Diaphorina citri psyllid: psy2848


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
LPIIRVVKRRNTANKKERRRTQSINNAFSDLRECIPNILETDDIISIDDFKADLSNHSSHRKNKSQYDSPSEISSNQSSQYVMDPS
cccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccccccccccccccccccccccc
*************************NAFSDLRECIPNILETDDIISIDDFK***********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPIIRVVKRRNTANKKERRRTQSINNAFSDLRECIPNILETDDIISIDDFKADLSNHSSHRKNKSQYDSPSEISSNQSSQYVMDPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032968 [BP]positive regulation of transcription elongation from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0034243, GO:0060255, GO:0032784, GO:0009889, GO:0032786, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0070888 [MF]E-box bindingprobableGO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0035050 [BP]embryonic heart tube developmentprobableGO:0072358, GO:0007507, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0032502, GO:0007275, GO:0044699
GO:0030097 [BP]hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0007508 [BP]larval heart developmentprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0048569, GO:0048513, GO:0048856, GO:0009791, GO:0072359, GO:0072358, GO:0002164, GO:0008150, GO:0048731, GO:0044767, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QL2, chain B
Confidence level:very confident
Coverage over the Query: 9-62
View the alignment between query and template
View the model in PyMOL