Diaphorina citri psyllid: psy2895

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---

MNLTKDKNIEILKKPNWIRVKLISNIDNFNKTKNILRANNLVTVCEEASCPNIGECFGRGVATFMIMGSICTRRCKFCNISHGRPDPLDIEEPKKIAYTINKLKLNYVVITSVNRDDLHDGGSSHFVSCIKHIRKLSTKIKIEILIPDFRNQINHVLKIFKQALPDVLNHNIETVPRLYKKVRPGSDYKHSLNLLKNFKKLYPNILTKSGIMVGLGENDEEILTVIHDMRNHNIDILTIGQYLMPSRLHLPVHRYLHPKFFEKFKKIAYKLGFKNVLVGSMIRSSYMADKHFF

cccccccccccccccccEEEccccccccHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccccccccccc

********IEILKKPNWIRVKLISNIDNFNKTKNILRANNLVTVCEEASCPNIGECFGRGVATFMIMGSICTRRCKFCNISHGRPDPLDIEEPKKIAYTINKLKLNYVVITSVNRDDLHDGGSSHFVSCIKHIRKLSTKIKIEILIPDFRNQINHVLKIFKQALPDVLNHNIETVPRLYKKVRPGSDYKHSLNLLKNFKKLYPNILTKSGIMVGLGENDEEILTVIHDMRNHNIDILTIGQYLMPSRLHLPVHRYLHPKFFEKFKKIAYKLGFKNVLVGSMIRSSYMADKHFF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lipoyl synthase	Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.	very confident	Q5P4B8
Lipoyl synthase	Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.	very confident	B2UE01
Lipoyl synthase	Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.	very confident	B1XX30

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009249 [BP]	protein lipoylation	confident	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0018065, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0009107 [BP]	lipoate biosynthetic process	probable	GO:0006633, GO:0006631, GO:0006732, GO:0019752, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0009106, GO:1901362, GO:0072330, GO:1901360, GO:1901576, GO:0044710, GO:0051186, GO:0051188, GO:0071704, GO:0008610, GO:0018130, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0046483, GO:0044238, GO:0006082, GO:0044272, GO:0046394, GO:0016053, GO:0044237, GO:0006790
GO:0016992 [MF]	lipoate synthase activity	probable	GO:0016782, GO:0016783, GO:0003824, GO:0016979, GO:0016740, GO:0070283, GO:0016879, GO:0003674, GO:0016874
GO:0051539 [MF]	4 iron, 4 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.8.-.-	Transferring sulfur-containing groups.	probable
2.8.1.-	12-beta-hydroxysteroid dehydrogenase.	probable
2.8.1.8	Lipoyl synthase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T7V, chain A
Confidence level:very confident
Coverage over the Query: 27-244
View the alignment between query and template
View the model in PyMOL

Template: 1R30, chain A
Confidence level:confident
Coverage over the Query: 27-270
View the alignment between query and template
View the model in PyMOL