BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2971
(134 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3I12|A Chain A, The Crystal Structure Of The D-alanyl-alanine Synthetase A
From Salmonella Enterica Subsp. Enterica Serovar
Typhimurium Str. Lt2
pdb|3I12|B Chain B, The Crystal Structure Of The D-alanyl-alanine Synthetase A
From Salmonella Enterica Subsp. Enterica Serovar
Typhimurium Str. Lt2
pdb|3I12|C Chain C, The Crystal Structure Of The D-alanyl-alanine Synthetase A
From Salmonella Enterica Subsp. Enterica Serovar
Typhimurium Str. Lt2
pdb|3I12|D Chain D, The Crystal Structure Of The D-alanyl-alanine Synthetase A
From Salmonella Enterica Subsp. Enterica Serovar
Typhimurium Str. Lt2
Length = 364
Score = 26.2 bits (56), Expect = 5.8, Method: Compositional matrix adjust.
Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
Query: 45 LANGSNANPIET-DLDFDDILPHLGEFGRYQKILFFAMIPFAFS 87
L N N P+ T D+ F + LGE G Q +L A +PF S
Sbjct: 87 LINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGMLRVANLPFVGS 130
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.144 0.447
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,327,788
Number of Sequences: 62578
Number of extensions: 184397
Number of successful extensions: 368
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 368
Number of HSP's gapped (non-prelim): 1
length of query: 134
length of database: 14,973,337
effective HSP length: 88
effective length of query: 46
effective length of database: 9,466,473
effective search space: 435457758
effective search space used: 435457758
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)