BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2971
         (134 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I12|A Chain A, The Crystal Structure Of The D-alanyl-alanine Synthetase A
           From Salmonella Enterica Subsp. Enterica Serovar
           Typhimurium Str. Lt2
 pdb|3I12|B Chain B, The Crystal Structure Of The D-alanyl-alanine Synthetase A
           From Salmonella Enterica Subsp. Enterica Serovar
           Typhimurium Str. Lt2
 pdb|3I12|C Chain C, The Crystal Structure Of The D-alanyl-alanine Synthetase A
           From Salmonella Enterica Subsp. Enterica Serovar
           Typhimurium Str. Lt2
 pdb|3I12|D Chain D, The Crystal Structure Of The D-alanyl-alanine Synthetase A
           From Salmonella Enterica Subsp. Enterica Serovar
           Typhimurium Str. Lt2
          Length = 364

 Score = 26.2 bits (56), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 45  LANGSNANPIET-DLDFDDILPHLGEFGRYQKILFFAMIPFAFS 87
           L N  N  P+ T D+ F  +   LGE G  Q +L  A +PF  S
Sbjct: 87  LINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVANLPFVGS 130


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.144    0.447 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,327,788
Number of Sequences: 62578
Number of extensions: 184397
Number of successful extensions: 368
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 368
Number of HSP's gapped (non-prelim): 1
length of query: 134
length of database: 14,973,337
effective HSP length: 88
effective length of query: 46
effective length of database: 9,466,473
effective search space: 435457758
effective search space used: 435457758
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)