Query         psy2945
Match_columns 134
No_of_seqs    112 out of 231
Neff          4.8 
Searched_HMMs 29240
Date          Fri Aug 16 21:36:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2945.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/2945hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2y69_F Cytochrome C oxidase su 100.0 2.5E-50 8.5E-55  301.6  10.2   93   38-131    32-125 (129)
  2 1v54_F VI, cytochrome C oxidas 100.0 1.5E-49 5.1E-54  285.4  10.5   92   39-131     2-94  (98)
  3 2odx_A Cytochrome C oxidase po 100.0 1.8E-37 6.3E-42  215.5   4.6   70   63-133     1-73  (80)
  4 2jrr_A Uncharacterized protein  98.2 9.5E-07 3.2E-11   59.2   2.8   50   80-131     2-55  (67)
  5 2jvm_A Uncharacterized protein  97.7 2.7E-05 9.2E-10   53.8   4.2   49   80-130    15-67  (80)
  6 2jz8_A Uncharacterized protein  93.6   0.047 1.6E-06   38.0   2.8   38   93-130    22-62  (87)
  7 1gh9_A 8.3 kDa protein (gene M  80.9     1.2 4.1E-05   29.5   2.9   32   93-130     2-34  (71)
  8 2m0d_A Zinc finger and BTB dom  78.6    0.98 3.4E-05   21.7   1.5   12  116-127     2-14  (30)
  9 1rik_A E6APC1 peptide; E6-bind  78.5    0.94 3.2E-05   21.9   1.4   12  116-127     1-13  (29)
 10 2kvh_A Zinc finger and BTB dom  76.5     1.3 4.4E-05   21.3   1.5   12  116-127     2-14  (27)
 11 2kvg_A Zinc finger and BTB dom  75.3     1.2 4.1E-05   21.6   1.3   12  116-127     2-14  (27)
 12 2lvu_A Zinc finger and BTB dom  77.2    0.59   2E-05   22.4   0.0   13  116-128     1-14  (26)
 13 2m0f_A Zinc finger and BTB dom  74.0     1.4 4.7E-05   21.1   1.3   12  116-127     1-13  (29)
 14 2elm_A Zinc finger protein 406  72.0     1.9 6.5E-05   22.6   1.6   14  115-128     7-21  (37)
 15 2kvf_A Zinc finger and BTB dom  71.8       2 6.9E-05   20.5   1.6   12  116-127     2-14  (28)
 16 1srk_A Zinc finger protein ZFP  71.4       2 6.9E-05   21.8   1.6   13  115-127     5-18  (35)
 17 2m0e_A Zinc finger and BTB dom  70.5     0.9 3.1E-05   21.7   0.0   12  116-127     1-13  (29)
 18 2els_A Zinc finger protein 406  70.5     2.1 7.2E-05   22.0   1.6   13  115-127     7-20  (36)
 19 2elt_A Zinc finger protein 406  70.3     2.2 7.6E-05   21.7   1.6   13  115-127     7-20  (36)
 20 2elx_A Zinc finger protein 406  70.0     2.4 8.1E-05   21.4   1.7   13  115-127     5-18  (35)
 21 2elv_A Zinc finger protein 406  68.8     2.6 8.7E-05   21.6   1.7   13  115-127     7-20  (36)
 22 2elq_A Zinc finger protein 406  68.6     2.5 8.7E-05   21.6   1.6   13  115-127     7-20  (36)
 23 2lvt_A Zinc finger and BTB dom  71.2     1.1 3.6E-05   21.8   0.0   13  116-128     1-14  (29)
 24 1ard_A Yeast transcription fac  67.9     1.2 4.1E-05   21.4   0.2   12  116-127     1-13  (29)
 25 1paa_A Yeast transcription fac  66.7     1.3 4.3E-05   21.6   0.1   12  116-127     1-13  (30)
 26 2elp_A Zinc finger protein 406  66.0       3  0.0001   21.4   1.6   13  115-127     7-20  (37)
 27 1p7a_A BF3, BKLF, kruppel-like  63.9     1.6 5.6E-05   22.5   0.2   13  115-127     9-22  (37)
 28 2elo_A Zinc finger protein 406  63.8       2 6.9E-05   22.1   0.6   13  115-127     7-20  (37)
 29 3iuf_A Zinc finger protein UBI  62.9     3.3 0.00011   23.3   1.5   13  115-127     5-18  (48)
 30 1njq_A Superman protein; zinc-  62.9     3.4 0.00012   21.6   1.5   13  115-127     4-17  (39)
 31 2lvr_A Zinc finger and BTB dom  66.8     1.5 5.3E-05   21.1   0.0   13  116-128     2-15  (30)
 32 1klr_A Zinc finger Y-chromosom  62.5     1.6 5.5E-05   20.9   0.0   12  116-127     1-13  (30)
 33 1fv5_A First zinc finger of U-  61.4     2.1 7.1E-05   24.0   0.4   14  114-127     5-19  (36)
 34 2epv_A Zinc finger protein 268  60.7     4.4 0.00015   21.9   1.7   13  115-127    10-23  (44)
 35 2epc_A Zinc finger protein 32;  60.3     4.4 0.00015   21.3   1.6   13  115-127     9-22  (42)
 36 2en2_A B-cell lymphoma 6 prote  59.5     4.3 0.00015   21.4   1.5   13  115-127     9-22  (42)
 37 2kfq_A FP1; protein, de novo p  57.9     1.3 4.5E-05   22.6  -0.8   12  116-127     1-13  (32)
 38 2elr_A Zinc finger protein 406  57.8     2.6 8.9E-05   21.4   0.4   13  115-127     7-20  (36)
 39 2ept_A Zinc finger protein 32;  57.8     5.3 0.00018   21.0   1.7   13  115-127     8-21  (41)
 40 2eow_A Zinc finger protein 347  57.5     5.1 0.00017   21.6   1.6   13  115-127    10-23  (46)
 41 1rim_A E6APC2 peptide; E6-bind  57.1     2.3 7.9E-05   21.8   0.1   12  116-127     1-13  (33)
 42 2yts_A Zinc finger protein 484  56.7     5.6 0.00019   21.4   1.7   13  115-127    10-23  (46)
 43 2ytp_A Zinc finger protein 484  56.5     5.6 0.00019   21.6   1.7   13  115-127    10-23  (46)
 44 4gzn_C ZFP-57, zinc finger pro  56.3     4.5 0.00015   24.8   1.3   12  116-127     3-15  (60)
 45 3irb_A Uncharacterized protein  56.2     3.4 0.00012   30.1   0.8   19  109-127    37-58  (145)
 46 2emi_A Zinc finger protein 484  56.1     5.7  0.0002   21.4   1.7   13  115-127    10-23  (46)
 47 2emb_A Zinc finger protein 473  55.8     5.4 0.00019   21.3   1.5   13  115-127    10-23  (44)
 48 2yrj_A Zinc finger protein 473  55.7     5.9  0.0002   21.3   1.7   13  115-127    10-23  (46)
 49 2eox_A Zinc finger protein 473  55.6       5 0.00017   21.5   1.3   13  115-127    10-23  (44)
 50 2ep3_A Zinc finger protein 484  55.5       6 0.00021   21.3   1.7   13  115-127    10-23  (46)
 51 2yu5_A Zinc finger protein 473  55.3     5.9  0.0002   21.1   1.6   13  115-127    10-23  (44)
 52 2em4_A Zinc finger protein 28   55.3     5.7  0.0002   21.5   1.6   16  112-127     6-23  (46)
 53 2el5_A Zinc finger protein 268  54.9     6.3 0.00022   20.7   1.7   13  115-127     8-21  (42)
 54 2epu_A Zinc finger protein 32;  54.8     5.2 0.00018   21.6   1.4   13  115-127    10-23  (45)
 55 2ytf_A Zinc finger protein 268  54.8     6.2 0.00021   21.2   1.7   13  115-127    10-23  (46)
 56 2emj_A Zinc finger protein 28   54.7     6.1 0.00021   21.4   1.6   13  115-127    10-23  (46)
 57 2en3_A ZFP-95, zinc finger pro  54.7     6.3 0.00022   21.3   1.7   13  115-127    10-23  (46)
 58 2em3_A Zinc finger protein 28   54.6     6.3 0.00022   21.2   1.7   13  115-127    10-23  (46)
 59 1yui_A GAGA-factor; complex (D  53.5       6  0.0002   22.4   1.5   13  115-127    22-35  (54)
 60 2eof_A Zinc finger protein 268  53.3     6.5 0.00022   20.8   1.6   13  115-127    10-23  (44)
 61 2eoy_A Zinc finger protein 473  53.2     6.7 0.00023   21.2   1.6   13  115-127    10-23  (46)
 62 2eoz_A Zinc finger protein 473  53.0     5.8  0.0002   21.5   1.4   13  115-127    10-23  (46)
 63 2emf_A Zinc finger protein 484  52.8     6.8 0.00023   21.2   1.6   13  115-127    10-23  (46)
 64 2eq0_A Zinc finger protein 347  52.7     6.7 0.00023   21.1   1.6   13  115-127    10-23  (46)
 65 2em9_A Zinc finger protein 224  52.2     7.3 0.00025   20.9   1.7   13  115-127    10-23  (46)
 66 2emy_A Zinc finger protein 268  51.9     7.2 0.00025   21.0   1.6   13  115-127    10-23  (46)
 67 2yto_A Zinc finger protein 484  51.6     7.5 0.00026   21.0   1.7   13  115-127    10-23  (46)
 68 2eor_A Zinc finger protein 224  51.5     7.2 0.00025   20.9   1.6   13  115-127    10-23  (46)
 69 2epp_A POZ-, at HOOK-, and zin  51.3     3.3 0.00011   26.2   0.1   15  113-127     9-24  (66)
 70 2eoo_A ZFP-95, zinc finger pro  50.8     7.9 0.00027   20.9   1.7   16  112-127     6-23  (46)
 71 2yu8_A Zinc finger protein 347  50.5     7.8 0.00027   20.8   1.6   13  115-127    10-23  (46)
 72 2eoj_A Zinc finger protein 268  50.5     4.6 0.00016   21.6   0.6   13  115-127    10-23  (44)
 73 2em2_A Zinc finger protein 28   50.4     8.1 0.00028   20.9   1.7   13  115-127    10-23  (46)
 74 2ema_A Zinc finger protein 347  50.3     7.9 0.00027   20.8   1.6   13  115-127    10-23  (46)
 75 2ytk_A Zinc finger protein 347  50.2       8 0.00027   20.8   1.6   13  115-127    10-23  (46)
 76 2emx_A Zinc finger protein 268  50.1       8 0.00027   20.6   1.6   13  115-127     8-21  (44)
 77 1znf_A 31ST zinc finger from X  50.0     3.5 0.00012   19.3   0.0   11  117-127     1-12  (27)
 78 2ytj_A Zinc finger protein 484  49.4     8.5 0.00029   20.7   1.7   13  115-127    10-23  (46)
 79 2em5_A ZFP-95, zinc finger pro  49.1     8.5 0.00029   20.8   1.6   13  115-127    10-23  (46)
 80 2emp_A Zinc finger protein 347  49.0     8.8  0.0003   20.6   1.7   13  115-127    10-23  (46)
 81 2epw_A Zinc finger protein 268  48.9     8.8  0.0003   20.5   1.7   13  115-127    10-23  (46)
 82 2el4_A Zinc finger protein 268  48.9     8.6 0.00029   20.6   1.6   13  115-127    10-23  (46)
 83 2ysp_A Zinc finger protein 224  48.8     7.4 0.00025   20.9   1.4   13  115-127    10-23  (46)
 84 2emh_A Zinc finger protein 484  48.2     8.7  0.0003   20.7   1.6   13  115-127    10-23  (46)
 85 2enc_A Zinc finger protein 224  48.2     9.2 0.00031   20.5   1.7   13  115-127    10-23  (46)
 86 2ene_A Zinc finger protein 347  48.0     8.8  0.0003   20.6   1.6   13  115-127    10-23  (46)
 87 2eos_A B-cell lymphoma 6 prote  47.9     4.8 0.00016   21.3   0.4   13  115-127     9-22  (42)
 88 2ytb_A Zinc finger protein 32;  47.8     4.6 0.00016   21.2   0.3   13  115-127     9-22  (42)
 89 2yso_A ZFP-95, zinc finger pro  47.7     8.9  0.0003   20.6   1.6   13  115-127    10-23  (46)
 90 2eon_A ZFP-95, zinc finger pro  47.6     5.1 0.00018   21.8   0.5   13  115-127    10-23  (46)
 91 2eme_A Zinc finger protein 473  47.6     9.5 0.00033   20.4   1.7   13  115-127    10-23  (46)
 92 2em7_A Zinc finger protein 224  47.4     9.6 0.00033   20.5   1.7   13  115-127    10-23  (46)
 93 2eml_A Zinc finger protein 28   47.4     9.6 0.00033   20.5   1.7   13  115-127    10-23  (46)
 94 2em8_A Zinc finger protein 224  46.9     9.9 0.00034   20.5   1.7   13  115-127    10-23  (46)
 95 2emm_A ZFP-95, zinc finger pro  46.8      10 0.00034   20.3   1.7   13  115-127    10-23  (46)
 96 2yte_A Zinc finger protein 473  46.6     5.2 0.00018   21.0   0.4   13  115-127     8-21  (42)
 97 2fiy_A Protein FDHE homolog; F  46.6     7.8 0.00027   31.8   1.6   42   90-131   203-268 (309)
 98 2ytg_A ZFP-95, zinc finger pro  46.2     9.7 0.00033   20.4   1.6   13  115-127    10-23  (46)
 99 2ep2_A Zinc finger protein 484  46.0      10 0.00036   20.3   1.7   13  115-127    10-23  (46)
100 2ep0_A Zinc finger protein 28   46.0      10 0.00036   20.3   1.7   13  115-127    10-23  (46)
101 2el6_A Zinc finger protein 268  45.7      10 0.00035   20.4   1.6   13  115-127    10-23  (46)
102 2y9f_A LSL-150, hemolytic lect  45.6      10 0.00035   28.4   2.0   45   84-131    69-114 (150)
103 2ytd_A Zinc finger protein 473  45.2      11 0.00037   20.2   1.7   13  115-127    10-23  (46)
104 2eq3_A Zinc finger protein 347  44.4     6.3 0.00022   21.2   0.6   13  115-127    10-23  (46)
105 3uk3_C Zinc finger protein 217  43.6      11 0.00039   20.9   1.6   13  115-127    30-43  (57)
106 2en6_A Zinc finger protein 268  43.5     9.8 0.00033   20.4   1.3   13  115-127    10-23  (46)
107 2drp_A Protein (tramtrack DNA-  43.4     9.9 0.00034   22.0   1.4   12  116-127     9-21  (66)
108 2epr_A POZ-, at HOOK-, and zin  43.4     9.9 0.00034   20.8   1.3   13  115-127    10-23  (48)
109 2enf_A Zinc finger protein 347  43.3     6.6 0.00023   21.2   0.5   13  115-127    10-23  (46)
110 2en1_A Zinc finger protein 224  43.3      10 0.00035   20.3   1.4   13  115-127    10-23  (46)
111 2enh_A Zinc finger protein 28   43.3     5.9  0.0002   21.5   0.3   13  115-127    10-23  (46)
112 2emg_A Zinc finger protein 484  42.9     6.3 0.00022   21.2   0.4   13  115-127    10-23  (46)
113 2en8_A Zinc finger protein 224  42.9      11 0.00039   20.1   1.5   13  115-127    10-23  (46)
114 2yti_A Zinc finger protein 347  42.6     5.5 0.00019   21.5   0.1   13  115-127    10-23  (46)
115 2em6_A Zinc finger protein 224  42.5     6.9 0.00024   21.2   0.5   13  115-127    10-23  (46)
116 1twf_L ABC10-alpha, DNA-direct  42.2     4.4 0.00015   26.6  -0.4   12  113-124    41-53  (70)
117 2epq_A POZ-, at HOOK-, and zin  41.9     7.3 0.00025   20.9   0.6   13  115-127     8-21  (45)
118 2eps_A POZ-, at HOOK-, and zin  41.2      13 0.00044   21.0   1.6   13  115-127    10-23  (54)
119 2eoh_A Zinc finger protein 28   41.2     6.4 0.00022   21.3   0.2   13  115-127    10-23  (46)
120 2yrm_A B-cell lymphoma 6 prote  41.1       7 0.00024   20.9   0.4   13  115-127     8-21  (43)
121 2eou_A Zinc finger protein 473  40.8     6.2 0.00021   21.2   0.1   13  115-127    10-23  (44)
122 2gmg_A Hypothetical protein PF  40.7     6.5 0.00022   27.9   0.3   11  116-126    66-77  (105)
123 2eq1_A Zinc finger protein 347  40.6     6.2 0.00021   21.3   0.1   13  115-127    10-23  (46)
124 2eom_A ZFP-95, zinc finger pro  40.5     6.7 0.00023   21.3   0.2   13  115-127    10-23  (46)
125 1bbo_A Human enhancer-binding   40.5      13 0.00046   20.6   1.6   13  115-127    27-40  (57)
126 2en9_A Zinc finger protein 28   40.1     7.2 0.00025   21.1   0.4   13  115-127    10-23  (46)
127 2eq2_A Zinc finger protein 347  40.0     6.4 0.00022   21.2   0.1   13  115-127    10-23  (46)
128 1f2i_G Fusion of N-terminal 17  39.9      13 0.00045   21.9   1.6   13  115-127    47-60  (73)
129 2gnr_A Conserved hypothetical   39.9     8.7  0.0003   28.0   0.8   16  111-126    39-57  (145)
130 2en7_A Zinc finger protein 268  39.8     6.2 0.00021   20.9   0.0   13  115-127    10-23  (44)
131 2emz_A ZFP-95, zinc finger pro  39.6     7.3 0.00025   21.1   0.3   13  115-127    10-23  (46)
132 2eoe_A Zinc finger protein 347  39.5     8.4 0.00029   20.6   0.6   13  115-127    10-23  (46)
133 1vd4_A Transcription initiatio  39.3      14 0.00048   21.7   1.6   12  116-127    13-25  (62)
134 2yth_A Zinc finger protein 224  38.7     7.9 0.00027   20.9   0.4   13  115-127    10-23  (46)
135 2epx_A Zinc finger protein 28   38.3     8.5 0.00029   20.6   0.5   16  112-127     6-23  (47)
136 2ytn_A Zinc finger protein 347  38.3     8.1 0.00028   20.8   0.4   13  115-127    10-23  (46)
137 2eq4_A Zinc finger protein 224  38.2     7.3 0.00025   20.9   0.2   13  115-127    10-23  (46)
138 2ep1_A Zinc finger protein 484  38.2     7.6 0.00026   20.8   0.2   13  115-127    10-23  (46)
139 2eov_A Zinc finger protein 484  38.0     8.9 0.00031   20.5   0.5   13  115-127    10-23  (46)
140 1x5w_A Zinc finger protein 64,  37.9      15 0.00052   21.5   1.6   12  116-127     8-20  (70)
141 2emk_A Zinc finger protein 28   37.8     8.8  0.0003   20.7   0.5   13  115-127    10-23  (46)
142 2ytq_A Zinc finger protein 268  37.8     9.1 0.00031   20.6   0.5   13  115-127    10-23  (46)
143 2elz_A Zinc finger protein 224  37.0     9.2 0.00031   20.6   0.5   13  115-127    10-23  (46)
144 3h0g_L DNA-directed RNA polyme  36.7     9.9 0.00034   24.6   0.6   17  112-128    33-50  (63)
145 2ely_A Zinc finger protein 224  36.6     9.4 0.00032   20.6   0.5   13  115-127    10-23  (46)
146 1x6e_A Zinc finger protein 24;  36.4      17 0.00057   21.5   1.7   13  115-127    12-25  (72)
147 2ytr_A Zinc finger protein 347  36.1     7.5 0.00026   20.8  -0.0   13  115-127    10-23  (46)
148 2em0_A Zinc finger protein 224  36.1     8.9  0.0003   20.6   0.3   13  115-127    10-23  (46)
149 2eop_A Zinc finger protein 268  35.8     9.6 0.00033   20.4   0.4   13  115-127    10-23  (46)
150 2epz_A Zinc finger protein 28   35.7     9.3 0.00032   20.5   0.4   13  115-127    10-23  (46)
151 2ytt_A Zinc finger protein 473  35.5     8.3 0.00028   20.8   0.1   13  115-127    10-23  (46)
152 2adr_A ADR1; transcription reg  35.3      17 0.00058   20.4   1.5   13  115-127    28-41  (60)
153 1zr9_A Zinc finger protein 593  35.2       4 0.00014   29.6  -1.6   14  114-127    47-61  (124)
154 2ct1_A Transcriptional repress  35.0      17 0.00059   21.7   1.6   13  115-127    13-26  (77)
155 2ytm_A Zinc finger protein 28   34.7     8.3 0.00028   20.9   0.0   13  115-127    10-23  (46)
156 1qyp_A RNA polymerase II; tran  34.1      49  0.0017   19.9   3.6   25  104-128    23-55  (57)
157 2eoq_A Zinc finger protein 224  33.8     9.9 0.00034   20.4   0.2   13  115-127    10-23  (46)
158 2lce_A B-cell lymphoma 6 prote  33.4      19 0.00065   21.3   1.6   13  115-127    43-56  (74)
159 2kdx_A HYPA, hydrogenase/ureas  33.0      15 0.00051   25.4   1.2    7  119-125    92-99  (119)
160 2eln_A Zinc finger protein 406  32.2      22 0.00074   19.7   1.5   13  115-127     7-22  (38)
161 2ctu_A Zinc finger protein 483  32.0      22 0.00076   20.4   1.7   17  112-128    12-30  (73)
162 2gqj_A Zinc finger protein KIA  31.9     3.5 0.00012   26.5  -2.2   12  116-127    23-35  (98)
163 2d9h_A Zinc finger protein 692  31.7      21 0.00071   21.3   1.5   13  115-127    36-49  (78)
164 2lv2_A Insulinoma-associated p  31.7      18 0.00062   23.5   1.3   13  115-127    54-67  (85)
165 1va1_A Transcription factor SP  30.8      16 0.00055   18.7   0.8   13  115-127     6-21  (37)
166 3q87_A Putative uncharacterize  28.6      26 0.00089   25.4   1.8   19  110-129    93-112 (125)
167 1bhi_A CRE-BP1, ATF-2; CRE bin  28.2      31  0.0011   17.3   1.7   13  115-127     4-19  (38)
168 3a43_A HYPD, hydrogenase nicke  27.6      27 0.00092   25.1   1.8   11  118-128    71-82  (139)
169 1dxg_A Desulforedoxin; non-hem  27.2      46  0.0016   18.5   2.4   19  114-132     3-22  (36)
170 1x6h_A Transcriptional repress  27.0      29   0.001   20.6   1.6   13  115-127    13-26  (86)
171 2kmk_A Zinc finger protein GFI  26.3      29 0.00099   20.4   1.5   13  115-127    55-68  (82)
172 2lcq_A Putative toxin VAPC6; P  25.8      26 0.00088   25.2   1.4   12  117-128   132-144 (165)
173 2eod_A TNF receptor-associated  25.7      31   0.001   20.0   1.5   12  116-127     9-21  (66)
174 2cot_A Zinc finger protein 435  25.5      32  0.0011   20.4   1.6   13  115-127    44-57  (77)
175 3zy0_A Tumor protein P63; tran  25.1      38  0.0013   19.2   1.7   14   49-62      9-22  (32)
176 6rxn_A Rubredoxin; electron tr  25.0      33  0.0011   20.6   1.5   11  117-127     4-15  (46)
177 2y69_J Cytochrome C oxidase po  24.9      19 0.00065   24.2   0.5   15   22-36      8-22  (80)
178 2ghf_A ZHX1, zinc fingers and   24.9      30   0.001   23.1   1.5   11  116-126    17-28  (102)
179 2wbs_A Krueppel-like factor 4;  24.8      34  0.0012   20.5   1.6   13  115-127    63-76  (89)
180 1tfi_A Transcriptional elongat  24.6      80  0.0027   18.9   3.3   25  104-128    17-49  (50)
181 1aie_A P53; oligomer, DNA; 1.5  24.5      41  0.0014   18.9   1.8   15   49-63      6-20  (31)
182 1sp2_A SP1F2; zinc finger, tra  24.2      18 0.00061   17.4   0.2   12  116-127     1-15  (31)
183 2ctd_A Zinc finger protein 512  23.2      25 0.00085   22.7   0.8   20  107-126    23-44  (96)
184 2nwa_A Hypothetical protein YT  23.1      39  0.0013   23.2   1.8   26  106-132     6-31  (88)
185 1a1h_A QGSR zinc finger peptid  23.0      37  0.0013   20.3   1.6   13  115-127    60-73  (90)
186 2dmd_A Zinc finger protein 64,  22.7      38  0.0013   20.6   1.6   13  115-127    62-75  (96)
187 1yk4_A Rubredoxin, RD; electro  22.5      36  0.0012   20.8   1.4   10  118-127     3-13  (52)
188 1llm_C Chimera of ZIF23-GCN4;   22.5      38  0.0013   20.6   1.6   13  115-127    29-42  (88)
189 1x6f_A Zinc finger protein 462  22.4      39  0.0013   21.7   1.6   13  115-127    23-36  (88)
190 4rxn_A Rubredoxin; electron tr  22.3      39  0.0013   20.9   1.5   11  117-127     3-14  (54)
191 2i5o_A DNA polymerase ETA; zin  21.2      47  0.0016   19.3   1.6   17  112-128     4-21  (39)
192 2csh_A Zinc finger protein 297  21.0      44  0.0015   21.0   1.7   13  115-127    63-76  (110)
193 2k44_A Hsapbk, K+-channel volt  20.2      18 0.00063   20.0  -0.3    8    4-11     17-24  (28)
194 1ncs_A Peptide M30F, transcrip  20.1      48  0.0016   17.9   1.5   13  115-127    16-31  (47)

No 1  
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus}
Probab=100.00  E-value=2.5e-50  Score=301.56  Aligned_cols=93  Identities=43%  Similarity=0.831  Sum_probs=88.4

Q ss_pred             CCCCCCCCcccccccHHHHHHHHHHcCCCCCCCcccccCCCCCCCCCeeeeCCCCCeEEeeeCCCCCCcceEEEeecCCc
Q psy2945          38 NDLDELPDPLDLATGLEKRELLAELAGDPDPFNVKIRKRGLGTKTQPTEVPSAFEARIVGCICEEESPSINWMWLYEGKP  117 (134)
Q Consensus        38 ~~~g~vptd~eqATGlEr~ELla~~~G~~D~fd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~~dsh~v~W~~l~~g~p  117 (134)
                      ++.|+||||+||||||||+||+++++|+ |||||+++++++|||||||+|||++++|||||+|++|+|+|+||||++|+|
T Consensus        32 a~~g~iPtd~eqATGlER~ELla~~~G~-DpFd~~~~~~~~GTkedP~lVpS~~d~RiVGC~~~~Dsh~v~Wf~L~kg~p  110 (129)
T 2y69_F           32 ASGGGVPTDEEQATGLEREVMLAARKGQ-DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEA  110 (129)
T ss_dssp             ---CBCCCHHHHCCHHHHHHHHHHHTTC-CTTCCSCCCCCCCCSSSCEEEEESSSEEEEEECCSTTCSCCEEEEEESSSC
T ss_pred             cCCCCCCCHHHhccCHHHHHHHHHHcCC-CccccCCCCCCCCcccCCeEeecCCCCeEEeecCCCCCceeEEEEEeCCCc
Confidence            3568999999999999999999999997 999999999999999999999999999999999999999999999999999


Q ss_pred             eee-eCCCEEEEEEe
Q psy2945         118 KRC-MCGHWFKLVYK  131 (134)
Q Consensus       118 ~RC-eCG~~FkL~~~  131 (134)
                      +|| +||+||||+++
T Consensus       111 ~RCpeCG~~fkL~~~  125 (129)
T 2y69_F          111 QRCPSCGTHYKLVPH  125 (129)
T ss_dssp             EECTTTCCEEEEEEC
T ss_pred             eeCCCCCeEEEEeee
Confidence            999 99999999975


No 2  
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ...
Probab=100.00  E-value=1.5e-49  Score=285.37  Aligned_cols=92  Identities=43%  Similarity=0.841  Sum_probs=89.2

Q ss_pred             CCCCCCCcccccccHHHHHHHHHHcCCCCCCCcccccCCCCCCCCCeeeeCCCCCeEEeeeCCCCCCcceEEEeecCCce
Q psy2945          39 DLDELPDPLDLATGLEKRELLAELAGDPDPFNVKIRKRGLGTKTQPTEVPSAFEARIVGCICEEESPSINWMWLYEGKPK  118 (134)
Q Consensus        39 ~~g~vptd~eqATGlEr~ELla~~~G~~D~fd~~~~~~~~GTke~P~lVpS~~~~RiVGC~g~~dsh~v~W~~l~~g~p~  118 (134)
                      +.|+||||+||||||||+||+++++|+ |||||+++++++|||||||+|||++++|||||+|++|+|+|+||||++|+|+
T Consensus         2 ~~g~iPtd~eqATGlEr~Ella~~~G~-Dpfd~~~~~~~~GTke~P~lVpS~~~~RiVGC~~~~D~h~v~W~~l~~g~~~   80 (98)
T 1v54_F            2 SGGGVPTDEEQATGLEREVMLAARKGQ-DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQ   80 (98)
T ss_dssp             CCCBCCCHHHHCCHHHHHHHHHHHTTC-CTTCCSCCCCCCCCSSSCEEEECSSSEEEEEECCSTTCSCCEEEEEESSSCE
T ss_pred             CCCCCCChHHhccCHHHHHHHHHHcCC-CcccccCCCCCCCcccCCeEeecCCCCeEEeecCCCCCceeEEEEEeCCCce
Confidence            468999999999999999999999997 9999999999999999999999999999999999999999999999999999


Q ss_pred             ee-eCCCEEEEEEe
Q psy2945         119 RC-MCGHWFKLVYK  131 (134)
Q Consensus       119 RC-eCG~~FkL~~~  131 (134)
                      || +||+||||++.
T Consensus        81 RC~eCG~~fkL~~~   94 (98)
T 1v54_F           81 RCPSCGTHYKLVPH   94 (98)
T ss_dssp             ECTTTCCEEEEECC
T ss_pred             ECCCCCeEEEEeee
Confidence            99 99999999975


No 3  
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae}
Probab=100.00  E-value=1.8e-37  Score=215.49  Aligned_cols=70  Identities=29%  Similarity=0.387  Sum_probs=51.1

Q ss_pred             cCCCCCCCcccccC-CCCCCCCCeeeeCCCCCeEEeeeC-CCCCCcceEEEeecCCceee-eCCCEEEEEEeCC
Q psy2945          63 AGDPDPFNVKIRKR-GLGTKTQPTEVPSAFEARIVGCIC-EEESPSINWMWLYEGKPKRC-MCGHWFKLVYKAP  133 (134)
Q Consensus        63 ~G~~D~fd~~~~~~-~~GTke~P~lVpS~~~~RiVGC~g-~~dsh~v~W~~l~~g~p~RC-eCG~~FkL~~~~p  133 (134)
                      +|+ |||||+|+++ ++|||||||||||++++|||||+| ++|+|+|+||||++|+++|| +||+||||+++||
T Consensus         1 ~G~-D~fd~~p~~~~~~GT~e~P~lVpS~~~~RiVGC~g~p~d~h~v~W~~l~~g~~~RC~eCG~~fkL~~vg~   73 (80)
T 2odx_A            1 MMA-DVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGV   73 (80)
T ss_dssp             -------------------CCSCSEECCSSSSCCEEESSSTTCCSCCEEECCCTTCEEECSSSCCEEEECCCC-
T ss_pred             CCc-CcccccccccCCCCCccCCeEecCCCCCeEEeeeCCCCCcceEEEEEecCCCCeECCCCCeEEEEEEcCC
Confidence            487 9999999986 799999999999999999999999 49999999999999999999 9999999999997


No 4  
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi}
Probab=98.16  E-value=9.5e-07  Score=59.20  Aligned_cols=50  Identities=16%  Similarity=0.232  Sum_probs=40.8

Q ss_pred             CCCCCeeeeCCCCCeEEeeeC--CCCCCcceEEEe-ecCCceee-eCCCEEEEEEe
Q psy2945          80 TKTQPTEVPSAFEARIVGCIC--EEESPSINWMWL-YEGKPKRC-MCGHWFKLVYK  131 (134)
Q Consensus        80 Tke~P~lVpS~~~~RiVGC~g--~~dsh~v~W~~l-~~g~p~RC-eCG~~FkL~~~  131 (134)
                      |++.|-+|  ..+.|+|.|-|  .+..|-.+|++| .++.+..| -||..|+|+..
T Consensus         2 ~~~ape~i--~v~~r~v~CdGg~g~lgHPrVyl~ld~~~g~~~CpYCg~~f~l~~~   55 (67)
T 2jrr_A            2 TIQAPETK--IVDKSRVACDGGEGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGS   55 (67)
T ss_dssp             CCCCCEEE--EESSSEEEEEESSTTSEEEEEEEECCTTTSEEEETTTTEEEEETTS
T ss_pred             CCCCCceE--EECCCEEEeCCCCCCCCCCEEEEEccCCCCeEECCCCCCEEEECCC
Confidence            55667666  44789999988  456899999999 56788999 99999999743


No 5  
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2}
Probab=97.75  E-value=2.7e-05  Score=53.76  Aligned_cols=49  Identities=16%  Similarity=0.248  Sum_probs=38.5

Q ss_pred             CCCCCeeeeCCCCCeEEeeeC--CCCCCcceEEEe-ecCCceee-eCCCEEEEEE
Q psy2945          80 TKTQPTEVPSAFEARIVGCIC--EEESPSINWMWL-YEGKPKRC-MCGHWFKLVY  130 (134)
Q Consensus        80 Tke~P~lVpS~~~~RiVGC~g--~~dsh~v~W~~l-~~g~p~RC-eCG~~FkL~~  130 (134)
                      |.+-|-+|.  .+.|+|.|-|  .+..|-.+|++| .++.+..| -||..|+|+.
T Consensus        15 ~~~apevI~--V~~~~V~CdGg~g~LGHPrVyL~ld~~~g~~~CpYCg~~f~l~~   67 (80)
T 2jvm_A           15 SIEAPETVV--VSTWKVACDGGEGALGHPRVWLSIPHETGFVECGYCDRRYIHES   67 (80)
T ss_dssp             CCSCCSEEE--ESCSEEEECCCSTTCCCCCEEEECCTTTCEEECSSSSCEEEEHH
T ss_pred             ccCCCCeEE--ECCcEEEcCCCCCCCCCCEEEEEccCCCCeEECCCCCCEEEecC
Confidence            445554442  3369999988  467999999999 57888999 9999999863


No 6  
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str}
Probab=93.55  E-value=0.047  Score=38.04  Aligned_cols=38  Identities=11%  Similarity=0.221  Sum_probs=32.0

Q ss_pred             CeEEeeeC--CCCCCcceEEEeecCCceee-eCCCEEEEEE
Q psy2945          93 ARIVGCIC--EEESPSINWMWLYEGKPKRC-MCGHWFKLVY  130 (134)
Q Consensus        93 ~RiVGC~g--~~dsh~v~W~~l~~g~p~RC-eCG~~FkL~~  130 (134)
                      .|.|-|.|  .+-.|--+|+.|.+.....| -||.-|+++.
T Consensus        22 ~~~v~CdG~~~plgHPrVyL~i~~~g~~~CpYCg~~y~~~~   62 (87)
T 2jz8_A           22 VKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRYDP   62 (87)
T ss_dssp             CSEEECCCSSCSSSSSSCEEECTTCCEECCTTTCCEEECCT
T ss_pred             CcEEEcCCCCCCCCCCEEEEEcCCCCeEECCCCCCEeEcCC
Confidence            35589988  35578889999999888999 9999999874


No 7  
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1
Probab=80.91  E-value=1.2  Score=29.51  Aligned_cols=32  Identities=28%  Similarity=0.601  Sum_probs=22.4

Q ss_pred             CeEEeeeCCCCCCcceEEEeecC-CceeeeCCCEEEEEE
Q psy2945          93 ARIVGCICEEESPSINWMWLYEG-KPKRCMCGHWFKLVY  130 (134)
Q Consensus        93 ~RiVGC~g~~dsh~v~W~~l~~g-~p~RCeCG~~FkL~~  130 (134)
                      |-||||.|..     .|. ++.+ +.+.|.||..++++.
T Consensus         2 Y~vv~C~C~~-----~~~-~~~~~kT~~C~CG~~~~~~k   34 (71)
T 1gh9_A            2 YIIFRCDCGR-----ALY-SREGAKTRKCVCGRTVNVKD   34 (71)
T ss_dssp             EEEEEETTSC-----CEE-EETTCSEEEETTTEEEECCS
T ss_pred             eEEEECCCCC-----EEE-EcCCCcEEECCCCCeeeece
Confidence            5799998743     143 3333 569999999988753


No 8  
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=78.61  E-value=0.98  Score=21.74  Aligned_cols=12  Identities=50%  Similarity=1.220  Sum_probs=10.3

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| .||..|.
T Consensus         2 k~~~C~~C~~~f~   14 (30)
T 2m0d_A            2 KPYQCDYCGRSFS   14 (30)
T ss_dssp             CCEECTTTCCEES
T ss_pred             cCccCCCCCcccC
Confidence            57899 9999985


No 9  
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A
Probab=78.47  E-value=0.94  Score=21.88  Aligned_cols=12  Identities=25%  Similarity=0.484  Sum_probs=10.0

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 k~~~C~~C~k~f~   13 (29)
T 1rik_A            1 YKFACPECPKRFM   13 (29)
T ss_dssp             CCEECSSSSCEES
T ss_pred             CCccCCCCCchhC
Confidence            47889 9999985


No 10 
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=76.48  E-value=1.3  Score=21.30  Aligned_cols=12  Identities=33%  Similarity=0.861  Sum_probs=10.3

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         2 k~~~C~~C~k~f~   14 (27)
T 2kvh_A            2 KPFSCSLCPQRSR   14 (27)
T ss_dssp             CCEECSSSSCEES
T ss_pred             cCccCCCcChhhC
Confidence            57899 9999985


No 11 
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=75.29  E-value=1.2  Score=21.63  Aligned_cols=12  Identities=33%  Similarity=0.789  Sum_probs=10.3

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| .||..|.
T Consensus         2 k~~~C~~C~k~f~   14 (27)
T 2kvg_A            2 APYRCPLCRAGCP   14 (27)
T ss_dssp             CTEEETTTTEEES
T ss_pred             cCcCCCCCCcccC
Confidence            57899 9999885


No 12 
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=77.20  E-value=0.59  Score=22.42  Aligned_cols=13  Identities=46%  Similarity=0.956  Sum_probs=10.4

Q ss_pred             Cceee-eCCCEEEE
Q psy2945         116 KPKRC-MCGHWFKL  128 (134)
Q Consensus       116 ~p~RC-eCG~~FkL  128 (134)
                      +|..| +||..|.-
T Consensus         1 kp~~C~~C~k~f~~   14 (26)
T 2lvu_A            1 KPYVCERCGKRFVQ   14 (26)
Confidence            46789 99999864


No 13 
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=74.03  E-value=1.4  Score=21.06  Aligned_cols=12  Identities=42%  Similarity=1.102  Sum_probs=9.8

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 ~~~~C~~C~k~f~   13 (29)
T 2m0f_A            1 GPLKCRECGKQFT   13 (29)
T ss_dssp             CCEECTTTSCEES
T ss_pred             CCccCCCCCCccC
Confidence            46789 9999885


No 14 
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=71.98  E-value=1.9  Score=22.60  Aligned_cols=14  Identities=21%  Similarity=0.237  Sum_probs=11.5

Q ss_pred             CCceee-eCCCEEEE
Q psy2945         115 GKPKRC-MCGHWFKL  128 (134)
Q Consensus       115 g~p~RC-eCG~~FkL  128 (134)
                      .+|..| +||..|.-
T Consensus         7 ~k~~~C~~C~k~f~~   21 (37)
T 2elm_A            7 GHLYYCSQCHYSSIT   21 (37)
T ss_dssp             SCEEECSSSSCEEEC
T ss_pred             CcCeECCCCCcccCC
Confidence            368999 99999963


No 15 
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=71.81  E-value=2  Score=20.55  Aligned_cols=12  Identities=42%  Similarity=1.257  Sum_probs=10.2

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         2 k~~~C~~C~k~f~   14 (28)
T 2kvf_A            2 RPYSCSVCGKRFS   14 (28)
T ss_dssp             CSEECSSSCCEES
T ss_pred             cCccCCCCCcccC
Confidence            57889 9999885


No 16 
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1
Probab=71.44  E-value=2  Score=21.80  Aligned_cols=13  Identities=31%  Similarity=0.726  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         5 ~k~~~C~~C~k~f~   18 (35)
T 1srk_A            5 KRPFVCRICLSAFT   18 (35)
T ss_dssp             CSCEECSSSCCEES
T ss_pred             CcCeeCCCCCcccC
Confidence            468999 9999985


No 17 
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=70.52  E-value=0.9  Score=21.70  Aligned_cols=12  Identities=33%  Similarity=0.908  Sum_probs=9.6

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 k~~~C~~C~~~f~   13 (29)
T 2m0e_A            1 KEHKCPHCDKKFN   13 (29)
T ss_dssp             CCCCCSSCCCCCC
T ss_pred             CCCcCCCCCcccC
Confidence            46789 8999874


No 18 
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=70.49  E-value=2.1  Score=21.96  Aligned_cols=13  Identities=46%  Similarity=0.899  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         7 ~k~~~C~~C~k~f~   20 (36)
T 2els_A            7 GKIFTCEYCNKVFK   20 (36)
T ss_dssp             CCCEECTTTCCEES
T ss_pred             CCCEECCCCCceeC
Confidence            468999 9999985


No 19 
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=70.26  E-value=2.2  Score=21.70  Aligned_cols=13  Identities=38%  Similarity=0.805  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         7 ~k~~~C~~C~k~f~   20 (36)
T 2elt_A            7 GKPYKCPQCSYASA   20 (36)
T ss_dssp             CCSEECSSSSCEES
T ss_pred             CCCCCCCCCCcccC
Confidence            468999 9999985


No 20 
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=69.99  E-value=2.4  Score=21.37  Aligned_cols=13  Identities=23%  Similarity=0.478  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         5 ~k~~~C~~C~k~f~   18 (35)
T 2elx_A            5 SSGYVCALCLKKFV   18 (35)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeECCCCcchhC
Confidence            468999 9999985


No 21 
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=68.81  E-value=2.6  Score=21.61  Aligned_cols=13  Identities=38%  Similarity=0.815  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         7 ~k~~~C~~C~k~f~   20 (36)
T 2elv_A            7 GLLYDCHICERKFK   20 (36)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCeECCCCCCccC
Confidence            468999 9999985


No 22 
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=68.58  E-value=2.5  Score=21.63  Aligned_cols=13  Identities=38%  Similarity=0.935  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus         7 ~k~~~C~~C~k~f~   20 (36)
T 2elq_A            7 GKPFKCSLCEYATR   20 (36)
T ss_dssp             CCSEECSSSSCEES
T ss_pred             CCCccCCCCCchhC
Confidence            468999 9999985


No 23 
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=71.25  E-value=1.1  Score=21.84  Aligned_cols=13  Identities=54%  Similarity=1.175  Sum_probs=10.2

Q ss_pred             Cceee-eCCCEEEE
Q psy2945         116 KPKRC-MCGHWFKL  128 (134)
Q Consensus       116 ~p~RC-eCG~~FkL  128 (134)
                      +|..| +||..|.-
T Consensus         1 k~~~C~~C~k~f~~   14 (29)
T 2lvt_A            1 KPCQCVMCGKAFTQ   14 (29)
Confidence            46789 89999863


No 24 
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A
Probab=67.93  E-value=1.2  Score=21.39  Aligned_cols=12  Identities=25%  Similarity=0.692  Sum_probs=9.5

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| .||..|.
T Consensus         1 k~~~C~~C~~~f~   13 (29)
T 1ard_A            1 RSFVCEVCTRAFA   13 (29)
T ss_dssp             CCCBCTTTCCBCS
T ss_pred             CCeECCCCCcccC
Confidence            46789 8999884


No 25 
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=66.73  E-value=1.3  Score=21.56  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=9.6

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 k~~~C~~C~k~f~   13 (30)
T 1paa_A            1 KAYACGLCNRAFT   13 (30)
T ss_dssp             CCSBCTTTCCBCS
T ss_pred             CCcCCcccCcccC
Confidence            46789 9999885


No 26 
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=66.04  E-value=3  Score=21.44  Aligned_cols=13  Identities=31%  Similarity=1.111  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         7 ~k~~~C~~C~k~f~   20 (37)
T 2elp_A            7 GRAMKCPYCDFYFM   20 (37)
T ss_dssp             CCCEECSSSSCEEC
T ss_pred             CCCeECCCCChhhc
Confidence            468999 9999986


No 27 
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A
Probab=63.91  E-value=1.6  Score=22.47  Aligned_cols=13  Identities=38%  Similarity=0.743  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         9 ~k~~~C~~C~k~f~   22 (37)
T 1p7a_A            9 IKPFQCPDCDRSFS   22 (37)
T ss_dssp             SSSBCCTTTCCCBS
T ss_pred             CCCccCCCCCcccC
Confidence            468999 9999884


No 28 
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=63.78  E-value=2  Score=22.09  Aligned_cols=13  Identities=31%  Similarity=0.912  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         7 ~k~~~C~~C~k~f~   20 (37)
T 2elo_A            7 GRSYSCPVCEKSFS   20 (37)
T ss_dssp             CCCCEETTTTEECS
T ss_pred             CCCcCCCCCCCccC
Confidence            468999 9999885


No 29 
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}
Probab=62.94  E-value=3.3  Score=23.29  Aligned_cols=13  Identities=46%  Similarity=1.219  Sum_probs=11.2

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         5 ~kp~~C~~C~k~F~   18 (48)
T 3iuf_A            5 DKPYACDICGKRYK   18 (48)
T ss_dssp             TSCEECTTTCCEES
T ss_pred             CcCEECCCcCcccC
Confidence            468999 8999996


No 30 
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A
Probab=62.89  E-value=3.4  Score=21.65  Aligned_cols=13  Identities=23%  Similarity=0.736  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         4 ~k~~~C~~C~k~f~   17 (39)
T 1njq_A            4 PRSYTCSFCKREFR   17 (39)
T ss_dssp             SSSEECTTTCCEES
T ss_pred             CCceECCCCCcccC
Confidence            468999 9999985


No 31 
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}
Probab=66.79  E-value=1.5  Score=21.13  Aligned_cols=13  Identities=38%  Similarity=0.715  Sum_probs=10.4

Q ss_pred             Cceee-eCCCEEEE
Q psy2945         116 KPKRC-MCGHWFKL  128 (134)
Q Consensus       116 ~p~RC-eCG~~FkL  128 (134)
                      +|..| .||..|.-
T Consensus         2 k~~~C~~C~k~f~~   15 (30)
T 2lvr_A            2 KPYVCIHCQRQFAD   15 (30)
Confidence            57789 89998863


No 32 
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A
Probab=62.47  E-value=1.6  Score=20.91  Aligned_cols=12  Identities=25%  Similarity=0.551  Sum_probs=9.4

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 k~~~C~~C~k~f~   13 (30)
T 1klr_A            1 KTYQCQYCEFRSA   13 (30)
T ss_dssp             CCCCCSSSSCCCS
T ss_pred             CCccCCCCCCccC
Confidence            46789 8998874


No 33 
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B
Probab=61.41  E-value=2.1  Score=24.04  Aligned_cols=14  Identities=29%  Similarity=0.520  Sum_probs=11.7

Q ss_pred             cCCceee-eCCCEEE
Q psy2945         114 EGKPKRC-MCGHWFK  127 (134)
Q Consensus       114 ~g~p~RC-eCG~~Fk  127 (134)
                      ..+|..| +||..|.
T Consensus         5 gekp~~C~~CgK~F~   19 (36)
T 1fv5_A            5 KPARFMCLPCGIAFS   19 (36)
T ss_dssp             SCCCCEETTTTEECS
T ss_pred             CccCeECCCCCCccC
Confidence            4579999 9999885


No 34 
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.67  E-value=4.4  Score=21.88  Aligned_cols=13  Identities=46%  Similarity=0.968  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (44)
T 2epv_A           10 EKPYECNECGKAFI   23 (44)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCeECCCCCcccC
Confidence            468999 9999985


No 35 
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A
Probab=60.32  E-value=4.4  Score=21.33  Aligned_cols=13  Identities=38%  Similarity=0.912  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus         9 ~~~~~C~~C~k~f~   22 (42)
T 2epc_A            9 ETPYLCGQCGKSFT   22 (42)
T ss_dssp             SCCEECSSSCCEES
T ss_pred             CCCeECCCCCcccC
Confidence            468999 9999985


No 36 
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=59.50  E-value=4.3  Score=21.42  Aligned_cols=13  Identities=46%  Similarity=1.089  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus         9 ~k~~~C~~C~k~f~   22 (42)
T 2en2_A            9 EKPYKCETCGARFV   22 (42)
T ss_dssp             SCSEECTTTCCEES
T ss_pred             CCCEeCCCcChhhC
Confidence            468999 9999985


No 37 
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}
Probab=57.93  E-value=1.3  Score=22.55  Aligned_cols=12  Identities=25%  Similarity=0.545  Sum_probs=9.3

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 kp~~C~~C~k~f~   13 (32)
T 2kfq_A            1 YAFACPACPKRFM   13 (32)
T ss_dssp             CCSSSSSSCTTHH
T ss_pred             CCCCCCCCCcccC
Confidence            46789 8998774


No 38 
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=57.80  E-value=2.6  Score=21.41  Aligned_cols=13  Identities=62%  Similarity=1.268  Sum_probs=10.6

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| +||..|.
T Consensus         7 ~~~~~C~~C~k~f~   20 (36)
T 2elr_A            7 GKTHLCDMCGKKFK   20 (36)
T ss_dssp             CSSCBCTTTCCBCS
T ss_pred             CCCeecCcCCCCcC
Confidence            467999 9999884


No 39 
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=57.79  E-value=5.3  Score=21.02  Aligned_cols=13  Identities=31%  Similarity=0.841  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         8 ~k~~~C~~C~k~f~   21 (41)
T 2ept_A            8 QRVYECQECGKSFR   21 (41)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCeECCCCCCCcC
Confidence            468999 9999985


No 40 
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.49  E-value=5.1  Score=21.60  Aligned_cols=13  Identities=46%  Similarity=1.150  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eow_A           10 EKPYKCNECGKAFR   23 (46)
T ss_dssp             CCCEECTTSCCEES
T ss_pred             CCCeeccccCChhc
Confidence            468999 9999985


No 41 
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1
Probab=57.11  E-value=2.3  Score=21.79  Aligned_cols=12  Identities=25%  Similarity=0.484  Sum_probs=9.5

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         1 kp~~C~~C~k~F~   13 (33)
T 1rim_A            1 YKFACPECPKRFM   13 (33)
T ss_dssp             CCCCCSSSCCCCS
T ss_pred             CcccCCCCCchhC
Confidence            46789 9999874


No 42 
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=56.68  E-value=5.6  Score=21.41  Aligned_cols=13  Identities=46%  Similarity=0.904  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2yts_A           10 EKPYICNECGKSFI   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCEECCCCChhhC
Confidence            468999 9999985


No 43 
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=56.52  E-value=5.6  Score=21.55  Aligned_cols=13  Identities=31%  Similarity=0.777  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2ytp_A           10 ERHYECSECGKAFA   23 (46)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCeECCcCCcccC
Confidence            468999 9999985


No 44 
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}
Probab=56.33  E-value=4.5  Score=24.77  Aligned_cols=12  Identities=33%  Similarity=1.107  Sum_probs=8.7

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus         3 Kpy~C~~C~k~F~   15 (60)
T 4gzn_C            3 RPFFCNFCGKTYR   15 (60)
T ss_dssp             CCEECTTTCCEES
T ss_pred             CCccCCCCCCEeC
Confidence            67777 7777774


No 45 
>3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus}
Probab=56.16  E-value=3.4  Score=30.10  Aligned_cols=19  Identities=32%  Similarity=0.651  Sum_probs=12.9

Q ss_pred             EEEeecCCc--eee-eCCCEEE
Q psy2945         109 WMWLYEGKP--KRC-MCGHWFK  127 (134)
Q Consensus       109 W~~l~~g~p--~RC-eCG~~Fk  127 (134)
                      |=-|.+|+.  +|| .||++|-
T Consensus        37 ~~~l~~grL~~~rC~~CG~~~~   58 (145)
T 3irb_A           37 FNGLKQNKIIGSKCSKCGRIFV   58 (145)
T ss_dssp             HHHHHTTCCEEEECTTTCCEEE
T ss_pred             HHHHHcCeEEEEEeCCCCcEEc
Confidence            334567775  888 8888763


No 46 
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=56.15  E-value=5.7  Score=21.43  Aligned_cols=13  Identities=31%  Similarity=0.733  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        10 ~~~~~C~~C~k~F~   23 (46)
T 2emi_A           10 ERHYECSECGKAFI   23 (46)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCCCCCCCCcccC
Confidence            468999 9999995


No 47 
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.82  E-value=5.4  Score=21.32  Aligned_cols=13  Identities=31%  Similarity=0.608  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (44)
T 2emb_A           10 RKRYECSKCQATFN   23 (44)
T ss_dssp             CSSEECTTTCCEES
T ss_pred             CCCeECCCCCCccC
Confidence            468999 9999996


No 48 
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.69  E-value=5.9  Score=21.30  Aligned_cols=13  Identities=54%  Similarity=1.122  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2yrj_A           10 EKPYRCGECGKAFA   23 (46)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCeECCCCCCccC
Confidence            468999 9999996


No 49 
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.59  E-value=5  Score=21.46  Aligned_cols=13  Identities=38%  Similarity=0.869  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~F~   23 (44)
T 2eox_A           10 SKSYNCNECGKAFT   23 (44)
T ss_dssp             CCCEEETTTTEEES
T ss_pred             CCCeECcccCcccC
Confidence            468999 9999985


No 50 
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.48  E-value=6  Score=21.35  Aligned_cols=13  Identities=54%  Similarity=1.135  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ep3_A           10 EKPYRCAECGKAFT   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeECCCCCchhC
Confidence            468999 9999985


No 51 
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.29  E-value=5.9  Score=21.15  Aligned_cols=13  Identities=31%  Similarity=0.866  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (44)
T 2yu5_A           10 ENPFKCSKCDRVFT   23 (44)
T ss_dssp             CCSEECSSSSCEES
T ss_pred             CCCeECCCCCchhC
Confidence            468999 9999996


No 52 
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.27  E-value=5.7  Score=21.51  Aligned_cols=16  Identities=44%  Similarity=0.912  Sum_probs=12.3

Q ss_pred             eecC-Cceee-eCCCEEE
Q psy2945         112 LYEG-KPKRC-MCGHWFK  127 (134)
Q Consensus       112 l~~g-~p~RC-eCG~~Fk  127 (134)
                      .+.| +|..| .||..|.
T Consensus         6 ~H~~~k~~~C~~C~k~f~   23 (46)
T 2em4_A            6 SGTGQRPYECIECGKAFK   23 (46)
T ss_dssp             CCCCSSSEECSSSCCEES
T ss_pred             ccCCCcCcCCCCCCCccC
Confidence            3444 68999 9999986


No 53 
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A
Probab=54.92  E-value=6.3  Score=20.74  Aligned_cols=13  Identities=38%  Similarity=0.981  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         8 ~k~~~C~~C~k~f~   21 (42)
T 2el5_A            8 ENPYECSECGKAFN   21 (42)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCccCCCcChhhC
Confidence            468999 9999985


No 54 
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.84  E-value=5.2  Score=21.57  Aligned_cols=13  Identities=46%  Similarity=1.081  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (45)
T 2epu_A           10 QKPFECTHCGKSFR   23 (45)
T ss_dssp             CCSEEETTTTEEES
T ss_pred             CcCccCCCCCCccC
Confidence            468999 9999985


No 55 
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.84  E-value=6.2  Score=21.20  Aligned_cols=13  Identities=38%  Similarity=0.818  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytf_A           10 EKPFECSECQKAFN   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCcCCCCCCcccC
Confidence            468999 9999985


No 56 
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A
Probab=54.71  E-value=6.1  Score=21.39  Aligned_cols=13  Identities=46%  Similarity=1.001  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2emj_A           10 EKPFECAECGKSFS   23 (46)
T ss_dssp             CCSEECSSSSCEES
T ss_pred             CCCEECCCCCcccC
Confidence            368999 9999995


No 57 
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.66  E-value=6.3  Score=21.25  Aligned_cols=13  Identities=46%  Similarity=0.974  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2en3_A           10 EKPFQCKECGMNFS   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeeCcccChhhC
Confidence            468999 9999985


No 58 
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.59  E-value=6.3  Score=21.25  Aligned_cols=13  Identities=38%  Similarity=0.958  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~F~   23 (46)
T 2em3_A           10 EKPYECKVCSKAFT   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCeECCCCCcccC
Confidence            468999 9999985


No 59 
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=53.50  E-value=6  Score=22.43  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        22 ~k~~~C~~C~k~f~   35 (54)
T 1yui_A           22 EQPATCPICYAVIR   35 (54)
T ss_dssp             SCCEECTTTCCEES
T ss_pred             CCCccCCCCCcccC
Confidence            368999 9999985


No 60 
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.29  E-value=6.5  Score=20.82  Aligned_cols=13  Identities=38%  Similarity=0.848  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (44)
T 2eof_A           10 EKPYECNECQKAFN   23 (44)
T ss_dssp             CCSEECTTTCCEES
T ss_pred             CCCeECCCCCcccC
Confidence            468999 9999996


No 61 
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=53.16  E-value=6.7  Score=21.22  Aligned_cols=13  Identities=31%  Similarity=0.608  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eoy_A           10 EKCFKCNKCEKTFS   23 (46)
T ss_dssp             SCCEECSSSCCEES
T ss_pred             CCCEECcCCCCcCC
Confidence            368999 9999985


No 62 
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.97  E-value=5.8  Score=21.47  Aligned_cols=13  Identities=46%  Similarity=1.055  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eoz_A           10 EKPYSCNVCGKAFV   23 (46)
T ss_dssp             CCSEEETTTTEEES
T ss_pred             CCCeECcccChhhC
Confidence            468999 9999985


No 63 
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.84  E-value=6.8  Score=21.19  Aligned_cols=13  Identities=46%  Similarity=0.961  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2emf_A           10 GKHFECTECGKAFT   23 (46)
T ss_dssp             SCCEECSSSCCEES
T ss_pred             CCCeECCCCCchhC
Confidence            468999 9999996


No 64 
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.66  E-value=6.7  Score=21.15  Aligned_cols=13  Identities=46%  Similarity=1.175  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2eq0_A           10 EKPYKCHECGKVFR   23 (46)
T ss_dssp             CCCEECTTTCCEES
T ss_pred             CCCeECCCCCchhC
Confidence            468999 9999995


No 65 
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A
Probab=52.16  E-value=7.3  Score=20.90  Aligned_cols=13  Identities=46%  Similarity=1.096  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2em9_A           10 EKPYNCKECGKSFR   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCeECCccccccC
Confidence            468999 9999995


No 66 
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.88  E-value=7.2  Score=21.00  Aligned_cols=13  Identities=38%  Similarity=0.963  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2emy_A           10 ENPYECHECGKAFS   23 (46)
T ss_dssp             SCCEECSSSCCEES
T ss_pred             CcCcCCCCCCcccC
Confidence            468999 9999985


No 67 
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.56  E-value=7.5  Score=20.99  Aligned_cols=13  Identities=46%  Similarity=1.058  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2yto_A           10 EKPYKCSDCGKAFT   23 (46)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCEECcccCCccC
Confidence            468999 9999985


No 68 
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.46  E-value=7.2  Score=20.93  Aligned_cols=13  Identities=46%  Similarity=0.966  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2eor_A           10 EKPYNCEECGKAFI   23 (46)
T ss_dssp             CCSEECTTTCCEES
T ss_pred             CcCccCCCCCCCcC
Confidence            468999 9999985


No 69 
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=51.33  E-value=3.3  Score=26.21  Aligned_cols=15  Identities=33%  Similarity=0.736  Sum_probs=12.3

Q ss_pred             ecCCceee-eCCCEEE
Q psy2945         113 YEGKPKRC-MCGHWFK  127 (134)
Q Consensus       113 ~~g~p~RC-eCG~~Fk  127 (134)
                      .+.+|..| +||..|.
T Consensus         9 ~~ekpy~C~~CgK~F~   24 (66)
T 2epp_A            9 REAGILPCGLCGKVFT   24 (66)
T ss_dssp             CCCCCCCCTTTCCCCS
T ss_pred             CCccCcCCCCCCCccC
Confidence            45689999 9999885


No 70 
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.80  E-value=7.9  Score=20.91  Aligned_cols=16  Identities=38%  Similarity=0.800  Sum_probs=12.2

Q ss_pred             eecC-Cceee-eCCCEEE
Q psy2945         112 LYEG-KPKRC-MCGHWFK  127 (134)
Q Consensus       112 l~~g-~p~RC-eCG~~Fk  127 (134)
                      .+.| +|..| .||..|.
T Consensus         6 ~H~~~k~~~C~~C~k~F~   23 (46)
T 2eoo_A            6 SGSGERPYGCNECGKNFG   23 (46)
T ss_dssp             CCSCCCCEECSSSCCEES
T ss_pred             CCCCCCCEEccccCcccC
Confidence            3444 68999 9999985


No 71 
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.55  E-value=7.8  Score=20.85  Aligned_cols=13  Identities=46%  Similarity=1.109  Sum_probs=11.1

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2yu8_A           10 EKPYKCNECGKVFT   23 (46)
T ss_dssp             CSSEECSSSCCEES
T ss_pred             CCCeECCcCCchhC
Confidence            468999 9999986


No 72 
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.47  E-value=4.6  Score=21.56  Aligned_cols=13  Identities=38%  Similarity=0.989  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (44)
T 2eoj_A           10 ENPYECCECGKVFS   23 (44)
T ss_dssp             CCSCEETTTTEECS
T ss_pred             CcCeeCCCCCCccC
Confidence            368999 9999885


No 73 
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.40  E-value=8.1  Score=20.86  Aligned_cols=13  Identities=46%  Similarity=1.119  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2em2_A           10 EKPFKCKECGKAFR   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCEECCcCCchhC
Confidence            468999 9999985


No 74 
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A
Probab=50.28  E-value=7.9  Score=20.83  Aligned_cols=13  Identities=38%  Similarity=0.892  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ema_A           10 EKRYKCNECGKVFS   23 (46)
T ss_dssp             SCCEECSSSCCEES
T ss_pred             CcCcCCCCCcchhC
Confidence            368999 9999985


No 75 
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.16  E-value=8  Score=20.81  Aligned_cols=13  Identities=46%  Similarity=1.109  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2ytk_A           10 EKPYKCNECGKVFT   23 (46)
T ss_dssp             SCSEECSSSCCEES
T ss_pred             CCCEeCCcCCCccC
Confidence            468999 9999985


No 76 
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=50.10  E-value=8  Score=20.58  Aligned_cols=13  Identities=38%  Similarity=0.797  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         8 ~k~~~C~~C~k~f~   21 (44)
T 2emx_A            8 EKPFGCSCCEKAFS   21 (44)
T ss_dssp             CCCEECSSSSCEES
T ss_pred             CcCccCCCCCcccC
Confidence            368999 9999985


No 77 
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1
Probab=49.98  E-value=3.5  Score=19.34  Aligned_cols=11  Identities=27%  Similarity=0.887  Sum_probs=7.9

Q ss_pred             ceee-eCCCEEE
Q psy2945         117 PKRC-MCGHWFK  127 (134)
Q Consensus       117 p~RC-eCG~~Fk  127 (134)
                      |..| .||..|.
T Consensus         1 ~~~C~~C~k~f~   12 (27)
T 1znf_A            1 XYKCGLCERSFV   12 (27)
T ss_dssp             -CBCSSSCCBCS
T ss_pred             CccCCCCCCcCC
Confidence            4579 8998874


No 78 
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.44  E-value=8.5  Score=20.68  Aligned_cols=13  Identities=46%  Similarity=0.953  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytj_A           10 EKPYICAECGKAFT   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCeECCCCChhhC
Confidence            468999 9999985


No 79 
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=49.07  E-value=8.5  Score=20.76  Aligned_cols=13  Identities=38%  Similarity=0.920  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2em5_A           10 TKSHQCHECGRGFT   23 (46)
T ss_dssp             SCSEECSSSCCEES
T ss_pred             CCCeECCcCCCccC
Confidence            468999 9999995


No 80 
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.98  E-value=8.8  Score=20.62  Aligned_cols=13  Identities=46%  Similarity=0.907  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2emp_A           10 VKPYMCNECGKAFS   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCeECCCCCchhC
Confidence            468999 9999985


No 81 
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.93  E-value=8.8  Score=20.54  Aligned_cols=13  Identities=46%  Similarity=0.991  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2epw_A           10 EKPCKCTECGKAFC   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeeCCCCCCccC
Confidence            368999 9999985


No 82 
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A
Probab=48.88  E-value=8.6  Score=20.59  Aligned_cols=13  Identities=38%  Similarity=0.797  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2el4_A           10 VKPYGCSQCAKTFS   23 (46)
T ss_dssp             CCSEECSSSSCEES
T ss_pred             CCceECCCCCchhC
Confidence            468999 9999985


No 83 
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.82  E-value=7.4  Score=20.94  Aligned_cols=13  Identities=38%  Similarity=1.058  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ysp_A           10 EKPYKCEKCGKGYN   23 (46)
T ss_dssp             CCSEEETTTTEEES
T ss_pred             CCCeECCCCCCccC
Confidence            468999 9999986


No 84 
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.23  E-value=8.7  Score=20.65  Aligned_cols=13  Identities=38%  Similarity=1.032  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2emh_A           10 ERPYICTVCGKAFT   23 (46)
T ss_dssp             CCSEECTTTCCEES
T ss_pred             CCCcCCCCCCchhC
Confidence            368999 9999985


No 85 
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=48.17  E-value=9.2  Score=20.54  Aligned_cols=13  Identities=46%  Similarity=0.986  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2enc_A           10 EKPFKCEECGKGFY   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCcCCCCCCCcCC
Confidence            368999 9999985


No 86 
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.99  E-value=8.8  Score=20.62  Aligned_cols=13  Identities=46%  Similarity=1.175  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ene_A           10 EKPYKCNECGKVFR   23 (46)
T ss_dssp             SSSEECSSSCCEES
T ss_pred             CCCeECCCCCchhC
Confidence            468999 9999995


No 87 
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.94  E-value=4.8  Score=21.33  Aligned_cols=13  Identities=46%  Similarity=1.201  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus         9 ~k~~~C~~C~k~f~   22 (42)
T 2eos_A            9 EKPYPCEICGTRFR   22 (42)
T ss_dssp             SCCBCCSSSCCCBS
T ss_pred             CCCEECCCCCCccC
Confidence            468999 9999885


No 88 
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.84  E-value=4.6  Score=21.25  Aligned_cols=13  Identities=54%  Similarity=1.160  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         9 ~k~~~C~~C~k~f~   22 (42)
T 2ytb_A            9 EKPYRCDQCGKAFS   22 (42)
T ss_dssp             CCSBCCTTTTCCBS
T ss_pred             CCCeeCCCccchhC
Confidence            468999 9999885


No 89 
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.73  E-value=8.9  Score=20.61  Aligned_cols=13  Identities=38%  Similarity=0.892  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2yso_A           10 EKSHQCRECGEIFF   23 (46)
T ss_dssp             CCCEECTTTCCEES
T ss_pred             CCCEEccccChhhC
Confidence            368999 9999986


No 90 
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.63  E-value=5.1  Score=21.79  Aligned_cols=13  Identities=46%  Similarity=1.242  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eon_A           10 EKPYKCQVCGKAFR   23 (46)
T ss_dssp             CCSCBCSSSCCBCS
T ss_pred             CcccCCCCCCcccC
Confidence            468999 9999885


No 91 
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.58  E-value=9.5  Score=20.40  Aligned_cols=13  Identities=46%  Similarity=0.979  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eme_A           10 EKPYVCDYCGKAFG   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeECCCCChhhC
Confidence            468999 9999985


No 92 
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.40  E-value=9.6  Score=20.45  Aligned_cols=13  Identities=46%  Similarity=1.017  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2em7_A           10 EKPYKCEECGKGFI   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCccCCCccchhC
Confidence            368999 9999986


No 93 
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.39  E-value=9.6  Score=20.46  Aligned_cols=13  Identities=46%  Similarity=1.117  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eml_A           10 EKPYECSVCGKAFS   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeeCCCcCCccC
Confidence            468999 9999985


No 94 
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.88  E-value=9.9  Score=20.48  Aligned_cols=13  Identities=46%  Similarity=1.104  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2em8_A           10 EKPYKCVECGKGYK   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeECcccCchhC
Confidence            468999 9999985


No 95 
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.82  E-value=10  Score=20.31  Aligned_cols=13  Identities=38%  Similarity=1.091  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2emm_A           10 ERPHKCNECGKSFI   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeeCCCCChhhC
Confidence            368999 9999985


No 96 
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.59  E-value=5.2  Score=21.02  Aligned_cols=13  Identities=38%  Similarity=0.810  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus         8 ~k~~~C~~C~k~f~   21 (42)
T 2yte_A            8 EKPYSCAECKETFS   21 (42)
T ss_dssp             CCSCBCTTTCCBCS
T ss_pred             CCCeECCCCCCccC
Confidence            468999 9999885


No 97 
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1
Probab=46.57  E-value=7.8  Score=31.78  Aligned_cols=42  Identities=26%  Similarity=0.636  Sum_probs=28.8

Q ss_pred             CCCCeEEee-eCC-------------CCCCcceEEEeec-----C----Cceee-eCCCEEEEEEe
Q psy2945          90 AFEARIVGC-ICE-------------EESPSINWMWLYE-----G----KPKRC-MCGHWFKLVYK  131 (134)
Q Consensus        90 ~~~~RiVGC-~g~-------------~dsh~v~W~~l~~-----g----~p~RC-eCG~~FkL~~~  131 (134)
                      ....|+.-| .|+             +++..+.++.+..     +    +..-| .|++|+|..+.
T Consensus       203 ~~G~R~l~Cs~C~t~W~~~R~~C~~Cg~~~~l~y~~~e~~~~~~~~~~~r~e~C~~C~~YlK~~~~  268 (309)
T 2fiy_A          203 ETGLRYLSCSLCACEWHYVRIKCSHCEESKHLAYLSLEHDGQPAEKAVLRAETCPSCQGYLKQFYL  268 (309)
T ss_dssp             -CCEEEEEETTTCCEEECCTTSCSSSCCCSCCEEECCCC-CCCSTTCSEEEEEETTTTEEEEEEET
T ss_pred             CCCcEEEEeCCCCCEEeecCcCCcCCCCCCCeeEEEecCccccCCCcceEEEEcccccchHhhhhh
Confidence            467788888 222             2335577777775     4    24789 89999999864


No 98 
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.19  E-value=9.7  Score=20.44  Aligned_cols=13  Identities=38%  Similarity=1.030  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2ytg_A           10 EKPFKCGECGKSYN   23 (46)
T ss_dssp             CCSEECTTTCCEES
T ss_pred             CCCeECCCCCcccC
Confidence            468999 9999986


No 99 
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.00  E-value=10  Score=20.30  Aligned_cols=13  Identities=46%  Similarity=1.147  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ep2_A           10 EKPYECSICGKSFT   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCcCCCCCCcccC
Confidence            468999 9999985


No 100
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.98  E-value=10  Score=20.31  Aligned_cols=13  Identities=38%  Similarity=1.045  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2ep0_A           10 EKPYKCDVCHKSFR   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CCCeeCcccCcccC
Confidence            467999 9999985


No 101
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}
Probab=45.72  E-value=10  Score=20.40  Aligned_cols=13  Identities=31%  Similarity=0.802  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2el6_A           10 VNPYKCSQCEKSFS   23 (46)
T ss_dssp             CCSEECSSSSCEES
T ss_pred             CCCeECCCCCcccC
Confidence            367999 9999985


No 102
>2y9f_A LSL-150, hemolytic lectin LSLA; sugar binding protein; 1.47A {Laetiporus sulphureus} PDB: 2y9g_A*
Probab=45.60  E-value=10  Score=28.42  Aligned_cols=45  Identities=24%  Similarity=0.269  Sum_probs=30.6

Q ss_pred             CeeeeCCC-CCeEEeeeCCCCCCcceEEEeecCCceeeeCCCEEEEEEe
Q psy2945          84 PTEVPSAF-EARIVGCICEEESPSINWMWLYEGKPKRCMCGHWFKLVYK  131 (134)
Q Consensus        84 P~lVpS~~-~~RiVGC~g~~dsh~v~W~~l~~g~p~RCeCG~~FkL~~~  131 (134)
                      =.++.|.. .++.|||+.+..--.=+||.+++|+-.   -..||.|+..
T Consensus        69 g~vlfsr~~~~p~vG~~d~Dgky~dnwF~~E~gk~~---l~g~frLv~p  114 (150)
T 2y9f_A           69 GKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTY---LSKYFRLVQP  114 (150)
T ss_dssp             CCEEEECSSSSSSEEEESSSSCSGGGCBEEEECCGG---GTTCEEEEET
T ss_pred             CcEEEEecCCCCccceeCCCCccccccEEEccCCcc---ccceEEEEee
Confidence            34677776 899999984433344499999999832   2456777653


No 103
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.16  E-value=11  Score=20.21  Aligned_cols=13  Identities=46%  Similarity=1.096  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytd_A           10 EKPYKCSECGKAFH   23 (46)
T ss_dssp             CCSEECSSSCCEES
T ss_pred             CcCeECCCCCCeeC
Confidence            368999 9999985


No 104
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.38  E-value=6.3  Score=21.17  Aligned_cols=13  Identities=46%  Similarity=1.050  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eq3_A           10 EKPYECNQCGKAFS   23 (46)
T ss_dssp             CCSSEETTTTEECS
T ss_pred             CCCeECCCCChhhC
Confidence            468999 9999885


No 105
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}
Probab=43.62  E-value=11  Score=20.93  Aligned_cols=13  Identities=31%  Similarity=0.664  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        30 ~~~~~C~~C~~~f~   43 (57)
T 3uk3_C           30 EKPYKCEFCEYAAA   43 (57)
T ss_dssp             CCCEECSSSSCEES
T ss_pred             CCCcCCCCCcchhC
Confidence            467999 8999885


No 106
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.54  E-value=9.8  Score=20.43  Aligned_cols=13  Identities=46%  Similarity=0.992  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2en6_A           10 EKPYGCNECGKTFS   23 (46)
T ss_dssp             SCCEEETTTTEEES
T ss_pred             CcCeECCCCCcccC
Confidence            367999 9999985


No 107
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1
Probab=43.41  E-value=9.9  Score=21.95  Aligned_cols=12  Identities=25%  Similarity=0.875  Sum_probs=7.7

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| .||..|.
T Consensus         9 k~~~C~~C~k~f~   21 (66)
T 2drp_A            9 HTYRCKVCSRVYT   21 (66)
T ss_dssp             TEEECTTTCCEES
T ss_pred             cceECCCCcchhC
Confidence            45667 6776664


No 108
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=43.41  E-value=9.9  Score=20.81  Aligned_cols=13  Identities=38%  Similarity=1.032  Sum_probs=10.6

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| +||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (48)
T 2epr_A           10 RKQVACEICGKIFR   23 (48)
T ss_dssp             CCSEEETTTTEEES
T ss_pred             CcCeeCCCCCcccC
Confidence            467899 8999885


No 109
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.32  E-value=6.6  Score=21.17  Aligned_cols=13  Identities=46%  Similarity=1.109  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2enf_A           10 EKPYKCNECGKVFT   23 (46)
T ss_dssp             CCSCBCSSSCCBCS
T ss_pred             CcCeECCCCCcccC
Confidence            468999 9999885


No 110
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.29  E-value=10  Score=20.34  Aligned_cols=13  Identities=46%  Similarity=1.104  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2en1_A           10 EKPFKCEECGKRFT   23 (46)
T ss_dssp             CCSEEETTTTEEES
T ss_pred             CCCeeCCCCCcccC
Confidence            467999 9999985


No 111
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.29  E-value=5.9  Score=21.46  Aligned_cols=13  Identities=38%  Similarity=0.922  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2enh_A           10 EKPYECDVCRKAFS   23 (46)
T ss_dssp             SSSCBCTTTCCBCS
T ss_pred             CCCcCCCCcCchhC
Confidence            368999 9999885


No 112
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.92  E-value=6.3  Score=21.24  Aligned_cols=13  Identities=38%  Similarity=0.887  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2emg_A           10 ENPFICSECGKVFT   23 (46)
T ss_dssp             CCSCBCTTTCCBCS
T ss_pred             CCCEECCccCcccC
Confidence            467999 9999885


No 113
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=42.88  E-value=11  Score=20.05  Aligned_cols=13  Identities=38%  Similarity=0.820  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2en8_A           10 EKSHTCDECGKNFC   23 (46)
T ss_dssp             CSSEECTTTCCEES
T ss_pred             CCCeECCCcCcccC
Confidence            468999 9999985


No 114
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.61  E-value=5.5  Score=21.51  Aligned_cols=13  Identities=46%  Similarity=1.109  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2yti_A           10 EKPYKCNECGKVFT   23 (46)
T ss_dssp             CCTTCCSSSCCCCS
T ss_pred             CcCeECCCCCcccC
Confidence            468999 9999885


No 115
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.52  E-value=6.9  Score=21.16  Aligned_cols=13  Identities=38%  Similarity=0.884  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2em6_A           10 EKCYKCDVCGKEFS   23 (46)
T ss_dssp             CCCCBCSSSCCBCS
T ss_pred             CCCeECCCCCcccC
Confidence            468999 9999885


No 116
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ...
Probab=42.17  E-value=4.4  Score=26.58  Aligned_cols=12  Identities=42%  Similarity=0.938  Sum_probs=9.8

Q ss_pred             ecCCceee-eCCC
Q psy2945         113 YEGKPKRC-MCGH  124 (134)
Q Consensus       113 ~~g~p~RC-eCG~  124 (134)
                      +.+.+.|| +||+
T Consensus        41 ~~~d~irCp~CG~   53 (70)
T 1twf_L           41 SRTDAVRCKDCGH   53 (70)
T ss_dssp             CTTSTTCCSSSCC
T ss_pred             CCCCCccCCCCCc
Confidence            36677899 9999


No 117
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=41.88  E-value=7.3  Score=20.95  Aligned_cols=13  Identities=54%  Similarity=1.168  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus         8 ~k~~~C~~C~k~f~   21 (45)
T 2epq_A            8 EKPYSCPVCGLRFK   21 (45)
T ss_dssp             CCSSEETTTTEECS
T ss_pred             CCCCcCCCCCcccC
Confidence            468999 9999885


No 118
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=41.25  E-value=13  Score=21.01  Aligned_cols=13  Identities=54%  Similarity=1.147  Sum_probs=10.2

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (54)
T 2eps_A           10 GKPYICQSCGKGFS   23 (54)
T ss_dssp             SCCEECSSSCCEES
T ss_pred             CCCeECCCCCcccC
Confidence            467889 8998884


No 119
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.20  E-value=6.4  Score=21.29  Aligned_cols=13  Identities=38%  Similarity=0.769  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eoh_A           10 KKPYECKECRKTFI   23 (46)
T ss_dssp             SCSCCCSSSCCCCS
T ss_pred             CCCcCCCCcCchhC
Confidence            368999 9999885


No 120
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=41.11  E-value=7  Score=20.95  Aligned_cols=13  Identities=23%  Similarity=0.473  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus         8 ~k~~~C~~C~k~f~   21 (43)
T 2yrm_A            8 NGAFFCNECDCRFS   21 (43)
T ss_dssp             SCCBCCSSSCCCBS
T ss_pred             CCCEECCCCCCeeC
Confidence            467999 9999885


No 121
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=40.81  E-value=6.2  Score=21.15  Aligned_cols=13  Identities=31%  Similarity=0.915  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (44)
T 2eou_A           10 KTTSECQECGKIFR   23 (44)
T ss_dssp             SCCCCCTTTCCCCS
T ss_pred             CcCeECCCCCcccC
Confidence            467899 9999885


No 122
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82
Probab=40.73  E-value=6.5  Score=27.94  Aligned_cols=11  Identities=55%  Similarity=1.343  Sum_probs=10.1

Q ss_pred             Cceee-eCCCEE
Q psy2945         116 KPKRC-MCGHWF  126 (134)
Q Consensus       116 ~p~RC-eCG~~F  126 (134)
                      .|.+| .||..|
T Consensus        66 ~p~~C~~CG~~F   77 (105)
T 2gmg_A           66 KPAQCRKCGFVF   77 (105)
T ss_dssp             CCCBBTTTCCBC
T ss_pred             ECcChhhCcCee
Confidence            67999 999999


No 123
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.62  E-value=6.2  Score=21.30  Aligned_cols=13  Identities=46%  Similarity=1.150  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eq1_A           10 EKPYKCNECGKAFR   23 (46)
T ss_dssp             SCCCCCTTTTCCCS
T ss_pred             CCCeECCcCChhhC
Confidence            468999 9999885


No 124
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=40.51  E-value=6.7  Score=21.29  Aligned_cols=13  Identities=38%  Similarity=1.058  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2eom_A           10 ERGHRCSDCGKFFL   23 (46)
T ss_dssp             CSSCCCSSSCCCCS
T ss_pred             CCCcCCCCCCCeeC
Confidence            468999 9999885


No 125
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A
Probab=40.47  E-value=13  Score=20.58  Aligned_cols=13  Identities=38%  Similarity=0.909  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        27 ~~~~~C~~C~~~f~   40 (57)
T 1bbo_A           27 VRPYHCTYCNFSFK   40 (57)
T ss_dssp             CCCEECSSSSCEES
T ss_pred             CCCccCCCCCchhc
Confidence            367999 9999985


No 126
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.14  E-value=7.2  Score=21.07  Aligned_cols=13  Identities=31%  Similarity=0.598  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2en9_A           10 KKLFKCNECKKTFT   23 (46)
T ss_dssp             SCCCBCTTTCCBCS
T ss_pred             CCCEECCccCcccC
Confidence            367999 9999885


No 127
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.01  E-value=6.4  Score=21.22  Aligned_cols=13  Identities=54%  Similarity=1.242  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eq2_A           10 GKPYQCNECGKAFS   23 (46)
T ss_dssp             SCSSSCCSSCCCCS
T ss_pred             CCCeECCCCCcccC
Confidence            468999 9999885


No 128
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1
Probab=39.92  E-value=13  Score=21.86  Aligned_cols=13  Identities=38%  Similarity=0.874  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        47 ~~~~~C~~C~~~f~   60 (73)
T 1f2i_G           47 QKPFQCRICMRNFS   60 (73)
T ss_dssp             CCCEECTTTCCEES
T ss_pred             CCCeECCCCCchhC
Confidence            468999 9999985


No 129
>2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A
Probab=39.87  E-value=8.7  Score=28.04  Aligned_cols=16  Identities=38%  Similarity=0.779  Sum_probs=11.2

Q ss_pred             EeecCCc--eee-eCCCEE
Q psy2945         111 WLYEGKP--KRC-MCGHWF  126 (134)
Q Consensus       111 ~l~~g~p--~RC-eCG~~F  126 (134)
                      -+.+|+.  +|| .||++|
T Consensus        39 ~l~~g~L~~~rC~~CG~~~   57 (145)
T 2gnr_A           39 GLKQNKIIGSKCSKCGRIF   57 (145)
T ss_dssp             HHHTTCCEEEECTTTCCEE
T ss_pred             hhhCCEEEEEEECCCCcEE
Confidence            3556664  888 788876


No 130
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.84  E-value=6.2  Score=20.92  Aligned_cols=13  Identities=46%  Similarity=0.961  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (44)
T 2en7_A           10 MKPYVCNECGKAFR   23 (44)
T ss_dssp             SSSSCCTTTCCCCS
T ss_pred             CcCeECCCCCCccC
Confidence            467999 9999885


No 131
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.58  E-value=7.3  Score=21.06  Aligned_cols=13  Identities=38%  Similarity=0.999  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2emz_A           10 ERPFKCNECGKGFG   23 (46)
T ss_dssp             CCSCCCSSSCCCCS
T ss_pred             CCCeECCCCCcccC
Confidence            367999 9999885


No 132
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.46  E-value=8.4  Score=20.64  Aligned_cols=13  Identities=46%  Similarity=1.109  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~F~   23 (46)
T 2eoe_A           10 EKPYKCNECGKVFT   23 (46)
T ss_dssp             CCSSEETTTTEECS
T ss_pred             CCCeECCCcChhhC
Confidence            468999 9999885


No 133
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=39.26  E-value=14  Score=21.66  Aligned_cols=12  Identities=25%  Similarity=0.772  Sum_probs=8.8

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| +||..|.
T Consensus        13 k~~~C~~C~k~F~   25 (62)
T 1vd4_A           13 ASFKCPVCSSTFT   25 (62)
T ss_dssp             SEEECSSSCCEEE
T ss_pred             CCccCCCCCchhc
Confidence            56778 7887775


No 134
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.69  E-value=7.9  Score=20.91  Aligned_cols=13  Identities=46%  Similarity=1.073  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2yth_A           10 EKPFQCEECGKRFT   23 (46)
T ss_dssp             SSSBCCSSSCCCBS
T ss_pred             CcCCCCCCCCcccC
Confidence            467999 9999885


No 135
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.34  E-value=8.5  Score=20.65  Aligned_cols=16  Identities=44%  Similarity=0.812  Sum_probs=12.1

Q ss_pred             eecC-Cceee-eCCCEEE
Q psy2945         112 LYEG-KPKRC-MCGHWFK  127 (134)
Q Consensus       112 l~~g-~p~RC-eCG~~Fk  127 (134)
                      .+.| +|..| .||..|.
T Consensus         6 ~H~~~k~~~C~~C~k~F~   23 (47)
T 2epx_A            6 SGTGKKPYECIECGKAFI   23 (47)
T ss_dssp             CCCCCCSBCCSSSCCCBS
T ss_pred             ccCCCCCEECCccCchhC
Confidence            3444 67999 9999885


No 136
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.25  E-value=8.1  Score=20.78  Aligned_cols=13  Identities=46%  Similarity=1.101  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2ytn_A           10 KKPYKCNECGKVFT   23 (46)
T ss_dssp             CSSCBCTTTCCBCS
T ss_pred             CcCeECCCCCCeeC
Confidence            468999 9999885


No 137
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.23  E-value=7.3  Score=20.91  Aligned_cols=13  Identities=38%  Similarity=0.777  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2eq4_A           10 EKLYNCKECGKSFS   23 (46)
T ss_dssp             CCCCCBTTTTBCCS
T ss_pred             CCCeECCCCCCccC
Confidence            468999 9999885


No 138
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.17  E-value=7.6  Score=20.82  Aligned_cols=13  Identities=46%  Similarity=0.950  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ep1_A           10 EKPYECSDCGKSFI   23 (46)
T ss_dssp             CCSSCCSSSCCCCS
T ss_pred             CCCcCCCCCCchhC
Confidence            468999 9999885


No 139
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.00  E-value=8.9  Score=20.52  Aligned_cols=13  Identities=46%  Similarity=1.065  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2eov_A           10 EKPYKCSDCGKSFT   23 (46)
T ss_dssp             CCSCBCSSSCCBCS
T ss_pred             CCCccCCccChhhC
Confidence            468999 9999885


No 140
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=37.88  E-value=15  Score=21.50  Aligned_cols=12  Identities=25%  Similarity=0.758  Sum_probs=7.8

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      ++..| .||..|.
T Consensus         8 ~~~~C~~C~k~f~   20 (70)
T 1x5w_A            8 HPEKCSECSYSCS   20 (70)
T ss_dssp             CSEECSSSSCEES
T ss_pred             CCeECCCCCcccC
Confidence            56677 6777664


No 141
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A
Probab=37.83  E-value=8.8  Score=20.70  Aligned_cols=13  Identities=46%  Similarity=1.025  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2emk_A           10 EKPYECKECGKAFS   23 (46)
T ss_dssp             SCSCBCSSSCCBCS
T ss_pred             CCceECCCCCchhC
Confidence            468999 9999885


No 142
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=37.76  E-value=9.1  Score=20.64  Aligned_cols=13  Identities=46%  Similarity=0.989  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytq_A           10 EKPYGCSECGKAFS   23 (46)
T ss_dssp             CCSCBCSSSCCBCS
T ss_pred             CCCcCCCccChhhC
Confidence            467999 9999885


No 143
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=37.04  E-value=9.2  Score=20.61  Aligned_cols=13  Identities=38%  Similarity=1.017  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2elz_A           10 EKPYKCEDCGKGYN   23 (46)
T ss_dssp             CSSCBCSSSCCBCS
T ss_pred             CCCeeCcccCchhC
Confidence            468999 9999885


No 144
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}
Probab=36.73  E-value=9.9  Score=24.57  Aligned_cols=17  Identities=29%  Similarity=0.642  Sum_probs=12.9

Q ss_pred             eecCCceee-eCCCEEEE
Q psy2945         112 LYEGKPKRC-MCGHWFKL  128 (134)
Q Consensus       112 l~~g~p~RC-eCG~~FkL  128 (134)
                      ++.+.+-|| +||+-...
T Consensus        33 l~~~~~iRC~~CG~RILy   50 (63)
T 3h0g_L           33 IQAKEVIRCRECGHRVMY   50 (63)
T ss_dssp             CCSSSCCCCSSSCCCCCB
T ss_pred             cCCCCceECCCCCcEEEE
Confidence            556889999 99985433


No 145
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A
Probab=36.61  E-value=9.4  Score=20.58  Aligned_cols=13  Identities=46%  Similarity=1.042  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ely_A           10 EKPFKCVECGKGFS   23 (46)
T ss_dssp             CCSBCCSSSCCCBS
T ss_pred             CCCcccCccCcccC
Confidence            368999 9999885


No 146
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=36.43  E-value=17  Score=21.50  Aligned_cols=13  Identities=46%  Similarity=0.989  Sum_probs=9.5

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        12 ~k~~~C~~C~k~f~   25 (72)
T 1x6e_A           12 EKPYGCVECGKAFS   25 (72)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCccCCCCCCccC
Confidence            357888 7888874


No 147
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=36.13  E-value=7.5  Score=20.84  Aligned_cols=13  Identities=46%  Similarity=1.083  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytr_A           10 EKPYKCNECGKAFS   23 (46)
T ss_dssp             CCTTCCTTTCCCCS
T ss_pred             CcCcCCCCCCCccC
Confidence            467999 9999885


No 148
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}
Probab=36.09  E-value=8.9  Score=20.61  Aligned_cols=13  Identities=31%  Similarity=0.708  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~F~   23 (46)
T 2em0_A           10 EKTWKCRECDMCFS   23 (46)
T ss_dssp             CCCCCCSSSCCCCS
T ss_pred             CcCeECCCCCcccC
Confidence            468999 9999885


No 149
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.76  E-value=9.6  Score=20.38  Aligned_cols=13  Identities=46%  Similarity=1.101  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2eop_A           10 EKPHECRECGKSFS   23 (46)
T ss_dssp             CCSCBCTTTCCBCS
T ss_pred             CCCeeCCCCCchhC
Confidence            468999 8999885


No 150
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.74  E-value=9.3  Score=20.52  Aligned_cols=13  Identities=46%  Similarity=0.950  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2epz_A           10 EKPFDCIDCGKAFS   23 (46)
T ss_dssp             CCSBCCTTTCCCBS
T ss_pred             CCCeECCCCCceeC
Confidence            368999 9999885


No 151
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.50  E-value=8.3  Score=20.81  Aligned_cols=13  Identities=46%  Similarity=1.060  Sum_probs=10.6

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytt_A           10 EKPYQCSECGKSFS   23 (46)
T ss_dssp             CCTTCCSSSCCCCS
T ss_pred             CCCeeCCCCCcccC
Confidence            467999 9999885


No 152
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1
Probab=35.31  E-value=17  Score=20.43  Aligned_cols=13  Identities=38%  Similarity=0.956  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        28 ~~~~~C~~C~~~f~   41 (60)
T 2adr_A           28 EKPYPCGLCNRAFT   41 (60)
T ss_dssp             SCSEECTTTCCEES
T ss_pred             CCCccCCCCCCccC
Confidence            367999 8999885


No 153
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4
Probab=35.24  E-value=4  Score=29.60  Aligned_cols=14  Identities=36%  Similarity=0.954  Sum_probs=11.5

Q ss_pred             cCCceee-eCCCEEE
Q psy2945         114 EGKPKRC-MCGHWFK  127 (134)
Q Consensus       114 ~g~p~RC-eCG~~Fk  127 (134)
                      -.+|.+| .||.+|.
T Consensus        47 GekpfyC~~C~K~F~   61 (124)
T 1zr9_A           47 GGGLHRCLACARYFI   61 (124)
T ss_dssp             GGGCSEETTTTEECS
T ss_pred             CCcceEcccCcchhC
Confidence            3468999 9999995


No 154
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=35.03  E-value=17  Score=21.68  Aligned_cols=13  Identities=38%  Similarity=0.951  Sum_probs=9.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        13 ~k~~~C~~C~k~f~   26 (77)
T 2ct1_A           13 EKPYECYICHARFT   26 (77)
T ss_dssp             CCSEECTTTCCEES
T ss_pred             CCCeECCCcCchhC
Confidence            357888 7888875


No 155
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.73  E-value=8.3  Score=20.88  Aligned_cols=13  Identities=46%  Similarity=1.053  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~k~~~C~~C~k~f~   23 (46)
T 2ytm_A           10 EKPYKCMECGKAFG   23 (46)
T ss_dssp             CCSSSBTTTTBCCS
T ss_pred             CCCcCCCCCCchhC
Confidence            368999 9999885


No 156
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1
Probab=34.09  E-value=49  Score=19.90  Aligned_cols=25  Identities=24%  Similarity=0.708  Sum_probs=18.5

Q ss_pred             CCcceEEEee---cCCc----eee-eCCCEEEE
Q psy2945         104 SPSINWMWLY---EGKP----KRC-MCGHWFKL  128 (134)
Q Consensus       104 sh~v~W~~l~---~g~p----~RC-eCG~~FkL  128 (134)
                      .+...|+.+.   .++|    ..| .||+.|+-
T Consensus        23 ~~~~~~~q~Q~rsadep~T~fy~C~~Cg~~w~~   55 (57)
T 1qyp_A           23 NDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRS   55 (57)
T ss_dssp             CSEEEEEEECCSSSSCSSEEEEEESSSCCEEEC
T ss_pred             CCEEEEEEeecccCCCCCcEEEEcCCCCCEecc
Confidence            3778888876   3455    689 89998863


No 157
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.83  E-value=9.9  Score=20.41  Aligned_cols=13  Identities=46%  Similarity=1.101  Sum_probs=10.6

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        10 ~~~~~C~~C~k~f~   23 (46)
T 2eoq_A           10 EKPFKCDICGKSFC   23 (46)
T ss_dssp             SCSCCCSSSCCCCS
T ss_pred             CCCcCCCcCCchhC
Confidence            368999 9999885


No 158
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=33.43  E-value=19  Score=21.29  Aligned_cols=13  Identities=54%  Similarity=1.255  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        43 ~~~~~C~~C~k~f~   56 (74)
T 2lce_A           43 EKPYRCNICGAQFN   56 (74)
T ss_dssp             CCSEECTTTCCEES
T ss_pred             CCCEECCCCCchhC
Confidence            367999 8999985


No 159
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori}
Probab=33.05  E-value=15  Score=25.42  Aligned_cols=7  Identities=29%  Similarity=0.691  Sum_probs=3.9

Q ss_pred             ee-eCCCE
Q psy2945         119 RC-MCGHW  125 (134)
Q Consensus       119 RC-eCG~~  125 (134)
                      .| .||+.
T Consensus        92 ~CP~Cgs~   99 (119)
T 2kdx_A           92 VCEKCHSK   99 (119)
T ss_dssp             CCSSSSSC
T ss_pred             cCccccCC
Confidence            56 56554


No 160
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=32.21  E-value=22  Score=19.66  Aligned_cols=13  Identities=23%  Similarity=0.437  Sum_probs=10.6

Q ss_pred             CCceee-e--CCCEEE
Q psy2945         115 GKPKRC-M--CGHWFK  127 (134)
Q Consensus       115 g~p~RC-e--CG~~Fk  127 (134)
                      .+|..| +  ||..|.
T Consensus         7 ekp~~C~~~~C~k~F~   22 (38)
T 2eln_A            7 GILLKCPTDGCDYSTP   22 (38)
T ss_dssp             CCCEECSSSSCCCEES
T ss_pred             CCCCCCCCCCCCCccC
Confidence            368999 5  999985


No 161
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.97  E-value=22  Score=20.42  Aligned_cols=17  Identities=29%  Similarity=0.757  Sum_probs=12.8

Q ss_pred             eecC-Cceee-eCCCEEEE
Q psy2945         112 LYEG-KPKRC-MCGHWFKL  128 (134)
Q Consensus       112 l~~g-~p~RC-eCG~~FkL  128 (134)
                      .+.| +|..| .||..|.-
T Consensus        12 ~h~~~~~~~C~~C~k~f~~   30 (73)
T 2ctu_A           12 IHLGDRSQKCSKCGIIFIR   30 (73)
T ss_dssp             CCCCCSEEECSSSCCEEEC
T ss_pred             HhCCCCCeeCCcccchhCC
Confidence            4444 67999 99999974


No 162
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.90  E-value=3.5  Score=26.54  Aligned_cols=12  Identities=17%  Similarity=0.409  Sum_probs=7.1

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      ++..| .||..|.
T Consensus        23 ~~~~C~~C~k~f~   35 (98)
T 2gqj_A           23 GEAVCPTCNVVTR   35 (98)
T ss_dssp             SCCCCTTTCCCCS
T ss_pred             CCcCCCCCCCChh
Confidence            45666 6666654


No 163
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.73  E-value=21  Score=21.29  Aligned_cols=13  Identities=31%  Similarity=0.813  Sum_probs=10.7

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        36 ~~~~~C~~C~k~f~   49 (78)
T 2d9h_A           36 ALRFPCEFCGKRFE   49 (78)
T ss_dssp             TCCEECTTTCCEES
T ss_pred             CcccCCCCCCchhC
Confidence            468899 8999885


No 164
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=31.71  E-value=18  Score=23.45  Aligned_cols=13  Identities=23%  Similarity=0.457  Sum_probs=11.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| +||..|.
T Consensus        54 ~k~~~C~~C~k~F~   67 (85)
T 2lv2_A           54 AQVFPCKYCPATFY   67 (85)
T ss_dssp             SSSEECTTSSCEES
T ss_pred             CCccCCCCCCCEeC
Confidence            478999 9999985


No 165
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens}
Probab=30.75  E-value=16  Score=18.69  Aligned_cols=13  Identities=31%  Similarity=0.779  Sum_probs=10.5

Q ss_pred             CCceeee---CCCEEE
Q psy2945         115 GKPKRCM---CGHWFK  127 (134)
Q Consensus       115 g~p~RCe---CG~~Fk  127 (134)
                      .+|..|.   ||..|.
T Consensus         6 ~k~~~C~~~~C~k~f~   21 (37)
T 1va1_A            6 KKQHICHIQGCGKVYG   21 (37)
T ss_dssp             CCCEECCSTTCCCEES
T ss_pred             CCCCCCCCCCCCCccC
Confidence            4689994   999985


No 166
>3q87_A Putative uncharacterized protein ECU08_1170; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}
Probab=28.56  E-value=26  Score=25.35  Aligned_cols=19  Identities=37%  Similarity=0.819  Sum_probs=14.5

Q ss_pred             EEeecCCceee-eCCCEEEEE
Q psy2945         110 MWLYEGKPKRC-MCGHWFKLV  129 (134)
Q Consensus       110 ~~l~~g~p~RC-eCG~~FkL~  129 (134)
                      ..+.+|+ =.| +||++|-++
T Consensus        93 ~~V~EG~-L~Cp~cgr~ypI~  112 (125)
T 3q87_A           93 IDVVEGS-LRCDMCGLIYPIK  112 (125)
T ss_dssp             EEEEEEE-EEETTTCCEEEEE
T ss_pred             eEEEEEE-EECCCCCCEeecc
Confidence            4556777 469 999999875


No 167
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=28.18  E-value=31  Score=17.33  Aligned_cols=13  Identities=46%  Similarity=1.053  Sum_probs=10.4

Q ss_pred             CCceeee---CCCEEE
Q psy2945         115 GKPKRCM---CGHWFK  127 (134)
Q Consensus       115 g~p~RCe---CG~~Fk  127 (134)
                      .+|..|.   ||..|.
T Consensus         4 ~k~~~C~~~~C~k~f~   19 (38)
T 1bhi_A            4 DKPFLCTAPGCGQRFT   19 (38)
T ss_dssp             CCCEECCCTTTCCEES
T ss_pred             CcceECCCCCCCcccC
Confidence            4678995   999985


No 168
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A*
Probab=27.58  E-value=27  Score=25.08  Aligned_cols=11  Identities=36%  Similarity=0.755  Sum_probs=6.2

Q ss_pred             eee-eCCCEEEE
Q psy2945         118 KRC-MCGHWFKL  128 (134)
Q Consensus       118 ~RC-eCG~~FkL  128 (134)
                      -+| .||+.|.+
T Consensus        71 ~~C~~CG~~~~~   82 (139)
T 3a43_A           71 FKCRNCNYEWKL   82 (139)
T ss_dssp             EEETTTCCEEEG
T ss_pred             EECCCCCCEEec
Confidence            555 56655554


No 169
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A
Probab=27.23  E-value=46  Score=18.53  Aligned_cols=19  Identities=32%  Similarity=0.814  Sum_probs=14.2

Q ss_pred             cCCceee-eCCCEEEEEEeC
Q psy2945         114 EGKPKRC-MCGHWFKLVYKA  132 (134)
Q Consensus       114 ~g~p~RC-eCG~~FkL~~~~  132 (134)
                      +.+-.+| .||+...++..+
T Consensus         3 ~~~fY~C~~CGnivev~~~g   22 (36)
T 1dxg_A            3 EGDVYKCELCGQVVKVLEEG   22 (36)
T ss_dssp             TTCEEECTTTCCEEEEEECC
T ss_pred             cccEEEcCCCCcEEEEEeCC
Confidence            4566899 899988876544


No 170
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=26.99  E-value=29  Score=20.64  Aligned_cols=13  Identities=38%  Similarity=0.920  Sum_probs=9.0

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .|+..|.
T Consensus        13 ~k~~~C~~C~~~f~   26 (86)
T 1x6h_A           13 EKPYACSHCDKTFR   26 (86)
T ss_dssp             CCCEECSSSSCEES
T ss_pred             CCCCcCCCCCCccC
Confidence            356777 7877774


No 171
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}
Probab=26.33  E-value=29  Score=20.38  Aligned_cols=13  Identities=46%  Similarity=1.244  Sum_probs=10.5

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        55 ~~~~~C~~C~~~f~   68 (82)
T 2kmk_A           55 EKPHKCQVCGKAFS   68 (82)
T ss_dssp             CCCEECTTTSCEES
T ss_pred             CCCCcCCCcchhhC
Confidence            467899 8999885


No 172
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii}
Probab=25.84  E-value=26  Score=25.20  Aligned_cols=12  Identities=33%  Similarity=0.667  Sum_probs=10.1

Q ss_pred             ceee-eCCCEEEE
Q psy2945         117 PKRC-MCGHWFKL  128 (134)
Q Consensus       117 p~RC-eCG~~FkL  128 (134)
                      -.|| .||+.|+.
T Consensus       132 ~y~C~~Cg~~~~~  144 (165)
T 2lcq_A          132 RYVCIGCGRKFST  144 (165)
T ss_dssp             CEEESSSCCEESS
T ss_pred             EEECCCCCCcccC
Confidence            3899 89999974


No 173
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=25.65  E-value=31  Score=20.03  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=9.8

Q ss_pred             Cceee-eCCCEEE
Q psy2945         116 KPKRC-MCGHWFK  127 (134)
Q Consensus       116 ~p~RC-eCG~~Fk  127 (134)
                      +|..| .||..|.
T Consensus         9 ~~~~C~~C~k~f~   21 (66)
T 2eod_A            9 RTQPCTYCTKEFV   21 (66)
T ss_dssp             CEEECSSSCCEEE
T ss_pred             CCeeccccCCccC
Confidence            57889 8998886


No 174
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=25.54  E-value=32  Score=20.38  Aligned_cols=13  Identities=46%  Similarity=1.027  Sum_probs=10.6

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        44 ~~~~~C~~C~~~f~   57 (77)
T 2cot_A           44 EKPYKCDECGKAFI   57 (77)
T ss_dssp             SCSEECSSSCCEES
T ss_pred             CcCeeCCCCCCccC
Confidence            467999 8999885


No 175
>3zy0_A Tumor protein P63; transcription, transcription factor, tetramerization domain, cycle control; HET: MSE; 1.90A {Homo sapiens}
Probab=25.10  E-value=38  Score=19.15  Aligned_cols=14  Identities=29%  Similarity=0.408  Sum_probs=12.5

Q ss_pred             ccccHHHHHHHHHH
Q psy2945          49 LATGLEKRELLAEL   62 (134)
Q Consensus        49 qATGlEr~ELla~~   62 (134)
                      |.-|.|++|++-++
T Consensus         9 ~VrGRe~ye~l~ki   22 (32)
T 3zy0_A            9 PVRGRETYEMLLKI   22 (32)
T ss_dssp             EESSHHHHHHHHHH
T ss_pred             EEechhhHHHHHHH
Confidence            77899999999886


No 176
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1
Probab=25.01  E-value=33  Score=20.62  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=8.7

Q ss_pred             ceee-eCCCEEE
Q psy2945         117 PKRC-MCGHWFK  127 (134)
Q Consensus       117 p~RC-eCG~~Fk  127 (134)
                      ..+| .||++|.
T Consensus         4 ~y~C~vCGyvyd   15 (46)
T 6rxn_A            4 KYVCNVCGYEYD   15 (46)
T ss_dssp             CEEETTTCCEEC
T ss_pred             EEECCCCCeEEe
Confidence            4689 8998884


No 177
>2y69_J Cytochrome C oxidase polypeptide 7A1; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus}
Probab=24.94  E-value=19  Score=24.24  Aligned_cols=15  Identities=33%  Similarity=0.224  Sum_probs=0.4

Q ss_pred             cccCcceeeeeeecc
Q psy2945          22 TATGNSFSTCAQRWN   36 (134)
Q Consensus        22 ~~~~R~fsts~~~~~   36 (134)
                      .++.|+||||+.|.-
T Consensus         8 ~~~~r~~st~~~r~~   22 (80)
T 2y69_J            8 QALVRSFSSTARNRF   22 (80)
T ss_dssp             --------------C
T ss_pred             HHHHHHhcccchhhh
Confidence            456799999998744


No 178
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=24.92  E-value=30  Score=23.11  Aligned_cols=11  Identities=18%  Similarity=0.374  Sum_probs=6.0

Q ss_pred             Cceee-eCCCEE
Q psy2945         116 KPKRC-MCGHWF  126 (134)
Q Consensus       116 ~p~RC-eCG~~F  126 (134)
                      +|..| +||..|
T Consensus        17 kpy~C~~Cgk~F   28 (102)
T 2ghf_A           17 GGYECKYCTFQT   28 (102)
T ss_dssp             SSEECSSCSCEE
T ss_pred             cCcCCCCCCCcc
Confidence            34555 555555


No 179
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A
Probab=24.84  E-value=34  Score=20.49  Aligned_cols=13  Identities=31%  Similarity=0.843  Sum_probs=10.8

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        63 ~~~~~C~~C~~~f~   76 (89)
T 2wbs_A           63 HRPFQCQKCDRAFS   76 (89)
T ss_dssp             CCCEECSSSSCEES
T ss_pred             CCCccCCCCCcccC
Confidence            357999 9999985


No 180
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=24.60  E-value=80  Score=18.92  Aligned_cols=25  Identities=20%  Similarity=0.559  Sum_probs=16.7

Q ss_pred             CCcceEEEee---cCCc----eee-eCCCEEEE
Q psy2945         104 SPSINWMWLY---EGKP----KRC-MCGHWFKL  128 (134)
Q Consensus       104 sh~v~W~~l~---~g~p----~RC-eCG~~FkL  128 (134)
                      .....||.+.   .++|    ..| .||+-|+.
T Consensus        17 ~~~a~f~q~Q~RsaDE~mT~Fy~C~~Cg~~w~~   49 (50)
T 1tfi_A           17 KKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF   49 (50)
T ss_dssp             SSCEEEEEECSSSSSSCCEEEEEESSSCCEEEC
T ss_pred             CCEEEEEEecCcCCCCCceEEEEcCCCCCeEEe
Confidence            4556666665   2444    789 99998864


No 181
>1aie_A P53; oligomer, DNA; 1.50A {Homo sapiens} SCOP: a.53.1.1 PDB: 2j0z_A 1c26_A 1pes_A 1pet_A 2j10_A 1hs5_A 2j11_A
Probab=24.48  E-value=41  Score=18.91  Aligned_cols=15  Identities=33%  Similarity=0.445  Sum_probs=12.4

Q ss_pred             ccccHHHHHHHHHHc
Q psy2945          49 LATGLEKRELLAELA   63 (134)
Q Consensus        49 qATGlEr~ELla~~~   63 (134)
                      |.-|.||+||+-++.
T Consensus         6 ~VrGRe~yEml~ki~   20 (31)
T 1aie_A            6 QIRGRERFEMFRELN   20 (31)
T ss_dssp             CCCSHHHHHHHHHHH
T ss_pred             EeccHHHHHHHHHHH
Confidence            566999999998873


No 182
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A
Probab=24.21  E-value=18  Score=17.42  Aligned_cols=12  Identities=42%  Similarity=1.132  Sum_probs=8.6

Q ss_pred             Cceee---eCCCEEE
Q psy2945         116 KPKRC---MCGHWFK  127 (134)
Q Consensus       116 ~p~RC---eCG~~Fk  127 (134)
                      +|..|   +||..|.
T Consensus         1 kp~~C~~~~C~k~f~   15 (31)
T 1sp2_A            1 RPFMCTWSYCGKRFT   15 (31)
T ss_dssp             CCCBCCSTTCCCBCS
T ss_pred             CCcCCcCCCCCcccC
Confidence            36678   5998874


No 183
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=23.20  E-value=25  Score=22.72  Aligned_cols=20  Identities=15%  Similarity=0.328  Sum_probs=13.7

Q ss_pred             ceEEEee-cCCceee-eCCCEE
Q psy2945         107 INWMWLY-EGKPKRC-MCGHWF  126 (134)
Q Consensus       107 v~W~~l~-~g~p~RC-eCG~~F  126 (134)
                      ..|...+ ..++..| .||..|
T Consensus        23 ~~~~~~~~~~~~~~C~~C~k~F   44 (96)
T 2ctd_A           23 EQWYLEIVDKGSVSCPTCQAVG   44 (96)
T ss_dssp             HHHHHHHHHTSCEECTTTCSCE
T ss_pred             HHHHHHhcCCCCcCCCCCCCCc
Confidence            3444444 3567999 899998


No 184
>2nwa_A Hypothetical protein YTMB; mostly beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Bacillus subtilis} SCOP: b.122.1.13
Probab=23.09  E-value=39  Score=23.22  Aligned_cols=26  Identities=23%  Similarity=0.239  Sum_probs=22.3

Q ss_pred             cceEEEeecCCceeeeCCCEEEEEEeC
Q psy2945         106 SINWMWLYEGKPKRCMCGHWFKLVYKA  132 (134)
Q Consensus       106 ~v~W~~l~~g~p~RCeCG~~FkL~~~~  132 (134)
                      .++|+-+.+|+..|-+ ++.|.|...|
T Consensus         6 E~Nt~Ivt~gke~rie-~n~f~l~KeG   31 (88)
T 2nwa_A            6 EFNTLIVTKGKEVRID-ENIFTLEKDG   31 (88)
T ss_dssp             EECSSEECCSCCEESS-SSEEEEEEES
T ss_pred             EEEEEEEeCCcceeee-ccEEEEEeCc
Confidence            4688889999999987 9999998766


No 185
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C
Probab=22.96  E-value=37  Score=20.32  Aligned_cols=13  Identities=46%  Similarity=1.073  Sum_probs=10.4

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        60 ~~~~~C~~C~~~f~   73 (90)
T 1a1h_A           60 EKPFACDICGRKFA   73 (90)
T ss_dssp             CCCEECTTTCCEES
T ss_pred             CCCccCCCCCchhC
Confidence            357899 8999885


No 186
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=22.66  E-value=38  Score=20.61  Aligned_cols=13  Identities=23%  Similarity=0.690  Sum_probs=10.6

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        62 ~~~~~C~~C~~~f~   75 (96)
T 2dmd_A           62 ERPFKCQICPYASR   75 (96)
T ss_dssp             CCCEECSSSSCEES
T ss_pred             CCCccCCCCCCccC
Confidence            457999 8999885


No 187
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ...
Probab=22.54  E-value=36  Score=20.76  Aligned_cols=10  Identities=30%  Similarity=1.045  Sum_probs=7.9

Q ss_pred             eee-eCCCEEE
Q psy2945         118 KRC-MCGHWFK  127 (134)
Q Consensus       118 ~RC-eCG~~Fk  127 (134)
                      .+| .||++|.
T Consensus         3 ~~C~~CGyvYd   13 (52)
T 1yk4_A            3 LSCKICGYIYD   13 (52)
T ss_dssp             EEESSSSCEEE
T ss_pred             EEeCCCCeEEC
Confidence            578 8998875


No 188
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A
Probab=22.47  E-value=38  Score=20.59  Aligned_cols=13  Identities=46%  Similarity=1.073  Sum_probs=10.5

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        29 ~~~~~C~~C~k~f~   42 (88)
T 1llm_C           29 EKPFACDICGRKFA   42 (88)
T ss_dssp             CCCEECTTTCCEES
T ss_pred             CCCccCCCCCCccC
Confidence            357899 8999885


No 189
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=22.43  E-value=39  Score=21.74  Aligned_cols=13  Identities=15%  Similarity=0.555  Sum_probs=10.9

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .+|..| .||..|.
T Consensus        23 ~kpy~C~~C~k~F~   36 (88)
T 1x6f_A           23 NSTYQCKHCDSKLQ   36 (88)
T ss_dssp             CSCEECSSSCCEES
T ss_pred             CCCCcCCCCCCEeC
Confidence            468999 9999985


No 190
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ...
Probab=22.34  E-value=39  Score=20.95  Aligned_cols=11  Identities=27%  Similarity=0.905  Sum_probs=8.5

Q ss_pred             ceee-eCCCEEE
Q psy2945         117 PKRC-MCGHWFK  127 (134)
Q Consensus       117 p~RC-eCG~~Fk  127 (134)
                      ..+| .||.+|.
T Consensus         3 ~y~C~vCGyvYd   14 (54)
T 4rxn_A            3 KYTCTVCGYIYD   14 (54)
T ss_dssp             CEEETTTCCEEC
T ss_pred             ceECCCCCeEEC
Confidence            3689 8998884


No 191
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens}
Probab=21.17  E-value=47  Score=19.28  Aligned_cols=17  Identities=18%  Similarity=0.513  Sum_probs=11.8

Q ss_pred             eecCCceee-eCCCEEEE
Q psy2945         112 LYEGKPKRC-MCGHWFKL  128 (134)
Q Consensus       112 l~~g~p~RC-eCG~~FkL  128 (134)
                      +..+....| .||..|..
T Consensus         4 ~~~~~~~~C~~C~~~i~~   21 (39)
T 2i5o_A            4 MAAEDQVPCEKCGSLVPV   21 (39)
T ss_dssp             --CCCEEECTTTCCEEEG
T ss_pred             CCcCCCcccccccCcCCc
Confidence            344567899 89998864


No 192
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=20.98  E-value=44  Score=21.03  Aligned_cols=13  Identities=38%  Similarity=0.902  Sum_probs=10.5

Q ss_pred             CCceee-eCCCEEE
Q psy2945         115 GKPKRC-MCGHWFK  127 (134)
Q Consensus       115 g~p~RC-eCG~~Fk  127 (134)
                      .++..| .||..|.
T Consensus        63 ~~~~~C~~C~~~f~   76 (110)
T 2csh_A           63 IKPYECNICAKRFM   76 (110)
T ss_dssp             CCCEECSSSCCEES
T ss_pred             CCCeeCCCCcchhc
Confidence            357899 8999885


No 193
>2k44_A Hsapbk, K+-channel voltage-sensor paddle domain of calcium-activated potassium channel subunit...; membrane, micelle, solution structure; NMR {Synthetic}
Probab=20.20  E-value=18  Score=19.97  Aligned_cols=8  Identities=50%  Similarity=0.791  Sum_probs=5.9

Q ss_pred             hhhhhccC
Q psy2945           4 FFRSLVLS   11 (134)
Q Consensus         4 ~~r~l~~~   11 (134)
                      |+|+|++.
T Consensus        17 FLRALRlm   24 (28)
T 2k44_A           17 FLRALRLI   24 (28)
T ss_dssp             TCTTHHHH
T ss_pred             HHHHHHcc
Confidence            78888753


No 194
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=20.12  E-value=48  Score=17.89  Aligned_cols=13  Identities=38%  Similarity=0.672  Sum_probs=10.6

Q ss_pred             CCceee---eCCCEEE
Q psy2945         115 GKPKRC---MCGHWFK  127 (134)
Q Consensus       115 g~p~RC---eCG~~Fk  127 (134)
                      .+|..|   +||..|.
T Consensus        16 ~k~~~C~~~~C~k~F~   31 (47)
T 1ncs_A           16 DKTFECLFPGCTKTFK   31 (47)
T ss_dssp             TTEEECCCTTCCCEEC
T ss_pred             CCCeECCCCCCCCccC
Confidence            468999   4999986


Done!