Query         psy29
Match_columns 222
No_of_seqs    137 out of 182
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 20:26:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy29.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/29hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03343 SART-1:  SART-1 family 100.0 1.8E-37 3.9E-42  299.3   0.0  166    6-182   132-323 (613)
  2 KOG2217|consensus              100.0   7E-32 1.5E-36  263.4   6.5  167    9-185   186-373 (705)
  3 PF06375 BLVR:  Bovine leukaemi  22.4      36 0.00078   29.1   0.5   13  132-144    63-76  (154)
  4 PHA00726 hypothetical protein   11.5      98  0.0021   24.5   0.5   11  143-153    25-35  (89)
  5 KOG2217|consensus               11.3      47   0.001   34.6  -1.6   22   47-68    228-249 (705)
  6 cd02252 nylC_like nylC-like fa   9.9 1.9E+02  0.0041   26.8   1.9   23   13-35      3-26  (260)
  7 COG3191 DmpA L-aminopeptidase/   8.4 2.4E+02  0.0051   27.3   1.9   24   12-35     18-44  (348)
  8 PF15333 TAF1D:  TATA box-bindi   8.2      83  0.0018   28.5  -1.1    9  143-151    57-65  (217)
  9 PF03303 WTF:  WTF protein;  In   7.5 3.1E+02  0.0068   25.3   2.2   14   94-107    27-40  (247)
 10 PF03576 Peptidase_S58:  Peptid   7.4 1.6E+02  0.0035   27.8   0.3   23   13-35      6-31  (326)

No 1  
>PF03343 SART-1:  SART-1 family;  InterPro: IPR005011  This family of proteins appear to contain a leucine zipper [] and may therefore be a family of transcription factors.; PDB: 3PLV_C 3PLU_D.
Probab=100.00  E-value=1.8e-37  Score=299.26  Aligned_cols=166  Identities=47%  Similarity=0.669  Sum_probs=0.0

Q ss_pred             cccccccCCCCceeeecccccCCCCcEEEEeecccccccCCC-CeeeccccchHHHHHHHHHHhhhcCCCCCCCCCCCcc
Q psy29             6 VEHDIKDFTEGRNVEHDIKDFTEGRNVILTLKDQDILAEDAS-DTLVNVNMVDDERHKKNVLNRKQKVGGKFGYSALDED   84 (222)
Q Consensus         6 ~~yt~~d~L~GlkV~H~~~~f~eG~~vILTLKD~~ILde~e~-D~LeNv~L~e~ek~kknle~kkkk~~~~~~Y~~ydDe   84 (222)
                      ..|++.+ |+||||+|++++|.+|++|||||||++||+++++ |+||||+|++++++++|+++|++++    .|++++  
T Consensus       132 ~~y~~~d-L~glkV~H~~~~f~eg~~vILTLKD~~VLdd~~~~D~LeNv~l~e~ek~kknle~kkk~~----~~d~~e--  204 (613)
T PF03343_consen  132 KEYTSKD-LAGLKVAHDLDEFEEGEEVILTLKDSSVLDDDDEGDVLENVNLAEDEKRKKNLELKKKKK----GYDPDE--  204 (613)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccccc-CCCCeeecchhhhccCCCeEEEeCCCCcCcCCCCCCEEechhhHHHHHHHHHHHHhccCc----cccccc--
Confidence            3577777 9999999999999999999999999999998854 9999999999999999999999999    566554  


Q ss_pred             ccccCCCccccccccCcccccccccccc---eEechh------------hhhhhcc------C--CCCCCcCCCCCCccc
Q psy29            85 EFDEDGNPRESQLLSKYDEEIEGTKKKS---FAIARW------------TLNLKVG------G--SSPSQLASDYLTEDE  141 (222)
Q Consensus        85 efDe~G~~k~k~iL~KYDEEieg~k~~~---F~Lg~~------------~lkk~l~------~--~~~~~~aSDY~t~eE  141 (222)
                       |   +.+..++||+|||++|+|++...   |+|+..            .++.++.      .  +....++|||||++|
T Consensus       205 -~---~~~~~k~iL~kYDeeie~~~~~~~~~f~L~~~g~~~~~~~~~~~~~~~k~~~~~~~l~~~~~~~~~~sDy~t~~E  280 (613)
T PF03343_consen  205 -D---GNGKKKSILSKYDEEIEGEKKKSDNSFTLDEGGSVDDEKEKKEQEIKEKLKLSSLSLDSLDSKEKIASDYYTEEE  280 (613)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             -c---cccCCCCccccCcccccCcccccccceEecCCCcchHHHHHHHhhHHHHHhhccccccccCCcccccccccCccc
Confidence             2   44457899999999999998777   999753            1222221      1  356789999999999


Q ss_pred             c-cccCCCcccchhhhcccccccccCCC-CCCCCCCCcccccc
Q psy29           142 V-KFKKPKKKVRKIRKTKLRADDLLNMD-SGADQSSEMMKREV  182 (222)
Q Consensus       142 m-kFKKpKKKkkk~Rkk~~~~ddL~~~~-~~~~~~~D~GsR~~  182 (222)
                      | +|||||||+++.+++....|++.+++ +.+.+++++|||..
T Consensus       281 m~kfKK~KkKk~kk~~r~~~~D~~~~~~~~~~~~~~~~~sr~~  323 (613)
T PF03343_consen  281 MIKFKKPKKKKKKKKKRKKKADDLELEPEEAASGSSDSGSRKM  323 (613)
T ss_dssp             -------------------------------------------
T ss_pred             cccccccccccchhhhhhhhhhccccccccccccccccccccc
Confidence            8 99999999855444433445555544 67889999999976


No 2  
>KOG2217|consensus
Probab=99.97  E-value=7e-32  Score=263.39  Aligned_cols=167  Identities=40%  Similarity=0.589  Sum_probs=143.2

Q ss_pred             ccccCCCCceeeecccccCCCCcEEEEeecccccccCCCCeeeccccchHHHHHHHHHHhhhcCCCCCCCCCCCcccccc
Q psy29             9 DIKDFTEGRNVEHDIKDFTEGRNVILTLKDQDILAEDASDTLVNVNMVDDERHKKNVLNRKQKVGGKFGYSALDEDEFDE   88 (222)
Q Consensus         9 t~~d~L~GlkV~H~~~~f~eG~~vILTLKD~~ILde~e~D~LeNv~L~e~ek~kknle~kkkk~~~~~~Y~~ydDeefDe   88 (222)
                      +...+|+||+|+|+++.|.+|.+|||||||++||+|+  |  + |||++.++..+|++++++++    .|-+|-++-+|+
T Consensus       186 ~~~sdL~G~kV~Hg~e~f~eg~~~ILTLKD~~VLdd~--d--v-~n~~D~lenvk~ve~kkrne----~~~~~~~e~ydD  256 (705)
T KOG2217|consen  186 YGNSDLHGVKVSHGIEAFSEGKDVILTLKDQSVLDDG--D--V-VNLVDVLENVKNVELKKRNE----KYELYPDEMYDD  256 (705)
T ss_pred             CCCcccccceeecchhhhccCCceEEEeccccccccc--c--c-hhhHHHHHHHHHHHHhccCc----hhcccccccchh
Confidence            4455699999999999999999999999999999998  4  4 99999999999999999998    566653344788


Q ss_pred             CCCccccccccCcccccccccccceEechh------------hhhhhcc-------CCCCCCcCCCCCCcccc-cccCCC
Q psy29            89 DGNPRESQLLSKYDEEIEGTKKKSFAIARW------------TLNLKVG-------GSSPSQLASDYLTEDEV-KFKKPK  148 (222)
Q Consensus        89 ~G~~k~k~iL~KYDEEieg~k~~~F~Lg~~------------~lkk~l~-------~~~~~~~aSDY~t~eEm-kFKKpK  148 (222)
                      +|+++++++|++||++.+|+..++|+|...            .++.++.       ......++|+||+++|| +|||||
T Consensus       257 ~~n~k~~s~l~k~dee~E~e~~k~~~l~~~g~id~e~ekkl~e~r~ki~gk~~~~~e~~n~~las~~~S~eem~kFkk~K  336 (705)
T KOG2217|consen  257 LGNKKPRSELSKYDEELEGEGKKQFRLTTHGTIDGEREKKLEEIRNKIAGKTLTGLEDVNYRLASDYYSQEEMGKFKKPK  336 (705)
T ss_pred             hccccchhhhccCChhhhcccCcceeeecccccchhhHHHHHHHHHHhccCCccchhhcCHHHhhhhcCHHHhhcccchh
Confidence            999999999999999999999999998864            2344443       34456889999999999 999999


Q ss_pred             cccchhhhcccccccccCCC-CCCCCCCCcccccccCC
Q psy29           149 KKVRKIRKTKLRADDLLNMD-SGADQSSEMMKREVKSE  185 (222)
Q Consensus       149 KKkkk~Rkk~~~~ddL~~~~-~~~~~~~D~GsR~~~~~  185 (222)
                      | +|++|++.+++.||.|++ +.+.+.+|||||.+.+.
T Consensus       337 k-~kklrkk~l~asdl~~~~~~~~~~~~Dlgsr~~gr~  373 (705)
T KOG2217|consen  337 K-KKKLRKKNLRASDLRPLAIGDGMEISDLGSRDSGRR  373 (705)
T ss_pred             H-Hhhhhcccccccccchhhcccccccccccccccchh
Confidence            9 689999989999999986 78999999999776443


No 3  
>PF06375 BLVR:  Bovine leukaemia virus receptor (BLVR);  InterPro: IPR010474  Bovine leukemia virus (BLV) is one of the most common infectious cattle viruses, with between 30 and 40% of cows in the United States being infected. It is closely related to the human T-cell leukaemia virus type 1 (HTLV-1) and has highly conserved envelope glycoprotein functional domains []. BLV is an oncogenic C-type retrovirus, which results in the animals developing a malignant lymphoma. BLV, like the human and simian T cell leukaemia viruses, is a deltaretrovirus. 182 residues at the amino-terminal of the BLV envelope glycoprotein surface unit encompass the receptor-binding domain. The metabolic activity in B cells, T cells, and thymocytes is indicated by the expression of the BLV-binding receptor []. A candidate gene of the receptor (BLVR) is related, but unique, to a gene family of the delta subunit of the adaptor protein (AP) complex 3, AP-3 []. The AP-3 complex is not clathrin-associated but is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. ; PDB: 4AFI_B.
Probab=22.38  E-value=36  Score=29.09  Aligned_cols=13  Identities=15%  Similarity=0.097  Sum_probs=4.9

Q ss_pred             cCCCCCCcccc-cc
Q psy29           132 LASDYLTEDEV-KF  144 (222)
Q Consensus       132 ~aSDY~t~eEm-kF  144 (222)
                      ..||.|-..+- .+
T Consensus        63 ~~sdkYl~~~~~~~   76 (154)
T PF06375_consen   63 KGSDKYLKQQQERR   76 (154)
T ss_dssp             SS-SSEEESST---
T ss_pred             chhHHHHHHHHhhh
Confidence            45565544444 65


No 4  
>PHA00726 hypothetical protein
Probab=11.53  E-value=98  Score=24.48  Aligned_cols=11  Identities=55%  Similarity=0.718  Sum_probs=8.3

Q ss_pred             cccCCCcccch
Q psy29           143 KFKKPKKKVRK  153 (222)
Q Consensus       143 kFKKpKKKkkk  153 (222)
                      =|+|||-|+.+
T Consensus        25 LFRKpK~k~~~   35 (89)
T PHA00726         25 LFRKPKPKKVK   35 (89)
T ss_pred             HhcCCCCchhh
Confidence            48999987654


No 5  
>KOG2217|consensus
Probab=11.27  E-value=47  Score=34.58  Aligned_cols=22  Identities=23%  Similarity=0.188  Sum_probs=18.7

Q ss_pred             CCeeeccccchHHHHHHHHHHh
Q psy29            47 SDTLVNVNMVDDERHKKNVLNR   68 (222)
Q Consensus        47 ~D~LeNv~L~e~ek~kknle~k   68 (222)
                      .|+|+||.+++..+.+...+..
T Consensus       228 ~D~lenvk~ve~kkrne~~~~~  249 (705)
T KOG2217|consen  228 VDVLENVKNVELKKRNEKYELY  249 (705)
T ss_pred             HHHHHHHHHHHHhccCchhccc
Confidence            5899999999998887777666


No 6  
>cd02252 nylC_like nylC-like family; composed of proteins with similarity to Flavobacterium endo-type 6-aminohexanoate-oligomer hydrolase (EIII), the product of the nylon oligomer degradation gene, nylC. EIII is an amide hydrolase that catalyzes the degradation of highly-polymerized 6-aminohexanoate oligomers. Together with other nylon degradation enzymes, such as 6-aminohexanoate cyclic dimer hydrolase (EI) and 6-aminohexanoate dimer hydrolase (EII), EIII plays a role in the detoxification and biological removal of the synthetic by-products of nylon manufacture. EIII shows sequence similarity to L-aminopeptidase D-amidase/D-esterase (DmpA), an aminopeptidase that releases N-terminal D and L amino acids from peptide substrates. Like DmpA, EIII undergoes autocatalytic cleavage in front of a nucleophile to form a heterodimer. DmpA shows similarity in catalytic mechanism to N-terminal nucleophile (Ntn) hydrolases, which are enzymes that catalyze the cleavage of amide bonds through the nucl
Probab=9.93  E-value=1.9e+02  Score=26.77  Aligned_cols=23  Identities=30%  Similarity=0.289  Sum_probs=16.8

Q ss_pred             CCCCceeeeccc-ccCCCCcEEEE
Q psy29            13 FTEGRNVEHDIK-DFTEGRNVILT   35 (222)
Q Consensus        13 ~L~GlkV~H~~~-~f~eG~~vILT   35 (222)
                      |..||+|+|... +...|=++||-
T Consensus         3 DV~Gv~VGh~t~~~~~TGvTvIl~   26 (260)
T cd02252           3 DVPGIRVGHATDEEGLTGVTVILC   26 (260)
T ss_pred             CCCCcEEeceEcCCCCceeEEEEe
Confidence            489999999854 34456677775


No 7  
>COG3191 DmpA L-aminopeptidase/D-esterase [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]
Probab=8.37  E-value=2.4e+02  Score=27.32  Aligned_cols=24  Identities=29%  Similarity=0.218  Sum_probs=19.2

Q ss_pred             cCCCCceeeecccc---cCCCCcEEEE
Q psy29            12 DFTEGRNVEHDIKD---FTEGRNVILT   35 (222)
Q Consensus        12 d~L~GlkV~H~~~~---f~eG~~vILT   35 (222)
                      .|.+||+|+|-...   +..|=++||.
T Consensus        18 TDV~Gi~VGh~T~~~~~~~TGVTvILp   44 (348)
T COG3191          18 TDVPGIKVGHVTLIRGDVRTGVTVILP   44 (348)
T ss_pred             ecCCceEeeeEecccCCccCceEEEec
Confidence            45899999998854   6778888885


No 8  
>PF15333 TAF1D:  TATA box-binding protein-associated factor 1D
Probab=8.23  E-value=83  Score=28.48  Aligned_cols=9  Identities=56%  Similarity=0.837  Sum_probs=4.9

Q ss_pred             cccCCCccc
Q psy29           143 KFKKPKKKV  151 (222)
Q Consensus       143 kFKKpKKKk  151 (222)
                      .|||+|||+
T Consensus        57 ~fkkrkrKk   65 (217)
T PF15333_consen   57 RFKKRKRKK   65 (217)
T ss_pred             HHHHHHHHH
Confidence            476665443


No 9  
>PF03303 WTF:  WTF protein;  InterPro: IPR004982 This is a family of mainly hypothetical Schizosacchoromyces pombe proteins that are often encoded near long terminal repeats within the genome. Their function is unknown but they contain several predicted transmembrane regions and at least one protein is up-regulated during meiosis []. Upregulation is also observed in histone deacetylase mutants, indicating their transcription is normally inhibited by hypoacetylation [].
Probab=7.55  E-value=3.1e+02  Score=25.33  Aligned_cols=14  Identities=36%  Similarity=0.503  Sum_probs=11.8

Q ss_pred             ccccccCccccccc
Q psy29            94 ESQLLSKYDEEIEG  107 (222)
Q Consensus        94 ~k~iL~KYDEEieg  107 (222)
                      ++|.|++|+-|.+|
T Consensus        27 EKG~lpeynSeees   40 (247)
T PF03303_consen   27 EKGPLPEYNSEEES   40 (247)
T ss_pred             ccCCCCcccCCCCC
Confidence            67899999988666


No 10 
>PF03576 Peptidase_S58:  Peptidase family S58 ;  InterPro: IPR005321 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S58 (DmpA aminopeptidase family, clan PB(S)). The protein fold of the peptidase unit for members of this family resembles that of archaean proteasome subunit B, the type example of clan PB. The type example is aminopeptidase DmpA from OOchrobactrum anthropi. This family also contains proteins that have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the family.  L-aminopeptidase D-Ala-esterase/amidase (DmpA) from O. anthropi releases the N-terminal L and/or D-Ala residues from peptide substrates. This is the only known enzyme to liberate N-terminal amino acids with both D and L stereospecificity. DmpA active form is an alphabeta heterodimer, which results from a putative autocatalytic cleavage of an inactive precursor polypeptide. DmpA shows structural homology to N-terminal nucleophile (Ntn) hydrolase family members, and may work by a similar catalytic mechanism, however their secondary structure elements differ significantly [].; PDB: 2DRH_D 3N5I_D 3N33_A 3NFB_A 3N2W_C 3NDV_D 1B65_C 3AXG_O 3S3U_A.
Probab=7.39  E-value=1.6e+02  Score=27.80  Aligned_cols=23  Identities=30%  Similarity=0.361  Sum_probs=17.7

Q ss_pred             CCCCceeeecccc---cCCCCcEEEE
Q psy29            13 FTEGRNVEHDIKD---FTEGRNVILT   35 (222)
Q Consensus        13 ~L~GlkV~H~~~~---f~eG~~vILT   35 (222)
                      |..||+|+|-...   ...|=++||.
T Consensus         6 DV~Gv~VGh~t~~~~~~~TGvTvIl~   31 (326)
T PF03576_consen    6 DVPGVRVGHATDEDGEARTGVTVILP   31 (326)
T ss_dssp             GSTT-EEEEEEEEETTEEEEEEEEET
T ss_pred             cCCCcEEEeEECCCCCcCcceEEEEe
Confidence            4899999999885   5667788877


Done!