Diaphorina citri psyllid: psy2972

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MKDLDQLLTETKEAIKNIRTQNTLSHLPQDVTVEEIKSEMELLHGQSIMCCIQADNKKFDIVISPKNTRVSDLKRTIERQITMQMKRKGLSKQISWRHVWKSYWLSFDGIKLTNEKSLLSELGIESQCEITFVKRLKDKVRIK
ccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccEEEEEEEccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHccccEEEccccccEEEcEEccccccccHHHHHHHccccccEEEEEEEEHHHHccc
****DQL*TETKEAIKNIRTQNTLSHLPQDVTVEEIKSEMELLHGQSIMCCIQADNKKFDIVISPKNTRVSDLKRTIERQITMQ*********ISWRHVWKSYWLSFDGIKLTNEKSLLSELGIESQCEITFVKRLKDK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxNTLSHLPQDVTVEEIKSEMELLHGQSIMCCIQADNKKFDIVISPKNTRVSDLKRTIERQITMQMKRKGLSKQISWRHVWKSYWLSFDGIKLTNEKSLLSELGIESQCEITFVKRLKDKVRIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U11/U12 small nuclear ribonucleoprotein 25 kDa protein confidentQ8VIK1
U11/U12 small nuclear ribonucleoprotein 25 kDa protein confidentQ9BV90
U11/U12 small nuclear ribonucleoprotein 25 kDa protein confidentQ3ZBQ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005689 [CC]U12-type spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V2Y, chain A
Confidence level:very confident
Coverage over the Query: 44-142
View the alignment between query and template
View the model in PyMOL
Template: 3RT3, chain B
Confidence level:confident
Coverage over the Query: 8-137
View the alignment between query and template
View the model in PyMOL