Query         psy2864
Match_columns 85
No_of_seqs    113 out of 496
Neff          6.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:51:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2864.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2864hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3526|consensus               99.8 5.2E-20 1.1E-24  142.7   2.8   73    3-85     88-160 (629)
  2 cd04059 Peptidases_S8_Protein_  98.9 1.4E-09   3E-14   78.7   3.4   38   48-85      1-38  (297)
  3 KOG3525|consensus               97.2 0.00015 3.3E-09   56.9   1.0   32   50-85      1-32  (431)
  4 cd07484 Peptidases_S8_Thermita  82.7     0.7 1.5E-05   32.7   1.3   17   47-63      1-17  (260)
  5 PTZ00262 subtilisin-like prote  69.0       4 8.6E-05   34.1   2.3   17   45-61    284-300 (639)
  6 PF15536 Toxin_58:  Putative to  42.0      11 0.00023   25.3   0.5   19   46-64     53-71  (131)
  7 PF08195 TRI9:  TRI9 protein;    33.1      13 0.00028   20.3  -0.2   12    5-16     10-21  (43)
  8 TIGR03757 conj_TIGR03757 integ  28.0      26 0.00057   23.1   0.6   11   74-84     73-83  (113)
  9 KOG1006|consensus               20.3      60  0.0013   25.3   1.3   14   70-84    245-258 (361)
 10 COG4667 Predicted esterase of   20.2 1.1E+02  0.0023   23.5   2.6   34   51-84    153-186 (292)

No 1  
>KOG3526|consensus
Probab=99.78  E-value=5.2e-20  Score=142.69  Aligned_cols=73  Identities=49%  Similarity=0.793  Sum_probs=65.8

Q ss_pred             cccccCCCCccEEeecccccccCCCCCCCcccCCCccccccCCCCCCCCCCCccceeecCCCCCCCCCCCCCcHHHHhcC
Q psy2864           3 KVEQSRRNYVHQAVQQSGFKRVKRGYKPLKVENLVPDIVMKESQDPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQG   82 (85)
Q Consensus         3 ~~~L~~~~~V~w~eQQ~~~~R~KR~~~~~~~~~~~~~~~~~~~~~~~DPl~~~QWyL~n~gq~~~~~g~DlNV~~aW~~G   82 (85)
                      +..|.+||.|+-++||....|.||+|.++...      +    +..+||+|..||||.|+||++|.+++||||.+||.+|
T Consensus        88 ~~~l~~dp~v~~a~qq~gf~r~krgyrp~~~f------d----~~~~dplf~~qwylkntgqaggk~rldlnv~~awa~g  157 (629)
T KOG3526|consen   88 HAKLHNDPEVKMALQQEGFDRKKRGYRPINEF------D----INMNDPLFTKQWYLKNTGQAGGKPRLDLNVAEAWALG  157 (629)
T ss_pred             hhhhccChhHhhhhhccccchhhccCCchhhh------c----cccCCcccceeeeeecccccCCcccccccHHHHHhhc
Confidence            45799999999999999999999999875422      2    2568999999999999999999999999999999999


Q ss_pred             CCC
Q psy2864          83 GNC   85 (85)
Q Consensus        83 ~TG   85 (85)
                      |||
T Consensus       158 ~tg  160 (629)
T KOG3526|consen  158 YTG  160 (629)
T ss_pred             ccC
Confidence            998


No 2  
>cd04059 Peptidases_S8_Protein_convertases_Kexins_Furin-like Peptidase S8 family domain in Protein convertases. Protein convertases, whose members include furins and kexins, are members of the peptidase S8 or Subtilase clan of proteases. They have an Asp/His/Ser catalytic triad that is not homologous to trypsin. Kexins are involved in the activation of peptide hormones, growth factors, and viral proteins.  Furin cleaves cell surface vasoactive peptides and proteins involved in cardiovascular tissue remodeling in the TGN, at cell surface, or in endosomes but rarely in the ER.  Furin also plays a key role in blood pressure regulation though the activation of transforming growth factor (TGF)-beta. High specificity is seen for cleavage after dibasic (Lys-Arg or Arg-Arg) or multiple basic residues in protein convertases.  There is also strong sequence conservation.
Probab=98.88  E-value=1.4e-09  Score=78.70  Aligned_cols=38  Identities=66%  Similarity=1.228  Sum_probs=36.4

Q ss_pred             CCCCCCCccceeecCCCCCCCCCCCCCcHHHHhcCCCC
Q psy2864          48 PSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGGNC   85 (85)
Q Consensus        48 ~~DPl~~~QWyL~n~gq~~~~~g~DlNV~~aW~~G~TG   85 (85)
                      ||||++++||||++.++.++.++.||||.+||++|+||
T Consensus         1 ~~dp~~~~qw~l~~~~~~~~~~~~~~~~~~~w~~g~~G   38 (297)
T cd04059           1 PNDPLFPYQWYLKNTGQAGGTPGLDLNVTPAWEQGITG   38 (297)
T ss_pred             CCCcccccccccccCCCCCCCCCCCcccHHHHhCCCCC
Confidence            69999999999999999888899999999999999998


No 3  
>KOG3525|consensus
Probab=97.15  E-value=0.00015  Score=56.89  Aligned_cols=32  Identities=38%  Similarity=0.647  Sum_probs=28.7

Q ss_pred             CCCCCccceeecCCCCCCCCCCCCCcHHHHhcCCCC
Q psy2864          50 DPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGGNC   85 (85)
Q Consensus        50 DPl~~~QWyL~n~gq~~~~~g~DlNV~~aW~~G~TG   85 (85)
                      ||+|..||||++.+    .++.||||..+|..||||
T Consensus         1 ~~~~~~~w~l~~~~----~~~~d~~v~~~~~~~~~g   32 (431)
T KOG3525|consen    1 DPMSIHMWYLNAQE----FPGSDLNVQNAWCKGYTG   32 (431)
T ss_pred             CCCccceEEecCCc----cccccceeeeccccCCCC
Confidence            79999999998766    456899999999999997


No 4  
>cd07484 Peptidases_S8_Thermitase_like Peptidase S8 family domain in Thermitase-like proteins. Thermitase is a non-specific, trypsin-related serine protease with a very high specific activity.  It contains a subtilisin like domain. The tertiary structure of thermitase is similar to that of subtilisin BPN'.  It contains a Asp/His/Ser catalytic triad. Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) clan include endopeptidases and  exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin.  The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid
Probab=82.71  E-value=0.7  Score=32.71  Aligned_cols=17  Identities=47%  Similarity=1.290  Sum_probs=14.6

Q ss_pred             CCCCCCCCccceeecCC
Q psy2864          47 DPSDPYFPFQWYLKNTG   63 (85)
Q Consensus        47 ~~~DPl~~~QWyL~n~g   63 (85)
                      .|+||+|++||||...+
T Consensus         1 ~~~~~~~~~~w~~~~~~   17 (260)
T cd07484           1 TPNDPYYSYQWNLDQIG   17 (260)
T ss_pred             CCCCcCcccCCCccccC
Confidence            37999999999998764


No 5  
>PTZ00262 subtilisin-like protease; Provisional
Probab=68.97  E-value=4  Score=34.10  Aligned_cols=17  Identities=24%  Similarity=0.176  Sum_probs=14.7

Q ss_pred             CCCCCCCCCCccceeec
Q psy2864          45 SQDPSDPYFPFQWYLKN   61 (85)
Q Consensus        45 ~~~~~DPl~~~QWyL~n   61 (85)
                      ...+|||.+..||+|..
T Consensus       284 ~~~~ND~~~~~qWgLd~  300 (639)
T PTZ00262        284 KYQFNDEGRNLQWGLDL  300 (639)
T ss_pred             ccccCCCCcccCcCcch
Confidence            35799999999999876


No 6  
>PF15536 Toxin_58:  Putative toxin 58
Probab=42.03  E-value=11  Score=25.28  Aligned_cols=19  Identities=26%  Similarity=0.639  Sum_probs=14.5

Q ss_pred             CCCCCCCCCccceeecCCC
Q psy2864          46 QDPSDPYFPFQWYLKNTGQ   64 (85)
Q Consensus        46 ~~~~DPl~~~QWyL~n~gq   64 (85)
                      +...-.-|.+|||+.|+-.
T Consensus        53 lha~~~~y~YQWY~l~Dp~   71 (131)
T PF15536_consen   53 LHASSSPYRYQWYFLNDPH   71 (131)
T ss_pred             ccccCCCccEEEEEecCcc
Confidence            4556677999999999754


No 7  
>PF08195 TRI9:  TRI9 protein;  InterPro: IPR013265 This entry contains putative genes, of 129 bp, from the Trichothecene gene cluster of Fusarium sporotrichioides and Gibberella zeae (Fusarium graminearum) that encode a predicted protein of 43 amino acids whose function is unknown [, ].
Probab=33.11  E-value=13  Score=20.30  Aligned_cols=12  Identities=8%  Similarity=-0.255  Sum_probs=9.6

Q ss_pred             cccCCCCccEEe
Q psy2864           5 EQSRRNYVHQAV   16 (85)
Q Consensus         5 ~L~~~~~V~w~e   16 (85)
                      .+..||.|.|+|
T Consensus        10 ~~~~dp~vswle   21 (43)
T PF08195_consen   10 SYDMDPDVSWLE   21 (43)
T ss_pred             cccCCCCccHHH
Confidence            467889999986


No 8  
>TIGR03757 conj_TIGR03757 integrating conjugative element protein, PFL_4709 family. Members of this protein belong to extended genomic regions that appear to be spread by conjugative transfer.
Probab=27.97  E-value=26  Score=23.10  Aligned_cols=11  Identities=36%  Similarity=0.670  Sum_probs=9.5

Q ss_pred             CcHHHHhcCCC
Q psy2864          74 NVEAAWAQGGN   84 (85)
Q Consensus        74 NV~~aW~~G~T   84 (85)
                      +|..||.+|+|
T Consensus        73 gv~~Aw~lGi~   83 (113)
T TIGR03757        73 GVADAWQLGVT   83 (113)
T ss_pred             HHHHHHHcCCc
Confidence            57899999987


No 9  
>KOG1006|consensus
Probab=20.29  E-value=60  Score=25.28  Aligned_cols=14  Identities=21%  Similarity=0.548  Sum_probs=11.6

Q ss_pred             CCCCCcHHHHhcCCC
Q psy2864          70 KLDLNVEAAWAQGGN   84 (85)
Q Consensus        70 g~DlNV~~aW~~G~T   84 (85)
                      |.|+. ..||.+|||
T Consensus       245 gyDiR-SDvWSLGIT  258 (361)
T KOG1006|consen  245 GYDIR-SDVWSLGIT  258 (361)
T ss_pred             Ccchh-hhhhhhcce
Confidence            67775 689999998


No 10 
>COG4667 Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only]
Probab=20.20  E-value=1.1e+02  Score=23.48  Aligned_cols=34  Identities=15%  Similarity=0.231  Sum_probs=26.6

Q ss_pred             CCCCccceeecCCCCCCCCCCCCCcHHHHhcCCC
Q psy2864          51 PYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGGN   84 (85)
Q Consensus        51 Pl~~~QWyL~n~gq~~~~~g~DlNV~~aW~~G~T   84 (85)
                      |+|++.-+|++..-..|...-.|=|.+||++|++
T Consensus       153 Pf~~~~V~i~G~~YlDGGIsdsIPvq~a~~~G~~  186 (292)
T COG4667         153 PFYSEGVEINGKNYLDGGISDSIPVKEAIRLGAD  186 (292)
T ss_pred             CCCCCCeEECCEecccCcccccccchHHHHcCCc
Confidence            7999999998865444444556999999999985


Done!