Diaphorina citri psyllid: psy2864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MPKVEQSRRNYVHQAVQQSGFKRVKRGYKPLKVENLVPDIVMKESQDPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGGNC
cccHHccccccccEEEEccccccccccccccccccccccccccccccccccccccccEEECcccccccccccccHHHHHHccccc
*******RRNYVHQAVQQSGFKRVKRGYKPLKVENLVPDIVM****DPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGGN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKVEQSRRNYVHQAVQQSGFKRVKRGYKPLKVENLVPDIVMKESQDPSDPYFPFQWYLKNTGQNGGKAKLDLNVEAAWAQGGNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P8J, chain A
Confidence level:confident
Coverage over the Query: 46-85
View the alignment between query and template
View the model in PyMOL
Template: 3T41, chain A
Confidence level:probable
Coverage over the Query: 5-28,44-65,76-85
View the alignment between query and template
View the model in PyMOL