 zf-C3HC4_2:  Zinc fing  77.2     2.8 6.2E-05   20.8   2.2   39   68-108     1-39  (39)
 33 PF14835 zf-RING_6:  zf-RING of  77.2     1.9 4.1E-05   24.4   1.6   48   66-117     8-55  (65)
 34 COG5152 Uncharacterized conser  77.1     1.2 2.6E-05   31.0   0.9   48   64-114   195-242 (259)
 35 PF10083 DUF2321:  Uncharacteri  76.2     2.8 6.1E-05   28.0   2.4   50   85-138    25-76  (158)
 36 PF14634 zf-RING_5:  zinc-RING   75.6     5.2 0.00011   20.4   3.0   43   68-110     2-44  (44)
 37 KOG3579|consensus               74.3     3.4 7.4E-05   30.5   2.7   36   34-69    264-299 (352)
 38 PF14471 DUF4428:  Domain of un  73.5     3.9 8.4E-05   22.0   2.2   30   67-98      1-30  (51)
 39 PF14570 zf-RING_4:  RING/Ubox   71.3     5.8 0.00013   21.1   2.5   24   88-111    22-46  (48)
 40 COG4847 Uncharacterized protei  69.3     2.1 4.5E-05   26.1   0.5   29  104-132     8-36  (103)
 41 PRK14890 putative Zn-ribbon RN  69.0     3.9 8.5E-05   22.7   1.6   13  104-116     9-21  (59)
 42 PF06677 Auto_anti-p27:  Sjogre  67.2     3.2 6.9E-05   21.3   0.9   22   67-94     19-40  (41)
 43 PF12156 ATPase-cat_bd:  Putati  66.5     4.6  0.0001   24.3   1.7   30  104-136     2-32  (88)
 44 PF06906 DUF1272:  Protein of u  66.3      15 0.00034   20.1   3.5   46   67-114     7-53  (57)
 45 COG1645 Uncharacterized Zn-fin  66.2     3.2 6.8E-05   27.0   1.0   22   67-95     30-51  (131)
 46 COG0068 HypF Hydrogenase matur  66.1     3.5 7.6E-05   34.2   1.4   84   35-138    98-181 (750)
 47 cd00162 RING RING-finger (Real  66.1     9.6 0.00021   18.6   2.7   26   86-111    18-44  (45)
 48 PF00645 zf-PARP:  Poly(ADP-rib  65.7     3.1 6.8E-05   24.4   0.9   31   37-67      6-47  (82)
 49 PF01258 zf-dskA_traR:  Prokary  64.6     1.2 2.6E-05   21.9  -0.9   28   68-97      6-33  (36)
 50 PF12773 DZR:  Double zinc ribb  62.9     3.2 6.9E-05   21.8   0.5    9  104-112    31-39  (50)
 51 PF10886 DUF2685:  Protein of u  60.4     7.5 0.00016   21.2   1.6   26   39-64      2-27  (54)
 52 PF11571 Med27:  Mediator compl  59.1     3.9 8.5E-05   24.7   0.4   17   94-112    48-64  (90)
 53 COG2888 Predicted Zn-ribbon RN  57.2     9.3  0.0002   21.3   1.7   17  104-120    11-27  (61)
 54 COG2191 Formylmethanofuran deh  55.5     3.4 7.5E-05   28.9  -0.3   31   66-98    173-203 (206)
 55 PF03854 zf-P11:  P-11 zinc fin  52.6     9.5 0.00021   20.2   1.2   32   83-114    16-47  (50)
 56 PRK00420 hypothetical protein;  52.5     7.1 0.00015   24.7   0.8    9   67-75     25-33  (112)
 57 PF13639 zf-RING_2:  Ring finge  49.9      14  0.0003   18.6   1.6    7   88-94     23-29  (44)
 58 PF06827 zf-FPG_IleRS:  Zinc fi  49.4     4.4 9.5E-05   18.9  -0.4   11  104-114     3-13  (30)
 59 PF07191 zinc-ribbons_6:  zinc-  47.6      13 0.00027   21.5   1.3    9  105-113    53-61  (70)
 60 COG3813 Uncharacterized protei  46.4      34 0.00073   19.9   2.9   44   68-113     8-52  (84)
 61 PF13248 zf-ribbon_3:  zinc-rib  45.3      15 0.00032   16.5   1.1    9   40-48      4-12  (26)
 62 PF06750 DiS_P_DiS:  Bacterial   44.9     9.3  0.0002   23.2   0.5   36   38-75     33-68  (92)
 63 PRK14559 putative protein seri  44.0      13 0.00028   30.8   1.3   13   39-51      2-14  (645)
 64 KOG3002|consensus               43.8      22 0.00048   26.5   2.4   44   66-114    49-92  (299)
 65 PF12674 Zn_ribbon_2:  Putative  43.7      13 0.00027   22.1   0.9   30   68-97      3-35  (81)
 66 PF13240 zinc_ribbon_2:  zinc-r  43.5     6.1 0.00013   17.4  -0.4    6  107-112     4-9   (23)
 67 PF07503 zf-HYPF:  HypF finger;  42.0      10 0.00022   18.7   0.3   30   41-75      2-31  (35)
 68 PRK00807 50S ribosomal protein  41.9      17 0.00037   19.6   1.2   25  104-128     3-29  (52)
 69 COG4306 Uncharacterized protei  41.3      30 0.00066   22.4   2.4   46   89-138    29-76  (160)
 70 PLN03208 E3 ubiquitin-protein   40.6      63  0.0014   22.5   4.1   11  104-114    70-80  (193)
 71 TIGR00143 hypF [NiFe] hydrogen  40.1     9.6 0.00021   31.9   0.0   36   35-75     65-100 (711)
 72 PF04570 DUF581:  Protein of un  40.1      25 0.00053   19.5   1.6   29   67-95     18-47  (58)
 73 KOG2932|consensus               39.9      13 0.00029   27.9   0.7   44   67-114    92-135 (389)
 74 PF06689 zf-C4_ClpX:  ClpX C4-t  38.9      55  0.0012   16.5   2.8   30   67-96      3-32  (41)
 75 KOG0978|consensus               37.8      10 0.00022   31.5  -0.1   48   66-116   644-692 (698)
 76 PF14569 zf-UDP:  Zinc-binding   36.2      54  0.0012   19.3   2.7   23   88-111    36-60  (80)
 77 TIGR00599 rad18 DNA repair pro  36.2      34 0.00074   26.6   2.4   45   66-113    27-71  (397)
 78 KOG2114|consensus               35.7      18 0.00038   30.9   0.9   10  123-132   860-869 (933)
 79 PF14255 Cys_rich_CPXG:  Cystei  35.5      17 0.00036   19.7   0.5   28   40-67      2-29  (52)
 80 smart00291 ZnF_ZZ Zinc-binding  35.4      46 0.00099   16.9   2.2    9   89-97     28-36  (44)
 81 PF02069 Metallothio_Pro:  Prok  34.8      22 0.00047   19.3   0.9   28   67-96      9-37  (52)
 82 cd02249 ZZ Zinc finger, ZZ typ  34.6      51  0.0011   16.9   2.3    7   90-96     25-31  (46)
 83 PF00096 zf-C2H2:  Zinc finger,  34.2      10 0.00022   16.0  -0.4    8  131-138     1-8   (23)
 84 KOG3497|consensus               33.5      14  0.0003   20.6  -0.0   14   38-51      4-17  (69)
 85 KOG4739|consensus               33.4      40 0.00086   24.3   2.2   31   82-114    19-49  (233)
 86 COG2174 RPL34A Ribosomal prote  32.9      15 0.00032   22.3   0.0   20   95-114    27-46  (93)
 87 smart00746 TRASH metallochaper  32.4      48  0.0011   14.7   2.0   23  105-127     1-25  (39)
 88 TIGR00570 cdk7 CDK-activating   31.8      68  0.0015   24.1   3.3   29   86-114    26-55  (309)
 89 KOG2034|consensus               31.8      18 0.00038   31.0   0.3   30  102-131   817-846 (911)
 90 PF01194 RNA_pol_N:  RNA polyme  31.7      26 0.00057   19.5   0.9   14   38-51      4-17  (60)
 91 PF00097 zf-C3HC4:  Zinc finger  30.4      61  0.0013   15.7   2.2   17   83-99     14-30  (41)
 92 PHA02610 uvsY.-2 hypothetical   30.4      41 0.00089   18.1   1.5   25   39-63      2-26  (53)
 93 cd02336 ZZ_RSC8 Zinc finger, Z  29.8      39 0.00084   17.6   1.3   29   67-97      2-32  (45)
 94 PF04810 zf-Sec23_Sec24:  Sec23  29.8      37 0.00081   16.9   1.2   31   38-73      2-32  (40)
 95 PF00320 GATA:  GATA zinc finge  29.6      73  0.0016   15.4   2.3   16   81-96     12-28  (36)
 96 PF12677 DUF3797:  Domain of un  29.5      42 0.00092   17.8   1.4   27  104-130    15-42  (49)
 97 PLN00032 DNA-directed RNA poly  29.4      16 0.00035   21.1  -0.2   14   38-51      4-17  (71)
 98 PF00569 ZZ:  Zinc finger, ZZ t  29.3      58  0.0013   16.7   2.0   10   88-97     28-37  (46)
 99 cd00472 Ribosomal_L24e_L24 Rib  28.5      41  0.0009   18.3   1.3   25  103-127     4-30  (54)
100 COG1644 RPB10 DNA-directed RNA  28.4      19 0.00041   20.2  -0.0   14   38-51      4-17  (63)
101 smart00547 ZnF_RBZ Zinc finger  28.3      15 0.00032   16.2  -0.4    7  104-110    18-24  (26)
102 PF07649 C1_3:  C1-like domain;  28.0      37 0.00081   15.6   1.0    9   67-75      2-10  (30)
103 COG0266 Nei Formamidopyrimidin  27.6      35 0.00076   25.1   1.2   25  104-130   247-271 (273)
104 PF01927 Mut7-C:  Mut7-C RNAse   27.5      26 0.00056   23.0   0.5   35  104-138    93-132 (147)
105 KOG2893|consensus               27.5      22 0.00047   25.8   0.1   36   38-76     10-45  (341)
106 PF02591 DUF164:  Putative zinc  26.6      16 0.00034   19.7  -0.5   13   39-51     23-35  (56)
107 PF00130 C1_1:  Phorbol esters/  26.1      41  0.0009   17.5   1.1   13   37-49     10-22  (53)
108 PF13894 zf-C2H2_4:  C2H2-type   26.0      22 0.00047   14.6  -0.1    8  131-138     1-8   (24)
109 smart00214 VWC von Willebrand   25.4      52  0.0011   17.8   1.4   18  117-134     5-23  (59)
110 smart00184 RING Ring finger. E  25.4      31 0.00066   15.8   0.4   15  117-131    11-25  (39)
111 PF13834 DUF4193:  Domain of un  25.4      18 0.00039   22.3  -0.5   29   65-94     70-98  (99)
112 PLN02638 cellulose synthase A   25.3      79  0.0017   28.0   3.0   15   36-50     15-29  (1079)
113 PRK04016 DNA-directed RNA poly  25.2      26 0.00056   19.7   0.1   13   38-50      4-16  (62)
114 COG4357 Zinc finger domain con  24.8     7.6 0.00017   23.8  -2.1   17   59-75     56-72  (105)
115 PF07975 C1_4:  TFIIH C1-like d  23.8      27 0.00059   18.8   0.1   10  105-114     2-11  (51)
116 smart00531 TFIIE Transcription  23.6      22 0.00047   23.4  -0.4   37   37-76     98-134 (147)
117 PRK12775 putative trifunctiona  23.6      62  0.0013   28.4   2.2   32  104-138   798-829 (1006)
118 PF05502 Dynactin_p62:  Dynacti  23.5      46   0.001   26.6   1.3   37   39-76     27-63  (483)
119 PF04945 YHS:  YHS domain;  Int  23.4      28  0.0006   17.9   0.1   23  106-128     4-27  (47)
120 PRK11595 DNA utilization prote  23.4      93   0.002   22.0   2.8   10   39-48      6-15  (227)
121 TIGR00595 priA primosomal prot  23.4      34 0.00075   27.4   0.6   38   67-111   224-262 (505)
122 PRK14873 primosome assembly pr  22.7      38 0.00083   28.2   0.7   38   67-111   394-431 (665)
123 cd02341 ZZ_ZZZ3 Zinc finger, Z  22.4   1E+02  0.0022   16.2   2.1    9   89-97     27-35  (48)
124 PRK00398 rpoP DNA-directed RNA  22.0      41 0.00088   17.2   0.5   10   66-75     22-31  (46)
125 PLN03123 poly [ADP-ribose] pol  21.9      60  0.0013   28.5   1.7   29  104-132    19-57  (981)
126 cd02340 ZZ_NBR1_like Zinc fing  21.8      49  0.0011   16.9   0.8   11  104-114     2-12  (43)
127 PF14445 Prok-RING_2:  Prokaryo  21.5      12 0.00027   20.0  -1.5   24   87-113    29-52  (57)
128 KOG3039|consensus               21.5 3.4E+02  0.0074   20.0   5.6   84   33-116   178-273 (303)
129 KOG3476|consensus               21.4      28 0.00061   20.9  -0.2   37   67-115    56-92  (100)
130 PF08271 TF_Zn_Ribbon:  TFIIB z  21.0      47   0.001   16.7   0.6   10   66-75     20-29  (43)
131 COG4068 Uncharacterized protei  20.9      56  0.0012   18.1   0.9   13  104-116    10-22  (64)
132 PLN02195 cellulose synthase A   20.7 1.1E+02  0.0024   26.8   3.0   53   37-113     5-59  (977)

No 1  
>KOG1701|consensus
Probab=99.86  E-value=6.5e-23  Score=151.30  Aligned_cols=99  Identities=27%  Similarity=0.674  Sum_probs=87.9

Q ss_pred             CCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeE-eeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           36 QGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLY-TKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        36 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~-~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      .+..+|..|++.|.+. ++.++++.||+.||+|..|.+.|+  +..|. ..++++||..||+++|++  +|+.|+++|++
T Consensus       332 ~tlekC~~Cg~~I~d~-iLrA~GkayHp~CF~Cv~C~r~ld--gipFtvd~~n~v~Cv~dfh~kfAP--rCs~C~~PI~P  406 (468)
T KOG1701|consen  332 DTLEKCNKCGEPIMDR-ILRALGKAYHPGCFTCVVCARCLD--GIPFTVDSQNNVYCVPDFHKKFAP--RCSVCGNPILP  406 (468)
T ss_pred             HHHHHHhhhhhHHHHH-HHHhcccccCCCceEEEEeccccC--CccccccCCCceeeehhhhhhcCc--chhhccCCccC
Confidence            4567899999999998 789999999999999999999994  44555 578899999999999999  99999999988


Q ss_pred             Cce-----EEEeCCccccccccccccCCCC
Q psy284          115 FEM-----VMRARNNVYHLECFACQQCNHR  139 (139)
Q Consensus       115 ~~~-----~~~~~~~~~H~~Cf~C~~C~~~  139 (139)
                      .+.     .|+++++.||.+||+|+.|+.+
T Consensus       407 ~~G~~etvRvvamdr~fHv~CY~CEDCg~~  436 (468)
T KOG1701|consen  407 RDGKDETVRVVAMDRDFHVNCYKCEDCGLL  436 (468)
T ss_pred             CCCCcceEEEEEccccccccceehhhcCcc
Confidence            542     6789999999999999999863


No 2  
>KOG1044|consensus
Probab=99.86  E-value=1.4e-22  Score=154.15  Aligned_cols=123  Identities=31%  Similarity=0.706  Sum_probs=111.5

Q ss_pred             cCccccccccccc---ccCCCCCCCCCCCCCCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEee
Q psy284            9 HLKINRMSMDVKT---QQGAQQTKAVPNNAQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTK   85 (139)
Q Consensus         9 ~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~   85 (139)
                      -..+++++++++.   |+.+.+.+..+....+...|++|++.|.....+.++++.||..||+|..|+..|.   ..|+.+
T Consensus       101 f~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~---gey~sk  177 (670)
T KOG1044|consen  101 FKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLN---GEYMSK  177 (670)
T ss_pred             CCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhccceeeeeccceeeeeeehhhhccccc---ceeecc
Confidence            4567888888877   7777777777888888999999999999987788999999999999999999884   569999


Q ss_pred             CCccccHhhHHHHhCCCccccccCCCCCCCceEEEeCCccccccccccccCCC
Q psy284           86 ANLILCKRDYLRLFGSTGYCAACSKVIPAFEMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus        86 ~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                      ++.+||+.||...||.  +|..|.+.|.|  .++.|.|++|||.|-+|++|++
T Consensus       178 dg~pyce~dy~~~fgv--kc~~c~~fisg--kvLqag~kh~HPtCARCsRCgq  226 (670)
T KOG1044|consen  178 DGVPYCEKDYQAKFGV--KCEECEKFISG--KVLQAGDKHFHPTCARCSRCGQ  226 (670)
T ss_pred             CCCcchhhhhhhhcCe--ehHHhhhhhhh--hhhhccCcccCcchhhhhhhcc
Confidence            9999999999999999  99999999988  8999999999999999999985


No 3  
>KOG1701|consensus
Probab=99.82  E-value=2.8e-22  Score=147.92  Aligned_cols=95  Identities=27%  Similarity=0.645  Sum_probs=86.0

Q ss_pred             CCCcccccccccccc-eeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCCC
Q psy284           37 GPQECAGCGKHITDR-FLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPAF  115 (139)
Q Consensus        37 ~~~~C~~C~~~i~~~-~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~  115 (139)
                      ...+|.+|++.|.++ ..+.++++.||..||+|..|.+.|  .++.||..++++||+.||....   ++|..|+++|++ 
T Consensus       273 ~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L--~Gq~FY~v~~k~~CE~cyq~tl---ekC~~Cg~~I~d-  346 (468)
T KOG1701|consen  273 YFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQL--AGQSFYQVDGKPYCEGCYQDTL---EKCNKCGEPIMD-  346 (468)
T ss_pred             hhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhh--ccccccccCCcccchHHHHHHH---HHHhhhhhHHHH-
Confidence            344999999999985 447899999999999999999999  6789999999999999998754   389999999965 


Q ss_pred             ceEEEeCCccccccccccccCCC
Q psy284          116 EMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       116 ~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                       .+++|.|+.||+.||+|..|++
T Consensus       347 -~iLrA~GkayHp~CF~Cv~C~r  368 (468)
T KOG1701|consen  347 -RILRALGKAYHPGCFTCVVCAR  368 (468)
T ss_pred             -HHHHhcccccCCCceEEEEecc
Confidence             9999999999999999999986


No 4  
>KOG4577|consensus
Probab=99.82  E-value=3.3e-22  Score=141.21  Aligned_cols=101  Identities=42%  Similarity=0.950  Sum_probs=92.8

Q ss_pred             CCCCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCC
Q psy284           34 NAQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIP  113 (139)
Q Consensus        34 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~  113 (139)
                      .....++|++|.+.|.+.+++.++++.||..|++|+.|..+|+   ..++.+++.+||+++|.++||.  +|..|+..|.
T Consensus        29 ~~~eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~---drCFsR~~s~yCkedFfKrfGT--KCsaC~~GIp  103 (383)
T KOG4577|consen   29 SNVEIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLA---DRCFSREGSVYCKEDFFKRFGT--KCSACQEGIP  103 (383)
T ss_pred             cccccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHH---HHHhhcCCceeehHHHHHHhCC--cchhhcCCCC
Confidence            3446889999999999999999999999999999999999995   4689999999999999999999  9999999999


Q ss_pred             CCceEEEeCCccccccccccccCCCC
Q psy284          114 AFEMVMRARNNVYHLECFACQQCNHR  139 (139)
Q Consensus       114 ~~~~~~~~~~~~~H~~Cf~C~~C~~~  139 (139)
                      +...+..|.+..||.+||.|..|+++
T Consensus       104 PtqVVRkAqd~VYHl~CF~C~iC~R~  129 (383)
T KOG4577|consen  104 PTQVVRKAQDFVYHLHCFACFICKRQ  129 (383)
T ss_pred             hHHHHHHhhcceeehhhhhhHhhhcc
Confidence            96556679999999999999999875


No 5  
>KOG2272|consensus
Probab=99.76  E-value=3.7e-20  Score=128.82  Aligned_cols=97  Identities=32%  Similarity=0.789  Sum_probs=90.8

Q ss_pred             CCCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           35 AQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        35 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      ..+.++|+.|.++|.+. +|.++++.||.+.|+|..|.+++  .+.+.|.+.|..||+.+|.++||.  .|..|+..|.|
T Consensus       192 ~mgipiCgaC~rpIeer-vi~amgKhWHveHFvCa~CekPF--lGHrHYEkkGlaYCe~h~~qLfG~--~CF~C~~~i~G  266 (332)
T KOG2272|consen  192 KMGIPICGACRRPIEER-VIFAMGKHWHVEHFVCAKCEKPF--LGHRHYEKKGLAYCETHYHQLFGN--LCFICNRVIGG  266 (332)
T ss_pred             ccCCcccccccCchHHH-HHHHhccccchhheeehhcCCcc--cchhhhhhcCchhHHHHHHHHhhh--hheecCCccCc
Confidence            36788999999999986 68899999999999999999998  778899999999999999999999  99999999977


Q ss_pred             CceEEEeCCccccccccccccCCC
Q psy284          115 FEMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       115 ~~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                        .++.++++.|.++||.|+.|++
T Consensus       267 --~vv~al~KawCv~cf~Cs~Cdk  288 (332)
T KOG2272|consen  267 --DVVSALNKAWCVECFSCSTCDK  288 (332)
T ss_pred             --cHHHHhhhhhcccccccccccc
Confidence              7999999999999999999986


No 6  
>KOG2272|consensus
Probab=99.74  E-value=6.5e-20  Score=127.60  Aligned_cols=96  Identities=27%  Similarity=0.662  Sum_probs=86.9

Q ss_pred             CCCcccccccccccce-eeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCCC
Q psy284           37 GPQECAGCGKHITDRF-LLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPAF  115 (139)
Q Consensus        37 ~~~~C~~C~~~i~~~~-~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~  115 (139)
                      ....|.+|.......+ ++..++..||..||.|..|-.++  ++..||..+++.||+.++..+|+|  .|..|++.|.| 
T Consensus        11 ~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf--~~g~~~efEgRkYCEhDF~~LfaP--cC~kC~EFiiG-   85 (332)
T KOG2272|consen   11 ANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPF--PDGIFYEFEGRKYCEHDFHVLFAP--CCGKCGEFIIG-   85 (332)
T ss_pred             HHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcC--CCceeEEecCcccccccchhhhch--hhcccccchhh-
Confidence            3557999998887753 45678899999999999999999  678899999999999999999999  99999999988 


Q ss_pred             ceEEEeCCccccccccccccCCC
Q psy284          116 EMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       116 ~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                       ++|.+++..|||.||+|..|++
T Consensus        86 -rVikamnnSwHp~CF~Cd~Cn~  107 (332)
T KOG2272|consen   86 -RVIKAMNNSWHPACFRCDLCNK  107 (332)
T ss_pred             -HHHHhhccccCcccchhHHHHH
Confidence             8999999999999999999875


No 7  
>KOG1703|consensus
Probab=99.63  E-value=4.4e-17  Score=126.11  Aligned_cols=98  Identities=26%  Similarity=0.582  Sum_probs=89.0

Q ss_pred             CCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCCC
Q psy284           36 QGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPAF  115 (139)
Q Consensus        36 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~  115 (139)
                      ...+.|.+|+.+|.+. .|.+++..||++||.|..|...+  ....++..++.+||..||..++.+  +|..|.++|...
T Consensus       361 ~~~p~C~~C~~~i~~~-~v~a~~~~wH~~cf~C~~C~~~~--~~~~~~~~~~~pyce~~~~~~~~~--~~~~~~~p~~~~  435 (479)
T KOG1703|consen  361 PFRPNCKRCLLPILEE-GVCALGRLWHPECFVCADCGKPL--KNSSFFESDGEPYCEDHYKKLFTT--KCDYCKKPVEFG  435 (479)
T ss_pred             hhCccccccCCchHHh-HhhhccCeechhceeeecccCCC--CCCcccccCCccchhhhHhhhccc--cchhccchhHhh
Confidence            5567999999999997 57777999999999999998888  567899999999999999999998  999999998765


Q ss_pred             ceEEEeCCccccccccccccCCC
Q psy284          116 EMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       116 ~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                      +..+.+++..||..||+|+.|.+
T Consensus       436 ~~~ie~~~~~~h~~~F~c~~c~~  458 (479)
T KOG1703|consen  436 SRQIEADGSPFHGDCFRCANCMK  458 (479)
T ss_pred             hhHhhccCccccccceehhhhhc
Confidence            68899999999999999999975


No 8  
>KOG1703|consensus
Probab=99.56  E-value=1.4e-15  Score=117.75  Aligned_cols=97  Identities=24%  Similarity=0.502  Sum_probs=87.0

Q ss_pred             CCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCCC
Q psy284           36 QGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPAF  115 (139)
Q Consensus        36 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~  115 (139)
                      ...++|..|...|.+...+.+++..||..+|.|..|...+.  ...+...++++||..||.+.+.+  .|.+|+++|.+ 
T Consensus       301 ~~~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~--~~~~~~~~g~~~c~~~~~~~~~p--~C~~C~~~i~~-  375 (479)
T KOG1703|consen  301 VTRPLCLSCNQKIRSVKVIVALGKEWHPEHFSCEVCAIVIL--DGGPRELDGKILCHECFHAPFRP--NCKRCLLPILE-  375 (479)
T ss_pred             cccccccccccCcccceeEeeccccccccceeecccccccc--CCCccccCCCccHHHHHHHhhCc--cccccCCchHH-
Confidence            44589999999999944788999999999999999999985  34568899999999999999999  99999999976 


Q ss_pred             ceEEEeCCccccccccccccCCC
Q psy284          116 EMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       116 ~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                       .+|.+.++.||++||.|..|++
T Consensus       376 -~~v~a~~~~wH~~cf~C~~C~~  397 (479)
T KOG1703|consen  376 -EGVCALGRLWHPECFVCADCGK  397 (479)
T ss_pred             -hHhhhccCeechhceeeecccC
Confidence             8899999999999999999954


No 9  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.51  E-value=2.4e-14  Score=80.42  Aligned_cols=57  Identities=37%  Similarity=0.831  Sum_probs=50.3

Q ss_pred             ccccccccccceee-eecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHh
Q psy284           41 CAGCGKHITDRFLL-KALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLF   99 (139)
Q Consensus        41 C~~C~~~i~~~~~~-~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~   99 (139)
                      |.+|+++|.+...+ .++++.||++||+|..|+..|.  +..++..++++||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~--~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLN--DGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTT--TSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccC--CCeeEeECCEEECHHHHhhhC
Confidence            78999999986554 6999999999999999999995  345899999999999999875


No 10 
>KOG1044|consensus
Probab=99.27  E-value=4.7e-12  Score=97.34  Aligned_cols=92  Identities=27%  Similarity=0.677  Sum_probs=72.7

Q ss_pred             CCCCCCCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCC
Q psy284           31 VPNNAQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSK  110 (139)
Q Consensus        31 ~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~  110 (139)
                      ++........|..|.+.-... ++.+.++.||..||+|..|++.|++.  .|+.+++.        +++++    ..|..
T Consensus         9 s~~~~~~~i~c~~c~~kc~ge-vlrv~d~~fhi~cf~c~~cg~~la~~--gff~k~~~--------~~ygt----~~c~~   73 (670)
T KOG1044|consen    9 SPQTGKQGIKCDKCRKKCSGE-VLRVNDNHFHINCFQCKKCGRNLAEG--GFFTKPEN--------RLYGT----DDCRA   73 (670)
T ss_pred             CccccccceehhhhCCccccc-eeEeeccccceeeeeccccCCCcccc--cceecccc--------eeecc----cchhh
Confidence            344455567899999988886 78999999999999999999999743  36665554        33332    55777


Q ss_pred             CCCCCceEEEeCCccccccccccccCCCC
Q psy284          111 VIPAFEMVMRARNNVYHLECFACQQCNHR  139 (139)
Q Consensus       111 ~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~  139 (139)
                      .|.+  .+|.++|+.||++||.|+.|+++
T Consensus        74 ~~~g--evvsa~gktyh~~cf~cs~ck~p  100 (670)
T KOG1044|consen   74 FVEG--EVVSTLGKTYHPKCFSCSTCKSP  100 (670)
T ss_pred             hccc--eeEecccceeccccceecccCCC
Confidence            7766  89999999999999999999763


No 11 
>KOG1700|consensus
Probab=99.16  E-value=5e-12  Score=87.65  Aligned_cols=99  Identities=26%  Similarity=0.591  Sum_probs=81.9

Q ss_pred             CCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCc-------------
Q psy284           37 GPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTG-------------  103 (139)
Q Consensus        37 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~-------------  103 (139)
                      ....|..|++.++..+.+...+..||+.||.|..|...|.  ...+..+++.+||+.+|...+++.+             
T Consensus         6 ~~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~--~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~   83 (200)
T KOG1700|consen    6 TTDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLT--LSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGL   83 (200)
T ss_pred             ccchhhhccCcchHHHHHhccCcchhhhHHhccccccccc--cccccccccccccccchHhhhCcccccccccccccCCC
Confidence            3458999999999976677889999999999999999994  4567889999999997766554422             


Q ss_pred             --------------------------cccccCCCCCCCceEEEeCCccccccccccccCCC
Q psy284          104 --------------------------YCAACSKVIPAFEMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       104 --------------------------~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                                                .|..|++.+.+.| .+...+..||..||+|+.|+.
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~E-k~~~~~~~~hk~cfrc~~~~~  143 (200)
T KOG1700|consen   84 GKDGKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLE-KVTGNGLEFHKSCFRCTHCGK  143 (200)
T ss_pred             CcccccccccccccchhHHhhhccccccccccceeeehH-HHhhhhhhhhhhheeeccccc
Confidence                                      1999999998754 556789999999999999975


No 12 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=99.00  E-value=3.2e-10  Score=58.17  Aligned_cols=36  Identities=44%  Similarity=0.929  Sum_probs=32.3

Q ss_pred             cccccCCCCCCCceEEEeCCccccccccccccCCCC
Q psy284          104 YCAACSKVIPAFEMVMRARNNVYHLECFACQQCNHR  139 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~  139 (139)
                      +|.+|+++|.+.+..+.+.++.||++||+|..|+++
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~   36 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKP   36 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCc
Confidence            588999999886678899999999999999999864


No 13 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.00  E-value=3e-10  Score=63.58  Aligned_cols=35  Identities=40%  Similarity=0.921  Sum_probs=31.7

Q ss_pred             ccccCCCCCCCceEEEeCCccccccccccccCCCC
Q psy284          105 CAACSKVIPAFEMVMRARNNVYHLECFACQQCNHR  139 (139)
Q Consensus       105 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~  139 (139)
                      |..|+++|.+.+.++.+.++.||++||+|+.|+++
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~   35 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKP   35 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCB
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCc
Confidence            78999999987777789999999999999999863


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.63  E-value=2.6e-08  Score=50.87  Aligned_cols=36  Identities=47%  Similarity=1.104  Sum_probs=32.3

Q ss_pred             cccccccccccc-eeeeecCccccccCcccccCCCCc
Q psy284           40 ECAGCGKHITDR-FLLKALDMYWHEDCLKCGCCDCRL   75 (139)
Q Consensus        40 ~C~~C~~~i~~~-~~~~~~~~~~H~~Cf~C~~C~~~l   75 (139)
                      +|.+|++.|.+. ..+.+.+..||..||+|..|+..|
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L   37 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPL   37 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcC
Confidence            588999999986 567889999999999999999887


No 15 
>KOG4577|consensus
Probab=98.29  E-value=2e-07  Score=66.91  Aligned_cols=64  Identities=23%  Similarity=0.489  Sum_probs=51.2

Q ss_pred             CCcccccccccccceee-eecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCC
Q psy284           38 PQECAGCGKHITDRFLL-KALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGS  101 (139)
Q Consensus        38 ~~~C~~C~~~i~~~~~~-~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~  101 (139)
                      ..+|..|+..|-+..++ .+.+..||..||.|..|.+.|..++..|...+.++.|+++|+..-..
T Consensus        92 GTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k  156 (383)
T KOG4577|consen   92 GTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQK  156 (383)
T ss_pred             CCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhc
Confidence            45899999999886544 56788999999999999999985444444688999999999865433


No 16 
>KOG0490|consensus
Probab=98.01  E-value=3.4e-07  Score=64.75  Aligned_cols=91  Identities=47%  Similarity=0.998  Sum_probs=74.7

Q ss_pred             cccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHH--HhCCCccccccCCCCCCCceEEEe
Q psy284           44 CGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLR--LFGSTGYCAACSKVIPAFEMVMRA  121 (139)
Q Consensus        44 C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~--~~~~~~~C~~C~~~I~~~~~~~~~  121 (139)
                      |+..|.+.+.+.+.+..||..|..|..|...+..... .+..++..||..+|.+  .+..  +|.+|.+.|...|.+..+
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~g~~~~~~d~~~~~~~~~--rr~rt~~~~~ql~~ler~   78 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDT-CFSKDGSIYCKRDYQREFKFSK--RCARCKFTISQLDELERA   78 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCC-cccCCCcccccccchhhhhccc--cccCCCCCcCHHHHHHHh
Confidence            6677788766677799999999999999999963334 4444999999999998  6666  999999999877778888


Q ss_pred             CCccccccccccccCCC
Q psy284          122 RNNVYHLECFACQQCNH  138 (139)
Q Consensus       122 ~~~~~H~~Cf~C~~C~~  138 (139)
                      ..+. |.-||.|..|..
T Consensus        79 f~~~-h~Pd~~~r~~la   94 (235)
T KOG0490|consen   79 FEKV-HLPCFACRECLA   94 (235)
T ss_pred             hcCC-CcCccchHHHHh
Confidence            8888 999999988753


No 17 
>KOG1700|consensus
Probab=97.85  E-value=3.8e-06  Score=58.41  Aligned_cols=65  Identities=22%  Similarity=0.517  Sum_probs=54.8

Q ss_pred             CCCCCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHh
Q psy284           33 NNAQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLF   99 (139)
Q Consensus        33 ~~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~   99 (139)
                      ........|..|++.+++.+.+...+..||..||+|..|+..|.  ...+....+.+||...+..++
T Consensus       103 ~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls--~~~~~~~~g~l~~~~~~~~~~  167 (200)
T KOG1700|consen  103 VFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLS--PKNYAALEGVLYCKHHFAQLF  167 (200)
T ss_pred             hhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccC--CcchhhcCCccccchhhheee
Confidence            45566789999999999987788899999999999999999995  456788889999987766544


No 18 
>KOG1702|consensus
Probab=97.56  E-value=6.9e-06  Score=56.47  Aligned_cols=59  Identities=25%  Similarity=0.523  Sum_probs=50.0

Q ss_pred             CCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHH
Q psy284           38 PQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRL   98 (139)
Q Consensus        38 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~   98 (139)
                      ...|..|++.+++.+.+.-+++.||..||+|..|+..|++  ..+-..+.++||..+|.+.
T Consensus         4 k~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnm--KnyKgy~kkpycn~hYpkq   62 (264)
T KOG1702|consen    4 KCNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNM--KNYKGYDKKPYCNPHYPKQ   62 (264)
T ss_pred             cchhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhh--hhccccccCCCcCcccccc
Confidence            3457789999999777888999999999999999999963  4566789999999999653


No 19 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=93.43  E-value=0.06  Score=27.03  Aligned_cols=29  Identities=31%  Similarity=0.677  Sum_probs=22.5

Q ss_pred             ccccCCCCCCCceEEEeCCcccccccccc
Q psy284          105 CAACSKVIPAFEMVMRARNNVYHLECFAC  133 (139)
Q Consensus       105 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C  133 (139)
                      |.-|++.|.+.-.++...++.||--|-+|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC~tC   29 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCCPTC   29 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEECHHH
Confidence            67899999986568889999999544443


No 20 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=91.83  E-value=0.13  Score=31.67  Aligned_cols=29  Identities=24%  Similarity=0.504  Sum_probs=22.7

Q ss_pred             cccccCCCCCCCceEEEeCCccccccccc
Q psy284          104 YCAACSKVIPAFEMVMRARNNVYHLECFA  132 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~  132 (139)
                      .|..|+++|...-.++...|..+|..|+.
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            79999999977545666777889988863


No 21 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=89.49  E-value=0.25  Score=26.98  Aligned_cols=28  Identities=21%  Similarity=0.548  Sum_probs=22.1

Q ss_pred             cccccCCCCCCCceEEE--eCCcccccccc
Q psy284          104 YCAACSKVIPAFEMVMR--ARNNVYHLECF  131 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~--~~~~~~H~~Cf  131 (139)
                      +|..|+++|.+++.++.  .=+..||.+|+
T Consensus         7 ~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    7 KCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             cChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            89999999976555555  45688999998


No 22 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=87.31  E-value=0.25  Score=30.53  Aligned_cols=29  Identities=28%  Similarity=0.521  Sum_probs=22.2

Q ss_pred             cccccCCCCCCCceEEEeCCccccccccc
Q psy284          104 YCAACSKVIPAFEMVMRARNNVYHLECFA  132 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~  132 (139)
                      +|..|+++|...+..-...+..-|..||+
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~   32 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFR   32 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHH
Confidence            79999999987544444566888988886


No 23 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=87.13  E-value=0.43  Score=21.53  Aligned_cols=15  Identities=27%  Similarity=0.705  Sum_probs=9.7

Q ss_pred             ccccCCCCCCCceEE
Q psy284          105 CAACSKVIPAFEMVM  119 (139)
Q Consensus       105 C~~C~~~I~~~~~~~  119 (139)
                      |..|+..|.+.+..+
T Consensus         1 C~sC~~~i~~r~~~v   15 (24)
T PF07754_consen    1 CTSCGRPIAPREQAV   15 (24)
T ss_pred             CccCCCcccCcccCc
Confidence            667888887754333


No 24 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=86.90  E-value=1.5  Score=23.18  Aligned_cols=44  Identities=18%  Similarity=0.394  Sum_probs=29.3

Q ss_pred             ccccCCCCcccCCCeeEeeCCcc-ccHhhHHHHhCCCccccccCCCCC
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLI-LCKRDYLRLFGSTGYCAACSKVIP  113 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~-~C~~cy~~~~~~~~~C~~C~~~I~  113 (139)
                      .|..|.....   ...+..=+.. +|..|+.+.+....+|..|.++|.
T Consensus         4 ~C~iC~~~~~---~~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPR---DVVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBS---SEEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCC---ceEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            4555655542   3455667777 999999877544449999999985


No 25 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=84.54  E-value=0.35  Score=29.86  Aligned_cols=31  Identities=26%  Similarity=0.420  Sum_probs=23.4

Q ss_pred             cccccccccccceeeee-cCccccccCccccc
Q psy284           40 ECAGCGKHITDRFLLKA-LDMYWHEDCLKCGC   70 (139)
Q Consensus        40 ~C~~C~~~i~~~~~~~~-~~~~~H~~Cf~C~~   70 (139)
                      .|..|+++|+.++...+ .+...|..||+=..
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~   35 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFREKA   35 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHHHH
Confidence            69999999998766554 44678999998443


No 26 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=83.55  E-value=0.94  Score=27.77  Aligned_cols=32  Identities=25%  Similarity=0.589  Sum_probs=21.4

Q ss_pred             CCCCcccccccccccc-eeeeecCccccccCcc
Q psy284           36 QGPQECAGCGKHITDR-FLLKALDMYWHEDCLK   67 (139)
Q Consensus        36 ~~~~~C~~C~~~i~~~-~~~~~~~~~~H~~Cf~   67 (139)
                      .....|..|++.|... ..+.-.+..+|..|++
T Consensus        76 ~~~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   76 TESTKCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CCCCCccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            4456799999988875 3334456677877753


No 27 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=83.20  E-value=2.1  Score=23.43  Aligned_cols=46  Identities=9%  Similarity=0.048  Sum_probs=33.1

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      |.|..|...+.   ..+....|..||..+..+.+.....|..|++++..
T Consensus         2 ~~Cpi~~~~~~---~Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~   47 (63)
T smart00504        2 FLCPISLEVMK---DPVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTH   47 (63)
T ss_pred             cCCcCCCCcCC---CCEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCCh
Confidence            56777877774   23566778999999977655434489999988854


No 28 
>KOG0320|consensus
Probab=81.99  E-value=1.2  Score=30.51  Aligned_cols=52  Identities=25%  Similarity=0.446  Sum_probs=37.8

Q ss_pred             cccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           62 HEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        62 H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      -..+++|..|-....+. ..+..+-|.+||..|-........+|..|++.|.-
T Consensus       128 ~~~~~~CPiCl~~~sek-~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  128 KEGTYKCPICLDSVSEK-VPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             cccccCCCceecchhhc-cccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            34578998887776422 22446889999999987665444599999998864


No 29 
>KOG1813|consensus
Probab=81.27  E-value=0.79  Score=33.76  Aligned_cols=46  Identities=22%  Similarity=0.388  Sum_probs=36.8

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      |.|..|.....   ..+...-+..+|..|..+.|...++|..|++.+.+
T Consensus       242 f~c~icr~~f~---~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  242 FKCFICRKYFY---RPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             ccccccccccc---cchhhcCCceeehhhhccccccCCcceeccccccc
Confidence            77888887773   34566778899999999888665699999999976


No 30 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=80.52  E-value=1  Score=27.33  Aligned_cols=43  Identities=23%  Similarity=0.505  Sum_probs=29.5

Q ss_pred             cccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           60 YWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        60 ~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      .|-..--.|..|...+.        ..+..||..|..+    ++.|+-|++.|.+
T Consensus        39 Py~~~~~~C~~CK~~v~--------q~g~~YCq~CAYk----kGiCamCGKki~d   81 (90)
T PF10235_consen   39 PYAPYSSKCKICKTKVH--------QPGAKYCQTCAYK----KGICAMCGKKILD   81 (90)
T ss_pred             cccccCccccccccccc--------cCCCccChhhhcc----cCcccccCCeecc
Confidence            34443346777876663        2256799999655    4599999999965


No 31 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=77.77  E-value=1.3  Score=21.97  Aligned_cols=23  Identities=26%  Similarity=0.668  Sum_probs=15.4

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhh
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRD   94 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~c   94 (139)
                      +.|..|+..      .+...+|..||..|
T Consensus         9 ~~C~~C~~~------~~~~~dG~~yC~~c   31 (36)
T PF11781_consen    9 EPCPVCGSR------WFYSDDGFYYCDRC   31 (36)
T ss_pred             CcCCCCCCe------EeEccCCEEEhhhC
Confidence            346667643      36778888888666


No 32 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=77.23  E-value=2.8  Score=20.76  Aligned_cols=39  Identities=21%  Similarity=0.432  Sum_probs=20.9

Q ss_pred             cccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCcccccc
Q psy284           68 CGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAAC  108 (139)
Q Consensus        68 C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C  108 (139)
                      |..|...+  ........-|..||..|..+.+....+|..|
T Consensus         1 C~iC~~~~--~~~~~~~~CGH~fC~~C~~~~~~~~~~CP~C   39 (39)
T PF13923_consen    1 CPICLDEL--RDPVVVTPCGHSFCKECIEKYLEKNPKCPVC   39 (39)
T ss_dssp             ETTTTSB---SSEEEECTTSEEEEHHHHHHHHHCTSB-TTT
T ss_pred             CCCCCCcc--cCcCEECCCCCchhHHHHHHHHHCcCCCcCC
Confidence            34455555  2222456778888988877655432355443


No 33 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=77.18  E-value=1.9  Score=24.44  Aligned_cols=48  Identities=23%  Similarity=0.388  Sum_probs=21.4

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCCCce
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPAFEM  117 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~~~  117 (139)
                      ++|+.|...|.+  .-....-...||..|-...++.  .|..|+.|...+|.
T Consensus         8 LrCs~C~~~l~~--pv~l~~CeH~fCs~Ci~~~~~~--~CPvC~~Paw~qD~   55 (65)
T PF14835_consen    8 LRCSICFDILKE--PVCLGGCEHIFCSSCIRDCIGS--ECPVCHTPAWIQDI   55 (65)
T ss_dssp             TS-SSS-S--SS---B---SSS--B-TTTGGGGTTT--B-SSS--B-S-SS-
T ss_pred             cCCcHHHHHhcC--CceeccCccHHHHHHhHHhcCC--CCCCcCChHHHHHH
Confidence            567777776642  1123455577888887777777  89999988765443


No 34 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=77.14  E-value=1.2  Score=31.04  Aligned_cols=48  Identities=21%  Similarity=0.404  Sum_probs=37.8

Q ss_pred             cCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           64 DCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        64 ~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      .=|.|..|.....   ......-|..||..|+.+.|.....|..|++...|
T Consensus       195 IPF~C~iCKkdy~---spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G  242 (259)
T COG5152         195 IPFLCGICKKDYE---SPVVTECGHSFCSLCAIRKYQKGDECGVCGKATYG  242 (259)
T ss_pred             Cceeehhchhhcc---chhhhhcchhHHHHHHHHHhccCCcceecchhhcc
Confidence            3488999987774   33566778899999999988655599999998776


No 35 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=76.20  E-value=2.8  Score=28.00  Aligned_cols=50  Identities=16%  Similarity=0.293  Sum_probs=32.9

Q ss_pred             eCCccccHhhHHHHhCCCccccccCCCCCCCce--EEEeCCccccccccccccCCC
Q psy284           85 KANLILCKRDYLRLFGSTGYCAACSKVIPAFEM--VMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus        85 ~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~~~--~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                      ....-||..|-.+...   .|..|+.+|.|..-  .+...+..|++=- -|..|++
T Consensus        25 ~~~~~fC~kCG~~tI~---~Cp~C~~~IrG~y~v~gv~~~g~~~~~Ps-YC~~CGk   76 (158)
T PF10083_consen   25 ELREKFCSKCGAKTIT---SCPNCSTPIRGDYHVEGVFGLGGHYEAPS-YCHNCGK   76 (158)
T ss_pred             hHHHHHHHHhhHHHHH---HCcCCCCCCCCceecCCeeeeCCCCCCCh-hHHhCCC
Confidence            3446799999877764   79999999988421  1223456777422 3666765


No 36 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=75.64  E-value=5.2  Score=20.43  Aligned_cols=43  Identities=26%  Similarity=0.510  Sum_probs=23.7

Q ss_pred             cccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCC
Q psy284           68 CGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSK  110 (139)
Q Consensus        68 C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~  110 (139)
                      |..|..........+...=+..+|..|..+..+....|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            3344444421223444566778888888776622226777753


No 37 
>KOG3579|consensus
Probab=74.34  E-value=3.4  Score=30.45  Aligned_cols=36  Identities=19%  Similarity=0.529  Sum_probs=28.6

Q ss_pred             CCCCCCcccccccccccceeeeecCccccccCcccc
Q psy284           34 NAQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCG   69 (139)
Q Consensus        34 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~   69 (139)
                      .....-.|..|.+.+.|...+..-.-.-|+.||-|+
T Consensus       264 A~~apLcCTLC~ERLEDTHFVQCPSVp~HKFCFPCS  299 (352)
T KOG3579|consen  264 APSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCS  299 (352)
T ss_pred             CCCCceeehhhhhhhccCceeecCCCcccceecccC
Confidence            445556889999999998667777778899999875


No 38 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=73.45  E-value=3.9  Score=21.98  Aligned_cols=30  Identities=27%  Similarity=0.573  Sum_probs=21.6

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhHHHH
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDYLRL   98 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~   98 (139)
                      .|..|+..++... .+-..++ ..|.+|+.+.
T Consensus         1 ~C~iCg~kigl~~-~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFK-RFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCcccccccccc-ceeccCc-cchHHHHHHh
Confidence            4778888887432 3556777 7899999775


No 39 
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=71.34  E-value=5.8  Score=21.09  Aligned_cols=24  Identities=21%  Similarity=0.656  Sum_probs=12.2

Q ss_pred             ccccHhhHHHHhC-CCccccccCCC
Q psy284           88 LILCKRDYLRLFG-STGYCAACSKV  111 (139)
Q Consensus        88 ~~~C~~cy~~~~~-~~~~C~~C~~~  111 (139)
                      --.|..||.+... ..++|.+|.++
T Consensus        22 f~IC~~C~~~i~~~~~g~CPgCr~~   46 (48)
T PF14570_consen   22 FQICRFCYHDILENEGGRCPGCREP   46 (48)
T ss_dssp             ----HHHHHHHTTSS-SB-TTT--B
T ss_pred             CcHHHHHHHHHHhccCCCCCCCCCC
Confidence            3468999987763 35599999875


No 40 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=69.25  E-value=2.1  Score=26.14  Aligned_cols=29  Identities=24%  Similarity=0.447  Sum_probs=19.7

Q ss_pred             cccccCCCCCCCceEEEeCCccccccccc
Q psy284          104 YCAACSKVIPAFEMVMRARNNVYHLECFA  132 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~  132 (139)
                      +|..|+++|.-.+..-......-|-+||.
T Consensus         8 kC~VCg~~iieGqkFTF~~kGsVH~eCl~   36 (103)
T COG4847           8 KCYVCGGTIIEGQKFTFTKKGSVHYECLA   36 (103)
T ss_pred             eEeeeCCEeeeccEEEEeeCCcchHHHHH
Confidence            78889988865333333456778888875


No 41 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=69.00  E-value=3.9  Score=22.69  Aligned_cols=13  Identities=31%  Similarity=0.616  Sum_probs=8.2

Q ss_pred             cccccCCCCCCCc
Q psy284          104 YCAACSKVIPAFE  116 (139)
Q Consensus       104 ~C~~C~~~I~~~~  116 (139)
                      .|.+|+..|.+.+
T Consensus         9 ~CtSCg~~i~~~~   21 (59)
T PRK14890          9 KCTSCGIEIAPRE   21 (59)
T ss_pred             cccCCCCcccCCC
Confidence            5667776666544


No 42 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=67.16  E-value=3.2  Score=21.29  Aligned_cols=22  Identities=27%  Similarity=0.517  Sum_probs=13.4

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhh
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRD   94 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~c   94 (139)
                      .|..|+.+|      +..++++.||..|
T Consensus        19 ~Cp~C~~PL------~~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPL------MRDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCee------EEecCCCEECCCC
Confidence            455666565      3356777777654


No 43 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=66.46  E-value=4.6  Score=24.27  Aligned_cols=30  Identities=20%  Similarity=0.559  Sum_probs=16.8

Q ss_pred             cccccCCCCCCC-ceEEEeCCccccccccccccC
Q psy284          104 YCAACSKVIPAF-EMVMRARNNVYHLECFACQQC  136 (139)
Q Consensus       104 ~C~~C~~~I~~~-~~~~~~~~~~~H~~Cf~C~~C  136 (139)
                      .|.+|+.+|... ...+...|..-+   |.|..|
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~---FCC~GC   32 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERP---FCCPGC   32 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccc---cccHHH
Confidence            578888888532 234445554433   555554


No 44 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=66.32  E-value=15  Score=20.12  Aligned_cols=46  Identities=17%  Similarity=0.446  Sum_probs=28.8

Q ss_pred             ccccCCCCcccCC-CeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           67 KCGCCDCRLGEVG-STLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        67 ~C~~C~~~l~~~~-~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      .|..|++.|.... ..+.-.-.--||..|....+..  .|.-|+..+..
T Consensus         7 nCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~--~CPNCgGelv~   53 (57)
T PF06906_consen    7 NCECCDKDLPPDSPEAYICSFECTFCADCAETMLNG--VCPNCGGELVR   53 (57)
T ss_pred             CccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcC--cCcCCCCcccc
Confidence            3556677665221 1233233356889998888765  89999986643


No 45 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=66.15  E-value=3.2  Score=26.99  Aligned_cols=22  Identities=23%  Similarity=0.517  Sum_probs=15.8

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhH
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDY   95 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy   95 (139)
                      .|..|+.+|       |.++|.+||..|-
T Consensus        30 hCp~Cg~PL-------F~KdG~v~CPvC~   51 (131)
T COG1645          30 HCPKCGTPL-------FRKDGEVFCPVCG   51 (131)
T ss_pred             hCcccCCcc-------eeeCCeEECCCCC
Confidence            466677777       3388888887774


No 46 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=66.07  E-value=3.5  Score=34.17  Aligned_cols=84  Identities=19%  Similarity=0.336  Sum_probs=47.2

Q ss_pred             CCCCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           35 AQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        35 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      .+....|..|.+.|.+.     .++.|+----.|..|+-++.       +-+.-+|=.......--+  .|..|.+    
T Consensus        98 ~pD~a~C~~Cl~Ei~dp-----~~rrY~YPF~~CT~CGPRfT-------Ii~alPYDR~nTsM~~F~--lC~~C~~----  159 (750)
T COG0068          98 PPDAATCEDCLEEIFDP-----NSRRYLYPFINCTNCGPRFT-------IIEALPYDRENTSMADFP--LCPFCDK----  159 (750)
T ss_pred             CCchhhhHHHHHHhcCC-----CCcceeccccccCCCCccee-------eeccCCCCcccCccccCc--CCHHHHH----
Confidence            44566899999988885     35667766667888886553       222222221111111112  4555543    


Q ss_pred             CceEEEeCCccccccccccccCCC
Q psy284          115 FEMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       115 ~~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                        .+-...++.||..=..|..|+.
T Consensus       160 --EY~dP~nRRfHAQp~aCp~CGP  181 (750)
T COG0068         160 --EYKDPLNRRFHAQPIACPKCGP  181 (750)
T ss_pred             --HhcCccccccccccccCcccCC
Confidence              2333556777777677777763


No 47 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=66.07  E-value=9.6  Score=18.56  Aligned_cols=26  Identities=15%  Similarity=0.438  Sum_probs=13.6

Q ss_pred             CCccccHhhHHHHhCC-CccccccCCC
Q psy284           86 ANLILCKRDYLRLFGS-TGYCAACSKV  111 (139)
Q Consensus        86 ~~~~~C~~cy~~~~~~-~~~C~~C~~~  111 (139)
                      -+..||..|....+.. ...|..|...
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            4555666665443321 2257777654


No 48 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=65.71  E-value=3.1  Score=24.37  Aligned_cols=31  Identities=32%  Similarity=0.715  Sum_probs=18.9

Q ss_pred             CCCccccccccccccee-e----eec------CccccccCcc
Q psy284           37 GPQECAGCGKHITDRFL-L----KAL------DMYWHEDCLK   67 (139)
Q Consensus        37 ~~~~C~~C~~~i~~~~~-~----~~~------~~~~H~~Cf~   67 (139)
                      +-..|..|++.|..+.+ +    ...      ...||..||.
T Consensus         6 ~Ra~Ck~C~~~I~kg~lRiG~~~~~~~~~~~~~~W~H~~C~~   47 (82)
T PF00645_consen    6 GRAKCKGCKKKIAKGELRIGKIVPSPEGDGDIPKWYHWDCFF   47 (82)
T ss_dssp             STEBETTTSCBE-TTSEEEEEEEEETTSSCEEEEEEEHHHHH
T ss_pred             CCccCcccCCcCCCCCEEEEEEecccccCCCCCceECccccc
Confidence            34589999999976422 1    111      1467888876


No 49 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=64.63  E-value=1.2  Score=21.90  Aligned_cols=28  Identities=21%  Similarity=0.326  Sum_probs=13.0

Q ss_pred             cccCCCCcccCCCeeEeeCCccccHhhHHH
Q psy284           68 CGCCDCRLGEVGSTLYTKANLILCKRDYLR   97 (139)
Q Consensus        68 C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~   97 (139)
                      |..|+..+  +..+.....+..+|..|...
T Consensus         6 C~~CGe~I--~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    6 CEDCGEPI--PEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -TTTSSBE--EHHHHHHCTTECS-HHHHHH
T ss_pred             ccccCChH--HHHHHHhCCCcEECHHHhCc
Confidence            45555555  22334444555666666543


No 50 
>PF12773 DZR:  Double zinc ribbon
Probab=62.93  E-value=3.2  Score=21.79  Aligned_cols=9  Identities=22%  Similarity=0.652  Sum_probs=4.5

Q ss_pred             cccccCCCC
Q psy284          104 YCAACSKVI  112 (139)
Q Consensus       104 ~C~~C~~~I  112 (139)
                      .|..|+..+
T Consensus        31 ~C~~Cg~~~   39 (50)
T PF12773_consen   31 ICPNCGAEN   39 (50)
T ss_pred             CCcCCcCCC
Confidence            455555544


No 51 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=60.42  E-value=7.5  Score=21.16  Aligned_cols=26  Identities=19%  Similarity=0.356  Sum_probs=17.7

Q ss_pred             CcccccccccccceeeeecCcccccc
Q psy284           39 QECAGCGKHITDRFLLKALDMYWHED   64 (139)
Q Consensus        39 ~~C~~C~~~i~~~~~~~~~~~~~H~~   64 (139)
                      .+|..|+.+|.++..+...+...|+.
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~g   27 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHPG   27 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCcH
Confidence            46888888888865555555566654


No 52 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=59.12  E-value=3.9  Score=24.66  Aligned_cols=17  Identities=35%  Similarity=0.913  Sum_probs=13.6

Q ss_pred             hHHHHhCCCccccccCCCC
Q psy284           94 DYLRLFGSTGYCAACSKVI  112 (139)
Q Consensus        94 cy~~~~~~~~~C~~C~~~I  112 (139)
                      -|..+|..  .|..|++.+
T Consensus        48 sY~~lfs~--pC~~C~klL   64 (90)
T PF11571_consen   48 SYRNLFST--PCKKCGKLL   64 (90)
T ss_pred             HHhhhccc--hhhHHHhHh
Confidence            35667777  899999988


No 53 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=57.22  E-value=9.3  Score=21.25  Aligned_cols=17  Identities=24%  Similarity=0.620  Sum_probs=11.0

Q ss_pred             cccccCCCCCCCceEEE
Q psy284          104 YCAACSKVIPAFEMVMR  120 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~  120 (139)
                      .|.+|+..|.+.|..+.
T Consensus        11 ~CtSCg~~i~p~e~~v~   27 (61)
T COG2888          11 VCTSCGREIAPGETAVK   27 (61)
T ss_pred             eeccCCCEeccCCceeE
Confidence            78888877755455443


No 54 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=55.51  E-value=3.4  Score=28.85  Aligned_cols=31  Identities=13%  Similarity=0.238  Sum_probs=22.1

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHH
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRL   98 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~   98 (139)
                      -+|..|+...  ........+|+++|..||.+.
T Consensus       173 v~C~kCGE~~--~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELF--MEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCccc--ccchhhhcCCceecccccccc
Confidence            4677787776  444556778888898888643


No 55 
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=52.62  E-value=9.5  Score=20.24  Aligned_cols=32  Identities=19%  Similarity=0.463  Sum_probs=20.3

Q ss_pred             EeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           83 YTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        83 ~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      ..=.+..+|..|.....+....|..|+++++.
T Consensus        16 i~C~dHYLCl~CLt~ml~~s~~C~iC~~~LPt   47 (50)
T PF03854_consen   16 IKCSDHYLCLNCLTLMLSRSDRCPICGKPLPT   47 (50)
T ss_dssp             EE-SS-EEEHHHHHHT-SSSSEETTTTEE---
T ss_pred             eeecchhHHHHHHHHHhccccCCCcccCcCcc
Confidence            33445678888888777766699999998864


No 56 
>PRK00420 hypothetical protein; Validated
Probab=52.47  E-value=7.1  Score=24.70  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=4.2

Q ss_pred             ccccCCCCc
Q psy284           67 KCGCCDCRL   75 (139)
Q Consensus        67 ~C~~C~~~l   75 (139)
                      .|..|+.+|
T Consensus        25 ~CP~Cg~pL   33 (112)
T PRK00420         25 HCPVCGLPL   33 (112)
T ss_pred             CCCCCCCcc
Confidence            344455444


No 57 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=49.95  E-value=14  Score=18.62  Aligned_cols=7  Identities=0%  Similarity=0.059  Sum_probs=2.8

Q ss_pred             ccccHhh
Q psy284           88 LILCKRD   94 (139)
Q Consensus        88 ~~~C~~c   94 (139)
                      ..|+..|
T Consensus        23 H~fh~~C   29 (44)
T PF13639_consen   23 HVFHRSC   29 (44)
T ss_dssp             EEEEHHH
T ss_pred             CeeCHHH
Confidence            3344444


No 58 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=49.39  E-value=4.4  Score=18.90  Aligned_cols=11  Identities=27%  Similarity=0.612  Sum_probs=5.9

Q ss_pred             cccccCCCCCC
Q psy284          104 YCAACSKVIPA  114 (139)
Q Consensus       104 ~C~~C~~~I~~  114 (139)
                      +|..|...|..
T Consensus         3 ~C~rC~~~~~~   13 (30)
T PF06827_consen    3 KCPRCWNYIED   13 (30)
T ss_dssp             B-TTT--BBEE
T ss_pred             cCccCCCcceE
Confidence            78889888743


No 59 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=47.64  E-value=13  Score=21.49  Aligned_cols=9  Identities=33%  Similarity=0.992  Sum_probs=2.8

Q ss_pred             ccccCCCCC
Q psy284          105 CAACSKVIP  113 (139)
Q Consensus       105 C~~C~~~I~  113 (139)
                      |..|+..|.
T Consensus        53 C~~c~gLiS   61 (70)
T PF07191_consen   53 CNHCHGLIS   61 (70)
T ss_dssp             -TTTT-EE-
T ss_pred             eccCCceee
Confidence            444444443


No 60 
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.42  E-value=34  Score=19.87  Aligned_cols=44  Identities=18%  Similarity=0.418  Sum_probs=26.4

Q ss_pred             cccCCCCccc-CCCeeEeeCCccccHhhHHHHhCCCccccccCCCCC
Q psy284           68 CGCCDCRLGE-VGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIP  113 (139)
Q Consensus        68 C~~C~~~l~~-~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~  113 (139)
                      |..|++.|.- .+....-.-.--||.+|...++..  .|..|+..+.
T Consensus         8 CECCDrDLpp~s~dA~ICtfEcTFCadCae~~l~g--~CPnCGGelv   52 (84)
T COG3813           8 CECCDRDLPPDSTDARICTFECTFCADCAENRLHG--LCPNCGGELV   52 (84)
T ss_pred             CcccCCCCCCCCCceeEEEEeeehhHhHHHHhhcC--cCCCCCchhh
Confidence            4556666641 111122222345788898888776  8999987654


No 61 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=45.27  E-value=15  Score=16.53  Aligned_cols=9  Identities=44%  Similarity=1.125  Sum_probs=4.1

Q ss_pred             ccccccccc
Q psy284           40 ECAGCGKHI   48 (139)
Q Consensus        40 ~C~~C~~~i   48 (139)
                      .|..|+..|
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            344454433


No 62 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=44.86  E-value=9.3  Score=23.17  Aligned_cols=36  Identities=19%  Similarity=0.469  Sum_probs=17.1

Q ss_pred             CCcccccccccccceeeeecCccccccCcccccCCCCc
Q psy284           38 PQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRL   75 (139)
Q Consensus        38 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l   75 (139)
                      ...|..|++.+.-.+.+-+.+-.+..  -+|..|+.++
T Consensus        33 rS~C~~C~~~L~~~~lIPi~S~l~lr--GrCr~C~~~I   68 (92)
T PF06750_consen   33 RSHCPHCGHPLSWWDLIPILSYLLLR--GRCRYCGAPI   68 (92)
T ss_pred             CCcCcCCCCcCcccccchHHHHHHhC--CCCcccCCCC
Confidence            34666666666554444433322222  2444455554


No 63 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=44.01  E-value=13  Score=30.84  Aligned_cols=13  Identities=15%  Similarity=0.358  Sum_probs=8.5

Q ss_pred             Ccccccccccccc
Q psy284           39 QECAGCGKHITDR   51 (139)
Q Consensus        39 ~~C~~C~~~i~~~   51 (139)
                      .+|..|+..+.+.
T Consensus         2 ~~Cp~Cg~~n~~~   14 (645)
T PRK14559          2 LICPQCQFENPNN   14 (645)
T ss_pred             CcCCCCCCcCCCC
Confidence            3677887766553


No 64 
>KOG3002|consensus
Probab=43.80  E-value=22  Score=26.54  Aligned_cols=44  Identities=18%  Similarity=0.357  Sum_probs=30.3

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      +.|..|...|  ....+.-.+|.+.|..|-.++..   +|..|..+|..
T Consensus        49 leCPvC~~~l--~~Pi~QC~nGHlaCssC~~~~~~---~CP~Cr~~~g~   92 (299)
T KOG3002|consen   49 LDCPVCFNPL--SPPIFQCDNGHLACSSCRTKVSN---KCPTCRLPIGN   92 (299)
T ss_pred             ccCchhhccC--cccceecCCCcEehhhhhhhhcc---cCCcccccccc
Confidence            5666777777  33456677888888888654332   78888888853


No 65 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=43.67  E-value=13  Score=22.08  Aligned_cols=30  Identities=17%  Similarity=0.287  Sum_probs=15.7

Q ss_pred             cccCCCCcccCC---CeeEeeCCccccHhhHHH
Q psy284           68 CGCCDCRLGEVG---STLYTKANLILCKRDYLR   97 (139)
Q Consensus        68 C~~C~~~l~~~~---~~~~~~~~~~~C~~cy~~   97 (139)
                      |..|+.+|....   ..-....+.-||.-||..
T Consensus         3 CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    3 CQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             CCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            667777775211   111122334588888753


No 66 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=43.47  E-value=6.1  Score=17.41  Aligned_cols=6  Identities=33%  Similarity=0.739  Sum_probs=2.2

Q ss_pred             ccCCCC
Q psy284          107 ACSKVI  112 (139)
Q Consensus       107 ~C~~~I  112 (139)
                      .|+..|
T Consensus         4 ~CG~~~    9 (23)
T PF13240_consen    4 NCGAEI    9 (23)
T ss_pred             ccCCCC
Confidence            333333


No 67 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=42.03  E-value=10  Score=18.66  Aligned_cols=30  Identities=27%  Similarity=0.569  Sum_probs=17.3

Q ss_pred             ccccccccccceeeeecCccccccCcccccCCCCc
Q psy284           41 CAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRL   75 (139)
Q Consensus        41 C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l   75 (139)
                      |..|.+.+.+.     .++.||-.-..|..|+-++
T Consensus         2 C~~C~~Ey~~p-----~~RR~~~~~isC~~CGPr~   31 (35)
T PF07503_consen    2 CDDCLKEYFDP-----SNRRFHYQFISCTNCGPRY   31 (35)
T ss_dssp             -HHHHHHHCST-----TSTTTT-TT--BTTCC-SC
T ss_pred             CHHHHHHHcCC-----CCCcccCcCccCCCCCCCE
Confidence            55666555443     4788898888899998665


No 68 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=41.91  E-value=17  Score=19.56  Aligned_cols=25  Identities=16%  Similarity=0.307  Sum_probs=17.6

Q ss_pred             cccccCCCCCCCce--EEEeCCccccc
Q psy284          104 YCAACSKVIPAFEM--VMRARNNVYHL  128 (139)
Q Consensus       104 ~C~~C~~~I~~~~~--~~~~~~~~~H~  128 (139)
                      .|.-|+..|.+...  ++..+|+.|.-
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~Dgkv~~F   29 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKDGTILYF   29 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeCCcEEEE
Confidence            68888888885333  35677888873


No 69 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.27  E-value=30  Score=22.38  Aligned_cols=46  Identities=20%  Similarity=0.372  Sum_probs=24.8

Q ss_pred             cccHhhHHHHhCCCccccccCCCCCCCce--EEEeCCccccccccccccCCC
Q psy284           89 ILCKRDYLRLFGSTGYCAACSKVIPAFEM--VMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus        89 ~~C~~cy~~~~~~~~~C~~C~~~I~~~~~--~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                      .||..|-.....   .|..|+.+|.|..-  .+.-+|..|-+--| |..|++
T Consensus        29 afcskcgeati~---qcp~csasirgd~~vegvlglg~dye~psf-chncgs   76 (160)
T COG4306          29 AFCSKCGEATIT---QCPICSASIRGDYYVEGVLGLGGDYEPPSF-CHNCGS   76 (160)
T ss_pred             HHHhhhchHHHh---cCCccCCcccccceeeeeeccCCCCCCcch-hhcCCC
Confidence            456666544332   57888888877321  22245566655433 555554


No 70 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=40.55  E-value=63  Score=22.55  Aligned_cols=11  Identities=18%  Similarity=0.670  Sum_probs=9.6

Q ss_pred             cccccCCCCCC
Q psy284          104 YCAACSKVIPA  114 (139)
Q Consensus       104 ~C~~C~~~I~~  114 (139)
                      .|..|...|..
T Consensus        70 ~CPvCR~~Is~   80 (193)
T PLN03208         70 KCPVCKSDVSE   80 (193)
T ss_pred             cCCCCCCcCCh
Confidence            79999999975


No 71 
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=40.14  E-value=9.6  Score=31.89  Aligned_cols=36  Identities=19%  Similarity=0.478  Sum_probs=25.8

Q ss_pred             CCCCCcccccccccccceeeeecCccccccCcccccCCCCc
Q psy284           35 AQGPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRL   75 (139)
Q Consensus        35 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l   75 (139)
                      ......|..|.+.+.+.     .++.|+---..|..|+-+.
T Consensus        65 ppD~a~C~~Cl~E~~dp-----~~Rry~YpF~nCt~CGPr~  100 (711)
T TIGR00143        65 PADVATCSDCLEEMLDK-----NDRRYLYPFISCTHCGPRF  100 (711)
T ss_pred             CCchhhHHHHHHHhcCC-----CcccccCCcccccCCCCCe
Confidence            34466899999988775     2566766666788887654


No 72 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=40.14  E-value=25  Score=19.49  Aligned_cols=29  Identities=14%  Similarity=0.267  Sum_probs=18.5

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccH-hhH
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCK-RDY   95 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~-~cy   95 (139)
                      .|..|++.|......|..+..+.+|. .|-
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS~ECR   47 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCSEECR   47 (58)
T ss_pred             HHHccCCCCCCCCCeeeeccccccccHHHH
Confidence            45668888874344455677788884 553


No 73 
>KOG2932|consensus
Probab=39.87  E-value=13  Score=27.87  Aligned_cols=44  Identities=14%  Similarity=0.283  Sum_probs=28.8

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      -|..|+.++..  ..-.+.-+..||.+|...--.+  .|..|...|.-
T Consensus        92 fCd~Cd~PI~I--YGRmIPCkHvFCl~CAr~~~dK--~Cp~C~d~Vqr  135 (389)
T KOG2932|consen   92 FCDRCDFPIAI--YGRMIPCKHVFCLECARSDSDK--ICPLCDDRVQR  135 (389)
T ss_pred             eecccCCccee--eecccccchhhhhhhhhcCccc--cCcCcccHHHH
Confidence            46678877731  2223556778898886543334  89999987743


No 74 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=38.91  E-value=55  Score=16.48  Aligned_cols=30  Identities=20%  Similarity=0.418  Sum_probs=13.7

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhHH
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDYL   96 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~   96 (139)
                      +|+-|+++-.+.+..+...++...|..|-.
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVE   32 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHH
Confidence            466666665533333333335666776654


No 75 
>KOG0978|consensus
Probab=37.81  E-value=10  Score=31.55  Aligned_cols=48  Identities=23%  Similarity=0.542  Sum_probs=31.1

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHHhC-CCccccccCCCCCCCc
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFG-STGYCAACSKVIPAFE  116 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~-~~~~C~~C~~~I~~~~  116 (139)
                      ++|..|+..+-   ......-+..||..|-..+|. .+.+|..|+.+..+.|
T Consensus       644 LkCs~Cn~R~K---d~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganD  692 (698)
T KOG0978|consen  644 LKCSVCNTRWK---DAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGAND  692 (698)
T ss_pred             eeCCCccCchh---hHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCccc
Confidence            57777775552   234456667788888665543 2237999998876644


No 76 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=36.16  E-value=54  Score=19.33  Aligned_cols=23  Identities=26%  Similarity=0.619  Sum_probs=9.7

Q ss_pred             ccccHhhHH--HHhCCCccccccCCC
Q psy284           88 LILCKRDYL--RLFGSTGYCAACSKV  111 (139)
Q Consensus        88 ~~~C~~cy~--~~~~~~~~C~~C~~~  111 (139)
                      -+.|+.||.  ++-+.+ .|.+|+.+
T Consensus        36 fPvCr~CyEYErkeg~q-~CpqCkt~   60 (80)
T PF14569_consen   36 FPVCRPCYEYERKEGNQ-VCPQCKTR   60 (80)
T ss_dssp             ----HHHHHHHHHTS-S-B-TTT--B
T ss_pred             CccchhHHHHHhhcCcc-cccccCCC
Confidence            345888864  455532 68888853


No 77 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=36.15  E-value=34  Score=26.64  Aligned_cols=45  Identities=18%  Similarity=0.368  Sum_probs=22.0

Q ss_pred             cccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCC
Q psy284           66 LKCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIP  113 (139)
Q Consensus        66 f~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~  113 (139)
                      +.|..|...+.   ......-+..||..|....+.....|..|...+.
T Consensus        27 l~C~IC~d~~~---~PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~~   71 (397)
T TIGR00599        27 LRCHICKDFFD---VPVLTSCSHTFCSLCIRRCLSNQPKCPLCRAEDQ   71 (397)
T ss_pred             cCCCcCchhhh---CccCCCCCCchhHHHHHHHHhCCCCCCCCCCccc
Confidence            44555544442   1122344555666665544433335777776653


No 78 
>KOG2114|consensus
Probab=35.69  E-value=18  Score=30.89  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=5.0

Q ss_pred             Cccccccccc
Q psy284          123 NNVYHLECFA  132 (139)
Q Consensus       123 ~~~~H~~Cf~  132 (139)
                      ++.||.+||.
T Consensus       860 gHsyHqhC~e  869 (933)
T KOG2114|consen  860 GHSYHQHCLE  869 (933)
T ss_pred             ccHHHHHhhc
Confidence            4555555544


No 79 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=35.53  E-value=17  Score=19.66  Aligned_cols=28  Identities=32%  Similarity=0.451  Sum_probs=13.7

Q ss_pred             cccccccccccceeeeecCccccccCcc
Q psy284           40 ECAGCGKHITDRFLLKALDMYWHEDCLK   67 (139)
Q Consensus        40 ~C~~C~~~i~~~~~~~~~~~~~H~~Cf~   67 (139)
                      .|+.|++.+.-.-=....++.|-.+|-.
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiEDC~v   29 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIEDCQV   29 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEeehhh
Confidence            4677777654420022234555555544


No 80 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=35.42  E-value=46  Score=16.93  Aligned_cols=9  Identities=22%  Similarity=0.608  Sum_probs=5.5

Q ss_pred             cccHhhHHH
Q psy284           89 ILCKRDYLR   97 (139)
Q Consensus        89 ~~C~~cy~~   97 (139)
                      -+|..||..
T Consensus        28 dlC~~Cf~~   36 (44)
T smart00291       28 DLCQSCFAK   36 (44)
T ss_pred             cchHHHHhC
Confidence            357777654


No 81 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=34.78  E-value=22  Score=19.25  Aligned_cols=28  Identities=18%  Similarity=0.417  Sum_probs=13.8

Q ss_pred             ccccCCCCcccCCCeeEeeCCcccc-HhhHH
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILC-KRDYL   96 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C-~~cy~   96 (139)
                      .|..|...+.  ...-+.++++.|| ..|..
T Consensus         9 aC~~C~C~V~--~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen    9 ACPSCSCVVS--EEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             SSTT----B---TTTSEESSS-EESSHHHHH
T ss_pred             cCCCCEeEEC--chHhHHhCCEeeecHHHhc
Confidence            4556666664  2345778899999 45543


No 82 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=34.58  E-value=51  Score=16.88  Aligned_cols=7  Identities=43%  Similarity=0.894  Sum_probs=3.4

Q ss_pred             ccHhhHH
Q psy284           90 LCKRDYL   96 (139)
Q Consensus        90 ~C~~cy~   96 (139)
                      +|..||.
T Consensus        25 LC~~Cf~   31 (46)
T cd02249          25 LCSSCYA   31 (46)
T ss_pred             CHHHHHC
Confidence            4555543


No 83 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=34.23  E-value=10  Score=16.01  Aligned_cols=8  Identities=25%  Similarity=1.107  Sum_probs=4.6

Q ss_pred             cccccCCC
Q psy284          131 FACQQCNH  138 (139)
Q Consensus       131 f~C~~C~~  138 (139)
                      |.|..|++
T Consensus         1 y~C~~C~~    8 (23)
T PF00096_consen    1 YKCPICGK    8 (23)
T ss_dssp             EEETTTTE
T ss_pred             CCCCCCCC
Confidence            45666654


No 84 
>KOG3497|consensus
Probab=33.51  E-value=14  Score=20.64  Aligned_cols=14  Identities=50%  Similarity=1.042  Sum_probs=11.0

Q ss_pred             CCcccccccccccc
Q psy284           38 PQECAGCGKHITDR   51 (139)
Q Consensus        38 ~~~C~~C~~~i~~~   51 (139)
                      +.+|+.|++.|.+.
T Consensus         4 PiRCFtCGKvig~K   17 (69)
T KOG3497|consen    4 PIRCFTCGKVIGDK   17 (69)
T ss_pred             eeEeeecccccccc
Confidence            35799999988874


No 85 
>KOG4739|consensus
Probab=33.43  E-value=40  Score=24.26  Aligned_cols=31  Identities=19%  Similarity=0.362  Sum_probs=23.6

Q ss_pred             eEeeCCccccHhhHHHHhCCCccccccCCCCCC
Q psy284           82 LYTKANLILCKRDYLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        82 ~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~  114 (139)
                      |..--..++|..|...-.+.  .|..|+++|..
T Consensus        19 ~LTaC~HvfC~~C~k~~~~~--~C~lCkk~ir~   49 (233)
T KOG4739|consen   19 FLTACRHVFCEPCLKASSPD--VCPLCKKSIRI   49 (233)
T ss_pred             eeeechhhhhhhhcccCCcc--ccccccceeee
Confidence            33466778899998776666  89999998744


No 86 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=32.86  E-value=15  Score=22.29  Aligned_cols=20  Identities=20%  Similarity=0.426  Sum_probs=14.6

Q ss_pred             HHHHhCCCccccccCCCCCC
Q psy284           95 YLRLFGSTGYCAACSKVIPA  114 (139)
Q Consensus        95 y~~~~~~~~~C~~C~~~I~~  114 (139)
                      |+++.....+|+.|+.++.|
T Consensus        27 ~~kK~~~~p~C~~cg~pL~G   46 (93)
T COG2174          27 YEKKKPTIPKCAICGRPLGG   46 (93)
T ss_pred             eeeccCCCCcccccCCccCC
Confidence            44555555599999999866


No 87 
>smart00746 TRASH metallochaperone-like domain.
Probab=32.38  E-value=48  Score=14.68  Aligned_cols=23  Identities=22%  Similarity=0.411  Sum_probs=13.1

Q ss_pred             ccccCCCCC-CC-ceEEEeCCcccc
Q psy284          105 CAACSKVIP-AF-EMVMRARNNVYH  127 (139)
Q Consensus       105 C~~C~~~I~-~~-~~~~~~~~~~~H  127 (139)
                      |..|+..|. .. ...+...++.||
T Consensus         1 c~~C~~~~~~~~~~~~~~~~g~~~~   25 (39)
T smart00746        1 CSFCGKDIYNPGTGIMVVNDGKVFY   25 (39)
T ss_pred             CCCCCCCccCCCCceEEEECCEEEE
Confidence            566777775 22 223346666665


No 88 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.81  E-value=68  Score=24.14  Aligned_cols=29  Identities=24%  Similarity=0.487  Sum_probs=19.5

Q ss_pred             CCccccHhhHHHHhC-CCccccccCCCCCC
Q psy284           86 ANLILCKRDYLRLFG-STGYCAACSKVIPA  114 (139)
Q Consensus        86 ~~~~~C~~cy~~~~~-~~~~C~~C~~~I~~  114 (139)
                      -|..+|..|..+.|. ..+.|..|+.++..
T Consensus        26 CGH~~C~sCv~~l~~~~~~~CP~C~~~lrk   55 (309)
T TIGR00570        26 CGHTLCESCVDLLFVRGSGSCPECDTPLRK   55 (309)
T ss_pred             CCCcccHHHHHHHhcCCCCCCCCCCCccch
Confidence            455667777766552 22379999988865


No 89 
>KOG2034|consensus
Probab=31.77  E-value=18  Score=30.96  Aligned_cols=30  Identities=13%  Similarity=0.456  Sum_probs=24.4

Q ss_pred             CccccccCCCCCCCceEEEeCCcccccccc
Q psy284          102 TGYCAACSKVIPAFEMVMRARNNVYHLECF  131 (139)
Q Consensus       102 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf  131 (139)
                      ...|..|.++|...-+++..-|+.||.+|.
T Consensus       817 ~d~C~~C~~~ll~~pF~vf~CgH~FH~~Cl  846 (911)
T KOG2034|consen  817 QDSCDHCGRPLLIKPFYVFPCGHCFHRDCL  846 (911)
T ss_pred             ccchHHhcchhhcCcceeeeccchHHHHHH
Confidence            347999999998766788888999998874


No 90 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=31.69  E-value=26  Score=19.54  Aligned_cols=14  Identities=43%  Similarity=0.992  Sum_probs=9.5

Q ss_pred             CCcccccccccccc
Q psy284           38 PQECAGCGKHITDR   51 (139)
Q Consensus        38 ~~~C~~C~~~i~~~   51 (139)
                      +.+|+.||++|.+.
T Consensus         4 PVRCFTCGkvi~~~   17 (60)
T PF01194_consen    4 PVRCFTCGKVIGNK   17 (60)
T ss_dssp             SSS-STTTSBTCGH
T ss_pred             ceecCCCCCChhHh
Confidence            45788888888763


No 91 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=30.45  E-value=61  Score=15.70  Aligned_cols=17  Identities=6%  Similarity=0.194  Sum_probs=10.4

Q ss_pred             EeeCCccccHhhHHHHh
Q psy284           83 YTKANLILCKRDYLRLF   99 (139)
Q Consensus        83 ~~~~~~~~C~~cy~~~~   99 (139)
                      ...=+..||..|..+.+
T Consensus        14 ~~~C~H~fC~~C~~~~~   30 (41)
T PF00097_consen   14 LLPCGHSFCRDCLRKWL   30 (41)
T ss_dssp             ETTTSEEEEHHHHHHHH
T ss_pred             EecCCCcchHHHHHHHH
Confidence            44556667777765543


No 92 
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=30.43  E-value=41  Score=18.12  Aligned_cols=25  Identities=16%  Similarity=0.309  Sum_probs=15.4

Q ss_pred             CcccccccccccceeeeecCccccc
Q psy284           39 QECAGCGKHITDRFLLKALDMYWHE   63 (139)
Q Consensus        39 ~~C~~C~~~i~~~~~~~~~~~~~H~   63 (139)
                      .+|..|+.+|..+..+.......|+
T Consensus         2 ~iCvvCK~Pi~~al~v~T~~Gpvh~   26 (53)
T PHA02610          2 KICVVCKQPIEKALVVETEKGPVHP   26 (53)
T ss_pred             ceeeeeCCchhhceEEecCCCCCCC
Confidence            3677888888666445444445554


No 93 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=29.81  E-value=39  Score=17.58  Aligned_cols=29  Identities=17%  Similarity=0.274  Sum_probs=15.6

Q ss_pred             ccccCCCCcccCCCeeEe--eCCccccHhhHHH
Q psy284           67 KCGCCDCRLGEVGSTLYT--KANLILCKRDYLR   97 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~--~~~~~~C~~cy~~   97 (139)
                      .|..|+..+.  .-+|.-  ..+..+|..||.+
T Consensus         2 ~C~~Cg~D~t--~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCT--RVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccC--ceEEEecCCCccccChHHHhC
Confidence            3556666662  222221  2235678888875


No 94 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=29.80  E-value=37  Score=16.95  Aligned_cols=31  Identities=16%  Similarity=0.381  Sum_probs=14.3

Q ss_pred             CCcccccccccccceeeeecCccccccCcccccCCC
Q psy284           38 PQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDC   73 (139)
Q Consensus        38 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~   73 (139)
                      +.+|..|+..|.+--.+...++.     ++|..|+.
T Consensus         2 p~rC~~C~aylNp~~~~~~~~~~-----w~C~~C~~   32 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFCQFDDGGKT-----WICNFCGT   32 (40)
T ss_dssp             S-B-TTT--BS-TTSEEETTTTE-----EEETTT--
T ss_pred             ccccCCCCCEECCcceEcCCCCE-----EECcCCCC
Confidence            46888998888774234333444     46777764


No 95 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=29.65  E-value=73  Score=15.45  Aligned_cols=16  Identities=19%  Similarity=-0.039  Sum_probs=10.3

Q ss_pred             eeEeeCCcc-ccHhhHH
Q psy284           81 TLYTKANLI-LCKRDYL   96 (139)
Q Consensus        81 ~~~~~~~~~-~C~~cy~   96 (139)
                      .....++.. +|..|..
T Consensus        12 WR~~~~g~~~LCn~Cg~   28 (36)
T PF00320_consen   12 WRRGPNGNRTLCNACGL   28 (36)
T ss_dssp             EEEETTSEE-EEHHHHH
T ss_pred             hhcCCCCCCHHHHHHHH
Confidence            334455666 8999964


No 96 
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=29.48  E-value=42  Score=17.84  Aligned_cols=27  Identities=15%  Similarity=0.391  Sum_probs=21.0

Q ss_pred             cccccCCCCCCC-ceEEEeCCccccccc
Q psy284          104 YCAACSKVIPAF-EMVMRARNNVYHLEC  130 (139)
Q Consensus       104 ~C~~C~~~I~~~-~~~~~~~~~~~H~~C  130 (139)
                      .|..|+.-..+. |..+.+.+..|+..|
T Consensus        15 ~Cp~CGN~~vGngEG~liV~edtfkRtC   42 (49)
T PF12677_consen   15 KCPKCGNDKVGNGEGTLIVEEDTFKRTC   42 (49)
T ss_pred             cCcccCCcEeecCcceEEEeccceeeee
Confidence            788998877664 457788889998876


No 97 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=29.43  E-value=16  Score=21.08  Aligned_cols=14  Identities=43%  Similarity=0.992  Sum_probs=10.9

Q ss_pred             CCcccccccccccc
Q psy284           38 PQECAGCGKHITDR   51 (139)
Q Consensus        38 ~~~C~~C~~~i~~~   51 (139)
                      +.+|+.||+.|.+.
T Consensus         4 PVRCFTCGkvig~~   17 (71)
T PLN00032          4 PVRCFTCGKVIGNK   17 (71)
T ss_pred             ceeecCCCCCcHHH
Confidence            45899999988763


No 98 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=29.28  E-value=58  Score=16.74  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=6.7

Q ss_pred             ccccHhhHHH
Q psy284           88 LILCKRDYLR   97 (139)
Q Consensus        88 ~~~C~~cy~~   97 (139)
                      --+|..||.+
T Consensus        28 ~dLC~~C~~~   37 (46)
T PF00569_consen   28 YDLCEDCFSK   37 (46)
T ss_dssp             -EEEHHHHHH
T ss_pred             CchhhHHHhC
Confidence            3468888876


No 99 
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=28.55  E-value=41  Score=18.26  Aligned_cols=25  Identities=24%  Similarity=0.416  Sum_probs=18.0

Q ss_pred             ccccccCCCCCCCc--eEEEeCCcccc
Q psy284          103 GYCAACSKVIPAFE--MVMRARNNVYH  127 (139)
Q Consensus       103 ~~C~~C~~~I~~~~--~~~~~~~~~~H  127 (139)
                      +.|.-|+..|.+..  .+|..+|+.|+
T Consensus         4 ~~C~f~g~~I~PG~G~~~Vr~Dgkv~~   30 (54)
T cd00472           4 EKCSFCGYKIYPGHGKMYVRNDGKVFR   30 (54)
T ss_pred             EEecCcCCeecCCCccEEEecCCCEEE
Confidence            37888999998743  36667777776


No 100
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=28.36  E-value=19  Score=20.20  Aligned_cols=14  Identities=43%  Similarity=0.985  Sum_probs=10.8

Q ss_pred             CCcccccccccccc
Q psy284           38 PQECAGCGKHITDR   51 (139)
Q Consensus        38 ~~~C~~C~~~i~~~   51 (139)
                      +.+|+.||++|.+.
T Consensus         4 PiRCFsCGkvi~~~   17 (63)
T COG1644           4 PVRCFSCGKVIGHK   17 (63)
T ss_pred             ceEeecCCCCHHHH
Confidence            45799999988763


No 101
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=28.29  E-value=15  Score=16.23  Aligned_cols=7  Identities=43%  Similarity=0.999  Sum_probs=3.9

Q ss_pred             cccccCC
Q psy284          104 YCAACSK  110 (139)
Q Consensus       104 ~C~~C~~  110 (139)
                      .|..|+.
T Consensus        18 ~C~~C~~   24 (26)
T smart00547       18 KCFACGA   24 (26)
T ss_pred             cccccCC
Confidence            5555554


No 102
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=27.96  E-value=37  Score=15.61  Aligned_cols=9  Identities=22%  Similarity=0.944  Sum_probs=2.1

Q ss_pred             ccccCCCCc
Q psy284           67 KCGCCDCRL   75 (139)
Q Consensus        67 ~C~~C~~~l   75 (139)
                      .|..|+..+
T Consensus         2 ~C~~C~~~~   10 (30)
T PF07649_consen    2 RCDACGKPI   10 (30)
T ss_dssp             --TTTS---
T ss_pred             cCCcCCCcC
Confidence            455555544


No 103
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=27.57  E-value=35  Score=25.15  Aligned_cols=25  Identities=24%  Similarity=0.582  Sum_probs=15.7

Q ss_pred             cccccCCCCCCCceEEEeCCccccccc
Q psy284          104 YCAACSKVIPAFEMVMRARNNVYHLEC  130 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~~~~~~~H~~C  130 (139)
                      -|..|+.+|.-  .++.-.+..|.|.|
T Consensus       247 pC~~CGt~I~k--~~~~gR~t~~CP~C  271 (273)
T COG0266         247 PCRRCGTPIEK--IKLGGRSTFYCPVC  271 (273)
T ss_pred             CCCccCCEeEE--EEEcCCcCEeCCCC
Confidence            69999999943  34444444454444


No 104
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=27.51  E-value=26  Score=23.02  Aligned_cols=35  Identities=17%  Similarity=0.361  Sum_probs=18.2

Q ss_pred             cccccCCCCCCCce--E---EEeCCccccccccccccCCC
Q psy284          104 YCAACSKVIPAFEM--V---MRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       104 ~C~~C~~~I~~~~~--~---~~~~~~~~H~~Cf~C~~C~~  138 (139)
                      +|..|+.++..-+.  +   +-..-...+.+-+.|..|++
T Consensus        93 RC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~k  132 (147)
T PF01927_consen   93 RCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGK  132 (147)
T ss_pred             ccCCCCcEeeechhhccccccCccccccCCeEEECCCCCC
Confidence            68888876643111  1   11222333445666888875


No 105
>KOG2893|consensus
Probab=27.50  E-value=22  Score=25.76  Aligned_cols=36  Identities=22%  Similarity=0.379  Sum_probs=23.6

Q ss_pred             CCcccccccccccceeeeecCccccccCcccccCCCCcc
Q psy284           38 PQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLG   76 (139)
Q Consensus        38 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   76 (139)
                      .+-|-.|+..+.+..++..   .-....|+|..|.+.|-
T Consensus        10 kpwcwycnrefddekiliq---hqkakhfkchichkkl~   45 (341)
T KOG2893|consen   10 KPWCWYCNREFDDEKILIQ---HQKAKHFKCHICHKKLF   45 (341)
T ss_pred             Cceeeecccccchhhhhhh---hhhhccceeeeehhhhc
Confidence            4578889888877633221   11234689999988884


No 106
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=26.64  E-value=16  Score=19.72  Aligned_cols=13  Identities=23%  Similarity=0.792  Sum_probs=8.6

Q ss_pred             Ccccccccccccc
Q psy284           39 QECAGCGKHITDR   51 (139)
Q Consensus        39 ~~C~~C~~~i~~~   51 (139)
                      ..|.+|+-.|.+.
T Consensus        23 ~~C~gC~~~l~~~   35 (56)
T PF02591_consen   23 GTCSGCHMELPPQ   35 (56)
T ss_pred             CccCCCCEEcCHH
Confidence            3677777766664


No 107
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=26.14  E-value=41  Score=17.51  Aligned_cols=13  Identities=46%  Similarity=0.856  Sum_probs=9.0

Q ss_pred             CCCcccccccccc
Q psy284           37 GPQECAGCGKHIT   49 (139)
Q Consensus        37 ~~~~C~~C~~~i~   49 (139)
                      .+..|..|++.|.
T Consensus        10 ~~~~C~~C~~~i~   22 (53)
T PF00130_consen   10 KPTYCDVCGKFIW   22 (53)
T ss_dssp             STEB-TTSSSBEC
T ss_pred             CCCCCcccCcccC
Confidence            4558999998883


No 108
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=26.02  E-value=22  Score=14.64  Aligned_cols=8  Identities=38%  Similarity=1.194  Sum_probs=3.3

Q ss_pred             cccccCCC
Q psy284          131 FACQQCNH  138 (139)
Q Consensus       131 f~C~~C~~  138 (139)
                      |.|..|++
T Consensus         1 ~~C~~C~~    8 (24)
T PF13894_consen    1 FQCPICGK    8 (24)
T ss_dssp             EE-SSTS-
T ss_pred             CCCcCCCC
Confidence            45566653


No 109
>smart00214 VWC von Willebrand factor (vWF) type C domain.
Probab=25.38  E-value=52  Score=17.79  Aligned_cols=18  Identities=11%  Similarity=0.368  Sum_probs=13.2

Q ss_pred             eEEEeCCcccccc-ccccc
Q psy284          117 MVMRARNNVYHLE-CFACQ  134 (139)
Q Consensus       117 ~~~~~~~~~~H~~-Cf~C~  134 (139)
                      ..+...|..|+++ |..|.
T Consensus         5 g~~y~~G~~W~~~~C~~C~   23 (59)
T smart00214        5 GEVYNDGETWKPDPCQICT   23 (59)
T ss_pred             CEEeCCCCEECCCCCeECC
Confidence            4566788999997 76663


No 110
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=25.37  E-value=31  Score=15.84  Aligned_cols=15  Identities=13%  Similarity=0.321  Sum_probs=7.6

Q ss_pred             eEEEeCCcccccccc
Q psy284          117 MVMRARNNVYHLECF  131 (139)
Q Consensus       117 ~~~~~~~~~~H~~Cf  131 (139)
                      .++..=++.||.+|+
T Consensus        11 ~~~~~C~H~~c~~C~   25 (39)
T smart00184       11 PVVLPCGHTFCRSCI   25 (39)
T ss_pred             cEEecCCChHHHHHH
Confidence            344445555655554


No 111
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=25.35  E-value=18  Score=22.30  Aligned_cols=29  Identities=14%  Similarity=0.210  Sum_probs=16.2

Q ss_pred             CcccccCCCCcccCCCeeEeeCCccccHhh
Q psy284           65 CLKCGCCDCRLGEVGSTLYTKANLILCKRD   94 (139)
Q Consensus        65 Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~c   94 (139)
                      =|+|..|..--. .++.-...++.++|..|
T Consensus        70 EFTCssCFLV~H-RSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   70 EFTCSSCFLVHH-RSQLAREKDGQPICRDC   98 (99)
T ss_pred             ceeeeeeeeEec-hhhhccccCCCEecccc
Confidence            377777753221 12222356788888776


No 112
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=25.27  E-value=79  Score=28.03  Aligned_cols=15  Identities=33%  Similarity=0.753  Sum_probs=10.4

Q ss_pred             CCCCccccccccccc
Q psy284           36 QGPQECAGCGKHITD   50 (139)
Q Consensus        36 ~~~~~C~~C~~~i~~   50 (139)
                      ....+|.-|+..|.-
T Consensus        15 ~~~qiCqICGD~vg~   29 (1079)
T PLN02638         15 GGGQVCQICGDNVGK   29 (1079)
T ss_pred             cCCceeeecccccCc
Confidence            345588889877654


No 113
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=25.17  E-value=26  Score=19.70  Aligned_cols=13  Identities=46%  Similarity=1.055  Sum_probs=10.1

Q ss_pred             CCccccccccccc
Q psy284           38 PQECAGCGKHITD   50 (139)
Q Consensus        38 ~~~C~~C~~~i~~   50 (139)
                      +.+|+.||+.|.+
T Consensus         4 PvRCFTCGkvi~~   16 (62)
T PRK04016          4 PVRCFTCGKVIAE   16 (62)
T ss_pred             CeEecCCCCChHH
Confidence            4578888888876


No 114
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=24.84  E-value=7.6  Score=23.80  Aligned_cols=17  Identities=24%  Similarity=0.600  Sum_probs=8.4

Q ss_pred             ccccccCcccccCCCCc
Q psy284           59 MYWHEDCLKCGCCDCRL   75 (139)
Q Consensus        59 ~~~H~~Cf~C~~C~~~l   75 (139)
                      ..+++.+..|..|...|
T Consensus        56 ~~~~~~~iiCGvC~~~L   72 (105)
T COG4357          56 QEFNPKAIICGVCRKLL   72 (105)
T ss_pred             hhcCCccEEhhhhhhhh
Confidence            34444555555555444


No 115
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=23.84  E-value=27  Score=18.75  Aligned_cols=10  Identities=40%  Similarity=1.035  Sum_probs=5.3

Q ss_pred             ccccCCCCCC
Q psy284          105 CAACSKVIPA  114 (139)
Q Consensus       105 C~~C~~~I~~  114 (139)
                      |.+|.+++..
T Consensus         2 CfgC~~~~~~   11 (51)
T PF07975_consen    2 CFGCQKPFPD   11 (51)
T ss_dssp             ETTTTEE-TT
T ss_pred             CccCCCCCCC
Confidence            5566666644


No 116
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=23.60  E-value=22  Score=23.42  Aligned_cols=37  Identities=24%  Similarity=0.406  Sum_probs=20.5

Q ss_pred             CCCcccccccccccceeeeecCccccccCcccccCCCCcc
Q psy284           37 GPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLG   76 (139)
Q Consensus        37 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   76 (139)
                      ....|+.|+..+...+.+...+.   ..-|.|..|+..|.
T Consensus        98 ~~Y~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l~  134 (147)
T smart00531       98 AYYKCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEELE  134 (147)
T ss_pred             cEEECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEEE
Confidence            35578888766554332322221   22378888877763


No 117
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=23.59  E-value=62  Score=28.44  Aligned_cols=32  Identities=16%  Similarity=0.514  Sum_probs=25.7

Q ss_pred             cccccCCCCCCCceEEEeCCccccccccccccCCC
Q psy284          104 YCAACSKVIPAFEMVMRARNNVYHLECFACQQCNH  138 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~  138 (139)
                      .|..|++|+.+.|.++-..+....   |+|..|++
T Consensus       798 ~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~  829 (1006)
T PRK12775        798 TCPKCHRPLEGDEEYVCCATSELQ---WRCDDCGK  829 (1006)
T ss_pred             cCcccCCCCCCCceeEEecCccee---eehhhhcc
Confidence            599999999998889888887776   46666654


No 118
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=23.49  E-value=46  Score=26.62  Aligned_cols=37  Identities=16%  Similarity=0.386  Sum_probs=24.0

Q ss_pred             CcccccccccccceeeeecCccccccCcccccCCCCcc
Q psy284           39 QECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLG   76 (139)
Q Consensus        39 ~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   76 (139)
                      ..|..|-..+...+ +...+..-...||.|..|...|.
T Consensus        27 ~yCp~CL~~~p~~e-~~~~~nrC~r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen   27 YYCPNCLFEVPSSE-ARSEKNRCSRNCFDCPICFSPLS   63 (483)
T ss_pred             eECccccccCChhh-heeccceeccccccCCCCCCcce
Confidence            35666665555443 33344555668999999998885


No 119
>PF04945 YHS:  YHS domain;  InterPro: IPR007029 This short presumed domain is about 50 amino acid residues long. It often contains two cysteines that may be functionally important. This domain is found in copper transporting ATPases, some phenol hydroxylases and in a set of uncharacterised membrane proteins including Q9CNI0 from SWISSPROT. This domain is named after three of the most conserved amino acids it contains. The domain may be metal binding, possibly copper ions. This domain is duplicated in some copper transporting ATPases.; PDB: 3U52_B 2INN_A 2INP_B 1T0Q_A 2RDB_A 1T0R_A 2IND_A 1T0S_A 2INC_A 3DHI_A ....
Probab=23.44  E-value=28  Score=17.94  Aligned_cols=23  Identities=13%  Similarity=0.368  Sum_probs=12.9

Q ss_pred             cccCCCCCC-CceEEEeCCccccc
Q psy284          106 AACSKVIPA-FEMVMRARNNVYHL  128 (139)
Q Consensus       106 ~~C~~~I~~-~~~~~~~~~~~~H~  128 (139)
                      ..|+..|.+ ....+...|+.||-
T Consensus         4 Pvcg~~v~~~~~~~~~y~G~~Y~F   27 (47)
T PF04945_consen    4 PVCGMKVPGNAAYSVEYNGRTYYF   27 (47)
T ss_dssp             -GGG-BE-----EEEEETTEEEEE
T ss_pred             CCCCCEEccCccEEEEECCEEEEE
Confidence            457777722 23577789999983


No 120
>PRK11595 DNA utilization protein GntX; Provisional
Probab=23.44  E-value=93  Score=21.95  Aligned_cols=10  Identities=20%  Similarity=0.351  Sum_probs=5.1

Q ss_pred             Cccccccccc
Q psy284           39 QECAGCGKHI   48 (139)
Q Consensus        39 ~~C~~C~~~i   48 (139)
                      ++|..|+..+
T Consensus         6 ~~C~~C~~~~   15 (227)
T PRK11595          6 GLCWLCRMPL   15 (227)
T ss_pred             CcCccCCCcc
Confidence            3455555544


No 121
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.42  E-value=34  Score=27.40  Aligned_cols=38  Identities=24%  Similarity=0.425  Sum_probs=24.3

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhHH-HHhCCCccccccCCC
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDYL-RLFGSTGYCAACSKV  111 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~-~~~~~~~~C~~C~~~  111 (139)
                      +|..|+..|     .|+...+.+.|..|-. ..+..  .|..|+..
T Consensus       224 ~C~~C~~~l-----~~h~~~~~l~Ch~Cg~~~~~~~--~Cp~C~s~  262 (505)
T TIGR00595       224 CCPNCDVSL-----TYHKKEGKLRCHYCGYQEPIPK--TCPQCGSE  262 (505)
T ss_pred             CCCCCCCce-----EEecCCCeEEcCCCcCcCCCCC--CCCCCCCC
Confidence            444555444     3556677888988854 33444  89999863


No 122
>PRK14873 primosome assembly protein PriA; Provisional
Probab=22.67  E-value=38  Score=28.25  Aligned_cols=38  Identities=18%  Similarity=0.292  Sum_probs=23.7

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCC
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKV  111 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~  111 (139)
                      +|..|+.+|     .|+...+.+.|.-|-......  .|..|+..
T Consensus       394 ~C~~C~~~L-----~~h~~~~~l~Ch~CG~~~~p~--~Cp~Cgs~  431 (665)
T PRK14873        394 RCRHCTGPL-----GLPSAGGTPRCRWCGRAAPDW--RCPRCGSD  431 (665)
T ss_pred             ECCCCCCce-----eEecCCCeeECCCCcCCCcCc--cCCCCcCC
Confidence            444555455     234445678898886544433  89999874


No 123
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=22.37  E-value=1e+02  Score=16.21  Aligned_cols=9  Identities=22%  Similarity=0.486  Sum_probs=5.3

Q ss_pred             cccHhhHHH
Q psy284           89 ILCKRDYLR   97 (139)
Q Consensus        89 ~~C~~cy~~   97 (139)
                      -+|..||..
T Consensus        27 DlC~~C~~~   35 (48)
T cd02341          27 DLCQDCVVK   35 (48)
T ss_pred             ccCHHHHhC
Confidence            356677654


No 124
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=22.02  E-value=41  Score=17.25  Aligned_cols=10  Identities=30%  Similarity=1.082  Sum_probs=6.0

Q ss_pred             cccccCCCCc
Q psy284           66 LKCGCCDCRL   75 (139)
Q Consensus        66 f~C~~C~~~l   75 (139)
                      ++|..|+..+
T Consensus        22 ~~Cp~CG~~~   31 (46)
T PRK00398         22 VRCPYCGYRI   31 (46)
T ss_pred             eECCCCCCeE
Confidence            5666666554


No 125
>PLN03123 poly [ADP-ribose] polymerase; Provisional
Probab=21.89  E-value=60  Score=28.51  Aligned_cols=29  Identities=21%  Similarity=0.356  Sum_probs=18.9

Q ss_pred             cccccCCCCCCCceEEE-------eC---Cccccccccc
Q psy284          104 YCAACSKVIPAFEMVMR-------AR---NNVYHLECFA  132 (139)
Q Consensus       104 ~C~~C~~~I~~~~~~~~-------~~---~~~~H~~Cf~  132 (139)
                      .|.+|++.|.-.+..|.       +.   ..-||..||.
T Consensus        19 ~Ck~C~~~I~K~~lRi~~~v~~~~~dg~~~~W~H~~Cf~   57 (981)
T PLN03123         19 SCKTCKSPIDKDELRLGKMVQSTQFDGFMPMWNHASCIL   57 (981)
T ss_pred             cccccCCcccCCCeEEEEeecccccCCCCCeeecccccc
Confidence            79999999976443321       11   2467889985


No 126
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=21.82  E-value=49  Score=16.89  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=9.4

Q ss_pred             cccccCCCCCC
Q psy284          104 YCAACSKVIPA  114 (139)
Q Consensus       104 ~C~~C~~~I~~  114 (139)
                      .|.+|+++|.|
T Consensus         2 ~Cd~C~~~i~G   12 (43)
T cd02340           2 ICDGCQGPIVG   12 (43)
T ss_pred             CCCCCCCcCcC
Confidence            68999998877


No 127
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=21.54  E-value=12  Score=20.03  Aligned_cols=24  Identities=17%  Similarity=0.451  Sum_probs=16.1

Q ss_pred             CccccHhhHHHHhCCCccccccCCCCC
Q psy284           87 NLILCKRDYLRLFGSTGYCAACSKVIP  113 (139)
Q Consensus        87 ~~~~C~~cy~~~~~~~~~C~~C~~~I~  113 (139)
                      |+--|..|+...|.   .|..|+..|.
T Consensus        29 GRWaC~sCW~deYY---~CksC~Gii~   52 (57)
T PF14445_consen   29 GRWACNSCWQDEYY---TCKSCNGIIN   52 (57)
T ss_pred             chhhhhhhhhhhHh---HHHhhhchhh
Confidence            44457778766654   5888887663


No 128
>KOG3039|consensus
Probab=21.47  E-value=3.4e+02  Score=19.98  Aligned_cols=84  Identities=13%  Similarity=0.133  Sum_probs=56.5

Q ss_pred             CCCCCCCccccccccccccee--ee--ecC-------ccccccCcccccCCCCcc-cCCCeeEeeCCccccHhhHHHHhC
Q psy284           33 NNAQGPQECAGCGKHITDRFL--LK--ALD-------MYWHEDCLKCGCCDCRLG-EVGSTLYTKANLILCKRDYLRLFG  100 (139)
Q Consensus        33 ~~~~~~~~C~~C~~~i~~~~~--~~--~~~-------~~~H~~Cf~C~~C~~~l~-~~~~~~~~~~~~~~C~~cy~~~~~  100 (139)
                      ..++....|..=+++|.-..+  +.  .++       ..-|..-|.|..+...|. ...-.+....|..++..|.++++.
T Consensus       178 ekP~~~v~CP~s~kplklkdL~~VkFT~l~s~~~et~l~a~s~ryiCpvtrd~LtNt~~ca~Lr~sg~Vv~~ecvEklir  257 (303)
T KOG3039|consen  178 EKPSTTVVCPVSGKPLKLKDLFAVKFTPLNSEETETKLIAASKRYICPVTRDTLTNTTPCAVLRPSGHVVTKECVEKLIR  257 (303)
T ss_pred             cCCCceeeccCCCCccchhhcceeeeeecCCchhhhhhhhhccceecccchhhhcCccceEEeccCCcEeeHHHHHHhcc
Confidence            345666788888888654222  11  111       134556788999988875 222334457888999999999887


Q ss_pred             CCccccccCCCCCCCc
Q psy284          101 STGYCAACSKVIPAFE  116 (139)
Q Consensus       101 ~~~~C~~C~~~I~~~~  116 (139)
                      ....|..|.+++...+
T Consensus       258 ~D~v~pv~d~plkdrd  273 (303)
T KOG3039|consen  258 KDMVDPVTDKPLKDRD  273 (303)
T ss_pred             ccccccCCCCcCcccc
Confidence            7678999999997643


No 129
>KOG3476|consensus
Probab=21.36  E-value=28  Score=20.91  Aligned_cols=37  Identities=27%  Similarity=0.543  Sum_probs=26.0

Q ss_pred             ccccCCCCcccCCCeeEeeCCccccHhhHHHHhCCCccccccCCCCCCC
Q psy284           67 KCGCCDCRLGEVGSTLYTKANLILCKRDYLRLFGSTGYCAACSKVIPAF  115 (139)
Q Consensus        67 ~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~~~~~~~~~C~~C~~~I~~~  115 (139)
                      .|..|...+-        ..|.-||..|..+    ++.|+-|++.|...
T Consensus        56 kC~iCk~~vH--------Q~GshYC~tCAY~----KgiCAMCGKki~nT   92 (100)
T KOG3476|consen   56 KCRICKQLVH--------QPGSHYCQTCAYK----KGICAMCGKKILNT   92 (100)
T ss_pred             hhHHHHHHhc--------CCcchhHhHhhhh----hhHHHHhhhHhhcc
Confidence            5667765553        3345689999665    34899999999764


No 130
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=21.01  E-value=47  Score=16.73  Aligned_cols=10  Identities=40%  Similarity=0.750  Sum_probs=4.2

Q ss_pred             cccccCCCCc
Q psy284           66 LKCGCCDCRL   75 (139)
Q Consensus        66 f~C~~C~~~l   75 (139)
                      +.|..|+.-|
T Consensus        20 ~vC~~CG~Vl   29 (43)
T PF08271_consen   20 LVCPNCGLVL   29 (43)
T ss_dssp             EEETTT-BBE
T ss_pred             EECCCCCCEe
Confidence            3455554444


No 131
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=20.93  E-value=56  Score=18.13  Aligned_cols=13  Identities=46%  Similarity=0.915  Sum_probs=10.0

Q ss_pred             cccccCCCCCCCc
Q psy284          104 YCAACSKVIPAFE  116 (139)
Q Consensus       104 ~C~~C~~~I~~~~  116 (139)
                      .|-.|+++|...|
T Consensus        10 HC~VCg~aIp~de   22 (64)
T COG4068          10 HCVVCGKAIPPDE   22 (64)
T ss_pred             cccccCCcCCCcc
Confidence            6888888887743


No 132
>PLN02195 cellulose synthase A
Probab=20.66  E-value=1.1e+02  Score=26.83  Aligned_cols=53  Identities=25%  Similarity=0.486  Sum_probs=29.7

Q ss_pred             CCCcccccccccccceeeeecCccccccCcccccCCCCcccCCCeeEeeCCccccHhhHH--HHhCCCccccccCCCCC
Q psy284           37 GPQECAGCGKHITDRFLLKALDMYWHEDCLKCGCCDCRLGEVGSTLYTKANLILCKRDYL--RLFGSTGYCAACSKVIP  113 (139)
Q Consensus        37 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~~C~~cy~--~~~~~~~~C~~C~~~I~  113 (139)
                      ..+.|..|+..|.-.    .+|..|    -.|..|+               -+.|+.||+  ++-|.+ .|.+|+..-.
T Consensus         5 ~~~~c~~cgd~~~~~----~~g~~f----vaC~eC~---------------~pvCrpCyeyer~eg~q-~CpqCkt~Yk   59 (977)
T PLN02195          5 GAPICATCGEEVGVD----SNGEAF----VACHECS---------------YPLCKACLEYEIKEGRK-VCLRCGGPYD   59 (977)
T ss_pred             CCccceecccccCcC----CCCCeE----EEeccCC---------------CccccchhhhhhhcCCc-cCCccCCccc
Confidence            345788887766543    234433    2333443               234788864  555532 7889987554


Done!