BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2861
(1140 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1F2J|A Chain A, Crystal Structure Analysis Of Aldolase From T. Brucei
Length = 370
Score = 32.7 bits (73), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
Query: 795 TRLFGLIPITHPEALIFAGKEMEIQFRMSKPL-TDFMSTLHKNG 837
++L GL+PI PE +I ++E R+S+ + ++ +S LH++G
Sbjct: 187 SQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHG 230
>pdb|3RPJ|A Chain A, Structure Of A Curlin Genes Transcriptional Regulator
Protein From Proteus Mirabilis Hi4320.
pdb|3RPJ|B Chain B, Structure Of A Curlin Genes Transcriptional Regulator
Protein From Proteus Mirabilis Hi4320
Length = 134
Score = 32.3 bits (72), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 4/69 (5%)
Query: 691 SSLIFHYNLKLYDGDGDMLDGVSLKRFVMQSVVGNIVSFRVHAPAAAEFLLDVFANSVTP 750
LI++Y + L+D +GD ++ V K+ V++S+ ++ F AA L ++ P
Sbjct: 68 EQLIYYYQVGLFDKNGDWVNQVISKKDVIESIHETLIRFHDFLQAAVSEL----EXTLVP 123
Query: 751 REYLTGEPM 759
E + P+
Sbjct: 124 DEKXSNFPL 132
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.430
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,280,895
Number of Sequences: 62578
Number of extensions: 1549716
Number of successful extensions: 2772
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 2771
Number of HSP's gapped (non-prelim): 4
length of query: 1140
length of database: 14,973,337
effective HSP length: 109
effective length of query: 1031
effective length of database: 8,152,335
effective search space: 8405057385
effective search space used: 8405057385
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 57 (26.6 bits)