Query         psy2931
Match_columns 95
No_of_seqs    107 out of 137
Neff          3.8 
Searched_HMMs 46136
Date          Fri Aug 16 21:16:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2931.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2931hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04889 Cwf_Cwc_15:  Cwf15/Cwc 100.0 9.9E-34 2.2E-38  218.6   7.3   75    1-75      1-75  (244)
  2 KOG3228|consensus              100.0 3.1E-31 6.6E-36  203.7   5.4   69    1-69      1-69  (226)
  3 KOG1168|consensus               47.1      16 0.00036   30.7   2.4   35   57-91    278-312 (385)
  4 KOG4715|consensus               25.6      66  0.0014   27.4   2.7   26   51-76    232-257 (410)
  5 KOG1029|consensus               18.0      30 0.00064   32.7  -0.9   17   32-48    186-202 (1118)
  6 PF09439 SRPRB:  Signal recogni  13.4      40 0.00086   25.3  -1.1   17   27-43     48-64  (181)
  7 PF11273 DUF3073:  Protein of u  12.3 1.1E+02  0.0023   20.0   0.8   19   40-64     15-33  (65)
  8 cd06411 PB1_p51 The PB1 domain  12.0 1.4E+02   0.003   20.0   1.3   16   34-49     32-47  (78)
  9 PF14105 DUF4278:  Domain of un   9.6 1.9E+02   0.004   17.3   1.2   16   30-45     39-54  (57)
 10 PF10872 DUF2740:  Protein of u   9.6 3.3E+02  0.0071   16.7   2.2    9   58-66     30-38  (48)

No 1  
>PF04889 Cwf_Cwc_15:  Cwf15/Cwc15 cell cycle control protein;  InterPro: IPR006973 This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. The function of these proteins is unknown, but they form part of the spliceosome and are thus thought to be involved in mRNA splicing [].; GO: 0000398 nuclear mRNA splicing, via spliceosome, 0005681 spliceosomal complex
Probab=100.00  E-value=9.9e-34  Score=218.64  Aligned_cols=75  Identities=72%  Similarity=1.052  Sum_probs=73.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCccccccccccccCCCCCceeeeecCCCCChhHhhHHHHHHHHHHHHHHHHHHhh
Q psy2931           1 MTTAARPTFEPARGGQGRGEKDLSAISKQYSSRDLPGHTKLKYREHGQGTNEELRSRDFRKELEEREREKDKTAR   75 (95)
Q Consensus         1 MTTAHRPT~~pA~G~~~~g~~~~~~~s~~~ssRdLP~HtkLK~Rq~gQ~~~~e~~~rDLr~ELe~~E~~~~~kkr   75 (95)
                      |||||||||+||+|+.++|+++++++|.|||+||||+||+||||++||++.+++..+|||+||+++|++++.++.
T Consensus         1 MTTAHRPT~~pA~G~~~~~~~~~~~~S~~~ssRdLPsHTkLK~Rq~gq~~~~e~~~rdlr~eLe~~E~~~~~kk~   75 (244)
T PF04889_consen    1 MTTAHRPTFEPARGGEGQGGNDLSVPSKQYSSRDLPSHTKLKYRQDGQGTEEELRKRDLRAELEEAEREHFAKKN   75 (244)
T ss_pred             CCCccCCCcccccCCcccCCccccccccccccccCCcCCeeeeecCCCCcchhHHHHHHHHHHHHHHHHHHhhcc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999994


No 2  
>KOG3228|consensus
Probab=99.97  E-value=3.1e-31  Score=203.68  Aligned_cols=69  Identities=81%  Similarity=1.232  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCccccccccccccCCCCCceeeeecCCCCChhHhhHHHHHHHHHHHHHH
Q psy2931           1 MTTAARPTFEPARGGQGRGEKDLSAISKQYSSRDLPGHTKLKYREHGQGTNEELRSRDFRKELEERERE   69 (95)
Q Consensus         1 MTTAHRPT~~pA~G~~~~g~~~~~~~s~~~ssRdLP~HtkLK~Rq~gQ~~~~e~~~rDLr~ELe~~E~~   69 (95)
                      |||||||||+||+|+...|+.+++++|+|||+||||+||+|||||.||++.+|+..+|||+|||++|+.
T Consensus         1 MTTAhRPtf~parGg~~~g~~~ls~ls~qysSRdlP~HTklKyRq~~Q~teee~rk~dlR~eleerER~   69 (226)
T KOG3228|consen    1 MTTAHRPTFEPARGGSARGETDLSILSKQYSSRDLPGHTKLKYRQTGQGTEEELRKRDLRRELEERERA   69 (226)
T ss_pred             CCcccCCccCcccCccccCCCCcccccchhhhccCCcccccchhhcccccHHHHHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999993


No 3  
>KOG1168|consensus
Probab=47.07  E-value=16  Score=30.67  Aligned_cols=35  Identities=20%  Similarity=0.069  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcCCCccchhhccccc
Q psy2931          57 RDFRKELEEREREKDKTARIRAPESHANRKQKKGK   91 (95)
Q Consensus        57 rDLr~ELe~~E~~~~~kkr~~~~~~~~~~~~~~~~   91 (95)
                      --|.+=||++|.++++|..+.+-.+.-+...||.|
T Consensus       278 PILqaWLEeAE~a~keK~~~pd~~~l~~~~ekKRK  312 (385)
T KOG1168|consen  278 PILQAWLEEAEAAMKEKDTKPDINELLPGGEKKRK  312 (385)
T ss_pred             HHHHHHHHHHHHHHHhhccCCchhhccCccccccc
Confidence            35899999999999999998877777776666655


No 4  
>KOG4715|consensus
Probab=25.61  E-value=66  Score=27.42  Aligned_cols=26  Identities=19%  Similarity=0.250  Sum_probs=21.5

Q ss_pred             hhHhhHHHHHHHHHHHHHHHHHHhhh
Q psy2931          51 NEELRSRDFRKELEEREREKDKTARI   76 (95)
Q Consensus        51 ~~e~~~rDLr~ELe~~E~~~~~kkr~   76 (95)
                      .--+.-+.|.+||+..|.+|.+||+.
T Consensus       232 SL~~HQ~KLEaEL~q~Ee~hq~kKrk  257 (410)
T KOG4715|consen  232 SLMVHQRKLEAELLQIEERHQEKKRK  257 (410)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33456788999999999999988874


No 5  
>KOG1029|consensus
Probab=18.00  E-value=30  Score=32.69  Aligned_cols=17  Identities=41%  Similarity=0.616  Sum_probs=13.3

Q ss_pred             ccCCCCCceeeeecCCC
Q psy2931          32 SRDLPGHTKLKYREHGQ   48 (95)
Q Consensus        32 sRdLP~HtkLK~Rq~gQ   48 (95)
                      -=.+|.|++|||||--.
T Consensus       186 eWAVp~~~klKY~QlFN  202 (1118)
T KOG1029|consen  186 EWAVPQHNKLKYRQLFN  202 (1118)
T ss_pred             hccccchhhhHHHHHhh
Confidence            44579999999999643


No 6  
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=13.45  E-value=40  Score=25.25  Aligned_cols=17  Identities=35%  Similarity=0.708  Sum_probs=13.1

Q ss_pred             cccccccCCCCCceeee
Q psy2931          27 SKQYSSRDLPGHTKLKY   43 (95)
Q Consensus        27 s~~~ssRdLP~HtkLK~   43 (95)
                      ...+.--|+|||.+|.+
T Consensus        48 ~~~~~lvD~PGH~rlr~   64 (181)
T PF09439_consen   48 GKKLRLVDIPGHPRLRS   64 (181)
T ss_dssp             GTCECEEEETT-HCCCH
T ss_pred             CCEEEEEECCCcHHHHH
Confidence            45678889999999975


No 7  
>PF11273 DUF3073:  Protein of unknown function (DUF3073);  InterPro: IPR021426  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=12.27  E-value=1.1e+02  Score=20.04  Aligned_cols=19  Identities=26%  Similarity=0.438  Sum_probs=13.1

Q ss_pred             eeeeecCCCCChhHhhHHHHHHHHH
Q psy2931          40 KLKYREHGQGTNEELRSRDFRKELE   64 (95)
Q Consensus        40 kLK~Rq~gQ~~~~e~~~rDLr~ELe   64 (95)
                      +|||..|.      +...-|.+||-
T Consensus        15 eLKY~sp~------tDl~~LqrEL~   33 (65)
T PF11273_consen   15 ELKYSSPD------TDLDALQRELS   33 (65)
T ss_pred             HhccCCCc------CCHHHHHHHHc
Confidence            58998884      34556777774


No 8  
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein.  p51 plays an  important role in NADPH oxidase activation during phagosytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain mo
Probab=12.05  E-value=1.4e+02  Score=20.00  Aligned_cols=16  Identities=25%  Similarity=0.491  Sum_probs=13.9

Q ss_pred             CCCCCceeeeecCCCC
Q psy2931          34 DLPGHTKLKYREHGQG   49 (95)
Q Consensus        34 dLP~HtkLK~Rq~gQ~   49 (95)
                      ..|.|++|-||.++.+
T Consensus        32 l~~~~~~LSY~~~~~~   47 (78)
T cd06411          32 QQAQRGQLSYRAPGED   47 (78)
T ss_pred             CChhhcEEEecCCCCC
Confidence            4788999999999876


No 9  
>PF14105 DUF4278:  Domain of unknown function (DUF4278)
Probab=9.58  E-value=1.9e+02  Score=17.31  Aligned_cols=16  Identities=19%  Similarity=0.191  Sum_probs=11.3

Q ss_pred             ccccCCCCCceeeeec
Q psy2931          30 YSSRDLPGHTKLKYRE   45 (95)
Q Consensus        30 ~ssRdLP~HtkLK~Rq   45 (95)
                      .....++.|..|+||-
T Consensus        39 ~~~~~~~~~~~L~YRG   54 (57)
T PF14105_consen   39 HHAPPPQPSHNLTYRG   54 (57)
T ss_pred             cccCCCCCCcceEeCC
Confidence            3455566788999994


No 10 
>PF10872 DUF2740:  Protein of unknown function (DUF2740);  InterPro: IPR022626 This entry is represented by Bacteriophage P22, Orf48. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This family of proteins with unknown function has a highly conserved sequence. They are found in Enterobacteria and Enterobacteria phages.
Probab=9.55  E-value=3.3e+02  Score=16.70  Aligned_cols=9  Identities=56%  Similarity=0.792  Sum_probs=6.3

Q ss_pred             HHHHHHHHH
Q psy2931          58 DFRKELEER   66 (95)
Q Consensus        58 DLr~ELe~~   66 (95)
                      -||+|||.-
T Consensus        30 rfraelekv   38 (48)
T PF10872_consen   30 RFRAELEKV   38 (48)
T ss_pred             hHHHHHHHH
Confidence            388888754


Done!