Query         psy2976
Match_columns 184
No_of_seqs    146 out of 1128
Neff          6.8 
Searched_HMMs 46136
Date          Fri Aug 16 22:22:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2976.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2976hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04281 ZnMc_BMP1_TLD Zinc-dep 100.0   3E-45 6.5E-50  298.0  12.7  121   62-184     2-122 (200)
  2 cd04282 ZnMc_meprin Zinc-depen 100.0 1.1E-44 2.4E-49  299.7  13.3  134   35-184    22-155 (230)
  3 PF01400 Astacin:  Astacin (Pep 100.0 1.9E-41 4.1E-46  273.9  10.2  114   68-184     1-114 (191)
  4 cd04283 ZnMc_hatching_enzyme Z 100.0 1.9E-40   4E-45  266.2  11.5  107   74-184     5-112 (182)
  5 KOG3714|consensus              100.0 1.2E-40 2.5E-45  296.6  11.2  127   56-184    68-194 (411)
  6 cd04280 ZnMc_astacin_like Zinc 100.0 6.1E-40 1.3E-44  262.9  11.4  109   72-184     1-109 (180)
  7 smart00235 ZnMc Zinc-dependent 100.0 1.3E-32 2.9E-37  210.7  12.2  115   67-183     2-120 (140)
  8 cd04327 ZnMc_MMP_like_3 Zinc-d 100.0 2.6E-31 5.6E-36  215.5  11.7  110   68-182     1-121 (198)
  9 cd04268 ZnMc_MMP_like Zinc-dep  99.9   7E-25 1.5E-29  171.3   8.4  103   73-176     2-121 (165)
 10 cd04278 ZnMc_MMP Zinc-dependen  99.8 6.9E-19 1.5E-23  137.4  10.2  103   69-171     1-129 (157)
 11 cd00203 ZnMc Zinc-dependent me  99.7   9E-17   2E-21  125.3   9.9  106   74-179     2-126 (167)
 12 cd04279 ZnMc_MMP_like_1 Zinc-d  99.6 5.4E-15 1.2E-19  115.2  10.3   97   74-170     3-125 (156)
 13 PF00413 Peptidase_M10:  Matrix  99.6 3.4E-14 7.5E-19  109.4  11.5  102   69-170     1-126 (154)
 14 cd04277 ZnMc_serralysin_like Z  99.6 3.1E-14 6.8E-19  113.9  10.8   93   82-175    30-139 (186)
 15 KOG1565|consensus               98.9 2.9E-09 6.2E-14   96.8   7.5  102   67-168   103-230 (469)
 16 PF12388 Peptidase_M57:  Dual-a  98.8 3.8E-08 8.3E-13   80.7   9.7  127   39-167     5-151 (211)
 17 cd04276 ZnMc_MMP_like_2 Zinc-d  98.6 6.5E-07 1.4E-11   73.0  10.6   99   71-170     6-137 (197)
 18 PF02031 Peptidase_M7:  Strepto  98.3 1.1E-06 2.3E-11   66.7   4.7   86   74-165     3-93  (132)
 19 COG5549 Predicted Zn-dependent  97.3 0.00038 8.3E-09   57.1   4.9   82   86-170   104-209 (236)
 20 PF13583 Reprolysin_4:  Metallo  96.7  0.0008 1.7E-08   55.0   2.0   20  149-168   137-156 (206)
 21 PF13582 Reprolysin_3:  Metallo  96.7 0.00073 1.6E-08   50.0   1.6   18  149-166   107-124 (124)
 22 cd04267 ZnMc_ADAM_like Zinc-de  96.6  0.0016 3.5E-08   52.0   2.6   21  149-169   133-153 (192)
 23 PF05572 Peptidase_M43:  Pregna  96.5  0.0016 3.5E-08   51.0   2.0   21  150-170    70-90  (154)
 24 PF13688 Reprolysin_5:  Metallo  96.2  0.0028   6E-08   50.6   2.0   23  148-170   141-163 (196)
 25 PF05548 Peptidase_M11:  Gameto  96.1    0.02 4.3E-07   49.9   6.9   81   82-168    84-169 (314)
 26 PF13574 Reprolysin_2:  Metallo  96.0  0.0042 9.1E-08   49.3   2.3   21  149-169   111-131 (173)
 27 cd04272 ZnMc_salivary_gland_MP  95.9  0.0072 1.6E-07   49.5   3.0   21  149-169   145-165 (220)
 28 cd04269 ZnMc_adamalysin_II_lik  95.7   0.006 1.3E-07   48.8   2.0   19  150-168   132-150 (194)
 29 cd04270 ZnMc_TACE_like Zinc-de  95.3  0.0094   2E-07   49.9   1.8   19  150-168   168-186 (244)
 30 cd04275 ZnMc_pappalysin_like Z  95.3  0.0018 3.9E-08   53.8  -2.6   22  149-170   137-158 (225)
 31 cd04271 ZnMc_ADAM_fungal Zinc-  95.2  0.0073 1.6E-07   50.2   0.8   18  151-168   147-164 (228)
 32 cd04273 ZnMc_ADAMTS_like Zinc-  95.1   0.006 1.3E-07   49.5   0.1   20  149-168   140-159 (207)
 33 COG1913 Predicted Zn-dependent  95.1    0.01 2.2E-07   47.5   1.3   20  150-169   125-144 (181)
 34 PF01421 Reprolysin:  Reprolysi  95.1   0.021 4.5E-07   45.9   3.1   19  150-168   132-150 (199)
 35 PRK13267 archaemetzincin-like   94.7   0.017 3.8E-07   46.4   1.8   16  151-166   127-142 (179)
 36 PF07998 Peptidase_M54:  Peptid  94.4   0.021 4.5E-07   46.6   1.6   19  150-168   146-164 (194)
 37 PF11350 DUF3152:  Protein of u  94.3    0.02 4.3E-07   46.9   1.2   95   73-168    29-158 (203)
 38 TIGR03296 M6dom_TIGR03296 M6 f  93.5   0.017 3.6E-07   49.5  -0.7   21  149-169   165-185 (286)
 39 PF12044 Metallopep:  Putative   93.1   0.063 1.4E-06   48.6   2.4   30  149-178   316-345 (423)
 40 PF10462 Peptidase_M66:  Peptid  92.7   0.063 1.4E-06   46.7   1.7   17  149-165   193-209 (305)
 41 PF01457 Peptidase_M8:  Leishma  92.4   0.074 1.6E-06   49.3   2.0   17  149-165   210-226 (521)
 42 cd06459 M3B_Oligoendopeptidase  91.7    0.44 9.6E-06   42.1   6.0   21  142-162   215-235 (427)
 43 PTZ00337 surface protease GP63  91.5    0.11 2.3E-06   48.8   1.9   18  148-165   228-245 (567)
 44 TIGR00181 pepF oligoendopeptid  91.4    0.45 9.7E-06   44.5   6.0   22  142-163   371-392 (591)
 45 cd02641 R3H_Smubp-2_like R3H d  91.1    0.35 7.7E-06   31.9   3.6   41  139-179    18-59  (60)
 46 TIGR02290 M3_fam_3 oligoendope  90.7    0.57 1.2E-05   43.9   5.9   22  142-163   368-389 (587)
 47 PTZ00257 Glycoprotein GP63 (le  90.3    0.16 3.5E-06   48.0   2.0   18  148-165   255-272 (622)
 48 TIGR02289 M3_not_pepF oligoend  88.9    0.84 1.8E-05   42.4   5.5   17  147-163   335-351 (549)
 49 KOG4525|consensus               88.6    0.27 5.8E-06   44.8   1.9   20  149-168   301-320 (614)
 50 PF12725 DUF3810:  Protein of u  87.9    0.35 7.6E-06   42.2   2.2   21  147-167   194-214 (318)
 51 PF05547 Peptidase_M6:  Immune   87.1   0.074 1.6E-06   50.6  -2.6   19  149-167   221-239 (645)
 52 cd06007 R3H_DEXH_helicase R3H   86.3     1.4   3E-05   29.1   3.9   42  138-179    16-58  (59)
 53 KOG3607|consensus               85.9    0.45 9.8E-06   45.9   1.9   19  149-167   323-341 (716)
 54 cd02640 R3H_NRF R3H domain of   85.4     1.4   3E-05   29.1   3.6   42  138-179    17-59  (60)
 55 PF09471 Peptidase_M64:  IgA Pe  82.7    0.86 1.9E-05   38.8   2.0   14  149-162   216-229 (264)
 56 PF04298 Zn_peptidase_2:  Putat  80.3     1.8 3.8E-05   36.1   3.1   26  137-162    71-102 (222)
 57 cd02642 R3H_encore_like R3H do  80.0     3.4 7.4E-05   27.2   3.9   41  139-180    22-62  (63)
 58 TIGR00043 metalloprotein, YbeY  79.2     1.4 3.1E-05   32.5   2.0   19  150-168    74-92  (110)
 59 PF01863 DUF45:  Protein of unk  79.0     5.7 0.00012   31.5   5.6   18  149-166   164-181 (205)
 60 COG2856 Predicted Zn peptidase  78.7     1.1 2.3E-05   37.1   1.3   12  150-161    73-84  (213)
 61 cd02646 R3H_G-patch R3H domain  78.5     4.8  0.0001   26.1   4.1   41  139-179    17-57  (58)
 62 PF02130 UPF0054:  Uncharacteri  76.2     1.9 4.1E-05   33.3   1.9   17  150-166   109-125 (145)
 63 PF06114 DUF955:  Domain of unk  75.8     1.7 3.6E-05   30.8   1.5   24  138-161    28-54  (122)
 64 COG0319 Predicted metal-depend  73.6     2.4 5.2E-05   33.3   2.0   19  150-168   109-127 (153)
 65 PF06262 DUF1025:  Possibl zinc  73.3     2.3 4.9E-05   30.9   1.6   17  150-166    74-90  (97)
 66 COG1164 Oligoendopeptidase F [  73.2     7.8 0.00017   36.7   5.6   17  147-163   378-394 (598)
 67 PRK00016 metal-binding heat sh  72.4     2.4 5.3E-05   33.3   1.8   18  150-167   114-131 (159)
 68 PF11667 DUF3267:  Protein of u  71.7     1.8 3.9E-05   31.5   0.8   20  151-170     6-25  (111)
 69 cd06258 Peptidase_M3_like The   70.7     2.5 5.5E-05   36.8   1.7   14  148-161   153-166 (365)
 70 PF01432 Peptidase_M3:  Peptida  69.3     2.9 6.3E-05   37.7   1.8   15  149-163   242-256 (458)
 71 PF14247 DUF4344:  Domain of un  69.0     3.1 6.7E-05   34.6   1.8   13  149-161    92-104 (220)
 72 PRK13963 unkown domain/putativ  68.9     3.4 7.3E-05   35.1   2.0   17  150-166   216-232 (258)
 73 cd06455 M3A_TOP Peptidase M3 T  65.7     3.7 7.9E-05   37.5   1.7   13  149-161   263-275 (472)
 74 COG2738 Predicted Zn-dependent  65.0     3.7 8.1E-05   33.7   1.4   24  139-162    76-105 (226)
 75 PF01447 Peptidase_M4:  Thermol  64.8     3.9 8.5E-05   31.8   1.5   12  150-161   136-147 (150)
 76 COG4783 Putative Zn-dependent   63.6     4.1 8.9E-05   37.6   1.6   16  147-162   128-143 (484)
 77 COG3824 Predicted Zn-dependent  63.4     3.3 7.1E-05   31.5   0.8   30  137-166    83-126 (136)
 78 cd06457 M3A_MIP Peptidase M3 m  63.0     4.4 9.6E-05   36.9   1.7   17  149-165   248-264 (458)
 79 cd06162 S2P-M50_PDZ_SREBP Ster  61.2     5.3 0.00011   34.4   1.8   16  149-164   135-150 (277)
 80 cd06159 S2P-M50_PDZ_Arch Uncha  60.5     5.5 0.00012   33.9   1.8   23  149-171   118-140 (263)
 81 cd06161 S2P-M50_SpoIVFB SpoIVF  58.9     6.2 0.00013   32.1   1.8   24  148-171    37-60  (208)
 82 PF01435 Peptidase_M48:  Peptid  58.6     6.8 0.00015   31.2   1.9   14  149-162    89-102 (226)
 83 PF13485 Peptidase_MA_2:  Pepti  58.2     6.5 0.00014   27.9   1.6   12  150-161    26-37  (128)
 84 cd06460 M32_Taq Peptidase fami  58.0     7.2 0.00016   35.2   2.1   20  148-170   158-177 (396)
 85 cd06456 M3A_DCP_Oligopeptidase  57.6     6.3 0.00014   35.6   1.7   13  149-161   208-220 (422)
 86 cd06164 S2P-M50_SpoIVFB_CBS Sp  54.2     8.2 0.00018   31.9   1.8   22  149-170    53-74  (227)
 87 PF14521 Aspzincin_M35:  Lysine  54.1     7.9 0.00017   29.9   1.5   14  149-162    96-111 (148)
 88 smart00731 SprT SprT homologue  53.0     8.5 0.00018   29.4   1.5   15  149-163    59-73  (146)
 89 PF10263 SprT-like:  SprT-like   52.8     9.3  0.0002   29.1   1.7   18  148-165    59-76  (157)
 90 KOG2921|consensus               51.5     8.4 0.00018   34.9   1.5   18  150-167   132-149 (484)
 91 PLN02887 hydrolase family prot  51.0      10 0.00022   35.9   2.0   19  150-168   231-249 (580)
 92 PF12315 DUF3633:  Protein of u  49.2      10 0.00022   31.3   1.5   13  149-161    93-105 (212)
 93 KOG3658|consensus               48.1     6.1 0.00013   38.0   0.0   18  151-168   394-411 (764)
 94 PRK10911 oligopeptidase A; Pro  48.1      10 0.00022   36.4   1.6   13  149-161   463-475 (680)
 95 PRK03982 heat shock protein Ht  48.0      11 0.00024   32.1   1.6   14  148-161   124-137 (288)
 96 PRK03072 heat shock protein Ht  48.0      11 0.00024   32.3   1.6   14  148-161   126-139 (288)
 97 PF13699 DUF4157:  Domain of un  47.4      12 0.00025   26.0   1.4   14  149-162    61-74  (79)
 98 COG0501 HtpX Zn-dependent prot  47.3      12 0.00026   31.3   1.7   14  148-161   156-169 (302)
 99 KOG3538|consensus               47.3       4 8.8E-05   40.1  -1.3   21  150-170   318-338 (845)
100 PRK05457 heat shock protein Ht  46.1      12 0.00026   32.0   1.6   13  148-160   133-145 (284)
101 PRK03001 M48 family peptidase;  46.1      12 0.00026   31.8   1.6   14  148-161   123-136 (283)
102 PF06167 Peptidase_M90:  Glucos  45.2      12 0.00027   31.6   1.5   17  148-164   153-169 (253)
103 PHA02456 zinc metallopeptidase  44.9      13 0.00027   28.0   1.3   36  124-163    58-93  (141)
104 PRK01345 heat shock protein Ht  44.8      13 0.00028   32.3   1.6   14  148-161   123-136 (317)
105 cd06160 S2P-M50_like_2 Unchara  44.2      15 0.00032   29.5   1.8   25  149-173    41-65  (183)
106 PRK04897 heat shock protein Ht  44.0      14  0.0003   31.8   1.6   13  149-161   137-149 (298)
107 cd02639 R3H_RRM R3H domain of   44.0      16 0.00034   24.1   1.5   28  139-166    18-46  (60)
108 PF15639 Tox-MPTase3:  Metallop  43.7      46   0.001   25.5   4.2   70   89-160    23-111 (135)
109 KOG2556|consensus               43.5      13 0.00029   34.5   1.5   18  150-167   256-273 (666)
110 PF07108 PipA:  PipA protein;    42.8     9.5 0.00021   30.4   0.4   44  115-164   122-167 (200)
111 PRK02870 heat shock protein Ht  42.8      15 0.00033   32.3   1.7   13  148-160   172-184 (336)
112 PF13203 DUF2201_N:  Putative m  42.3      18 0.00038   30.6   2.0   22  149-171    60-81  (292)
113 PF04228 Zn_peptidase:  Putativ  41.7      15 0.00032   31.9   1.4   12  150-161   171-182 (292)
114 PRK02391 heat shock protein Ht  40.9      16 0.00036   31.4   1.6   13  148-160   132-144 (296)
115 PRK01265 heat shock protein Ht  40.6      17 0.00036   32.0   1.6   13  148-160   139-151 (324)
116 KOG3624|consensus               39.1      21 0.00045   34.1   2.2   30  151-182   520-549 (687)
117 PF02102 Peptidase_M35:  Deuter  38.8      22 0.00047   31.8   2.0   20  145-164   290-312 (359)
118 cd02325 R3H R3H domain. The na  38.4      50  0.0011   20.0   3.2   41  139-179    18-58  (59)
119 cd06006 R3H_unknown_2 R3H doma  38.1      33 0.00071   22.5   2.3   39  141-179    20-58  (59)
120 PRK04351 hypothetical protein;  36.2      22 0.00048   27.6   1.5   13  149-161    61-73  (149)
121 PF01431 Peptidase_M13:  Peptid  36.2      19 0.00041   28.6   1.2   20  151-172    38-57  (206)
122 PF14891 Peptidase_M91:  Effect  35.4      25 0.00054   27.7   1.7   19  150-168   104-122 (174)
123 PRK10280 dipeptidyl carboxypep  35.1      23 0.00049   34.2   1.7   13  150-162   465-477 (681)
124 PRK04860 hypothetical protein;  34.3      26 0.00057   27.6   1.7   13  149-161    63-75  (160)
125 PLN02791 Nudix hydrolase homol  33.8      20 0.00044   35.2   1.1   20  150-169   586-605 (770)
126 PRK15410 DgsA anti-repressor M  32.8      21 0.00045   30.4   1.0   18  148-165   141-158 (260)
127 PF10460 Peptidase_M30:  Peptid  32.6      28 0.00061   31.2   1.8   16  149-164   139-154 (366)
128 COG2317 Zn-dependent carboxype  30.2      24 0.00052   32.7   0.9   11  151-161   261-271 (497)
129 KOG0201|consensus               27.4      20 0.00044   32.9  -0.0   30  150-183   113-142 (467)
130 smart00393 R3H Putative single  27.2      73  0.0016   21.5   2.8   39  141-179    39-77  (79)
131 PF04450 BSP:  Peptidase of pla  26.0      44 0.00095   27.3   1.7   16  149-164    96-111 (205)
132 PF01434 Peptidase_M41:  Peptid  24.2      45 0.00098   27.0   1.5   13  149-161    28-40  (213)
133 PF02074 Peptidase_M32:  Carbox  24.2      43 0.00094   31.1   1.5   13  149-161   259-271 (494)
134 PF09768 Peptidase_M76:  Peptid  23.2      48   0.001   26.5   1.4   14  149-162    71-84  (173)
135 COG0339 Dcp Zn-dependent oligo  22.6      49  0.0011   32.0   1.5   24   89-112   365-388 (683)
136 KOG2719|consensus               22.4      46   0.001   30.4   1.3   13  148-160   279-291 (428)
137 KOG3314|consensus               21.7      56  0.0012   26.3   1.5   24  150-183    92-115 (194)
138 PF07023 DUF1315:  Protein of u  21.6 1.3E+02  0.0028   21.7   3.2   47   67-121    22-68  (93)
139 cd06461 M2_ACE Peptidase famil  21.3      58  0.0013   30.1   1.7   16  148-163   246-261 (477)
140 KOG3854|consensus               21.0      84  0.0018   29.2   2.6   40  124-163   321-365 (505)
141 PF05452 Clavanin:  Clavanin;    20.8      28 0.00061   23.7  -0.3   13  150-162    41-53  (80)
142 KOG2661|consensus               20.8      56  0.0012   29.2   1.4   12  150-161   276-287 (424)
143 COG4900 Predicted metallopepti  20.5      55  0.0012   24.6   1.1   15  146-160    76-91  (133)
144 PF10023 DUF2265:  Predicted am  20.1      79  0.0017   28.0   2.2   13  149-161   165-177 (337)

No 1  
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=100.00  E-value=3e-45  Score=297.95  Aligned_cols=121  Identities=80%  Similarity=1.446  Sum_probs=112.4

Q ss_pred             cccCCCCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCccee
Q psy2976          62 ATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAI  141 (184)
Q Consensus        62 a~~~~~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~i  141 (184)
                      |......+||+++|||.|+++|+...+..|++||++|++.|||+|+|++.  +.+||.|...+.||||+||+.+.|.|.|
T Consensus         2 ~~~~~~~~Wp~~~VpY~i~~~~~~~~~~~I~~Am~~~~~~TCirF~~r~~--~~~yi~f~~~~~GC~S~vG~~~~g~q~i   79 (200)
T cd04281           2 ATARKERIWPGGVIPYVIDGNFTGSQRAMFKQAMRHWENFTCVTFVERTP--EENYIVFTYRPCGCCSYVGRRGNGPQAI   79 (200)
T ss_pred             CccCccCcCCCCEEEEEECCCCCHHHHHHHHHHHHHHHhCCceEEEECCC--CCCEEEEEECCCCeeEcCCCcCCCceee
Confidence            34456789999999999999999999999999999999999999999987  5799999865679999999988789999


Q ss_pred             ecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         142 SIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       142 sl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      +|+.+|...|+|+|||||||||+|||+|||||+||+|+|+||+
T Consensus        80 sl~~~C~~~Gti~HEl~HaLGf~HEhsRpDRD~yV~I~~~nI~  122 (200)
T cd04281          80 SIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQ  122 (200)
T ss_pred             ecCCCcCcCchHHHHHHHHhcCcchhccccccceEEEeecccC
Confidence            9999999999999999999999999999999999999999995


No 2  
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=100.00  E-value=1.1e-44  Score=299.74  Aligned_cols=134  Identities=32%  Similarity=0.601  Sum_probs=121.0

Q ss_pred             CCCCCceEEccCCcccccccCCCCCcccccCCCCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCC
Q psy2976          35 PPSPSTIVVSQTSLPEAYTVHHRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEH  114 (184)
Q Consensus        35 ~~~~~~i~~~~~~~~~~~~~~~R~kR~a~~~~~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~  114 (184)
                      ..-.+||.+..           .++|.|+.....+||+ +|||.|+++|+...++.|++||++|++.|||+|++++.  +
T Consensus        22 ~~~eGDI~l~~-----------~~~R~a~~~~~~~Wp~-~VPY~i~~~~~~~~~~~I~~Am~~~~~~TCirF~~rt~--e   87 (230)
T cd04282          22 DLFEGDILLDE-----------GQSRNGLIGDTYRWPF-PIPYILDDSLDLNAKGVILKAFEMYRLKSCVDFKPYEG--E   87 (230)
T ss_pred             ccccccccCCc-----------ccccccccCcccCCCc-ceeEEECCCCCHHHHHHHHHHHHHHHhCCCeeEEECCC--C
Confidence            35566666652           2367888888899999 89999999999999999999999999999999999987  4


Q ss_pred             CcEEEEecCCCCcccccCCCCCCcceeecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         115 PNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       115 ~~~I~f~~~~~gC~S~vG~~~~g~q~isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      .+||.|.. +.||||+||+.+ |.|.|+|+.+|...|+|+|||||||||+|||+|||||+||+|+|+||.
T Consensus        88 ~~yi~i~~-~~GC~S~vG~~g-g~q~isl~~~C~~~Gti~HEl~HalGf~HEqsRpDRD~yV~I~~~nI~  155 (230)
T cd04282          88 SNYIFFFK-GSGCWSMVGDQQ-GGQNLSIGAGCDYKATVEHEFLHALGFYHEQSRSDRDDYVKIWWDQIL  155 (230)
T ss_pred             CcEEEEEc-CCCeeeccCccC-CeEEEEECCCcCCCchHHHHHHHHhCCcccccccccccceEEeecccC
Confidence            79999984 789999999987 899999999999999999999999999999999999999999999995


No 3  
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=100.00  E-value=1.9e-41  Score=273.85  Aligned_cols=114  Identities=46%  Similarity=1.008  Sum_probs=96.4

Q ss_pred             CCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCcceeecCCCC
Q psy2976          68 RIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNC  147 (184)
Q Consensus        68 ~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~isl~~~c  147 (184)
                      ++||+++|||.|+++|++..++.|++||+.|++.|||+|++++ .....+|.|. .+.||||+||+.+ |.|.|+|+.+|
T Consensus         1 ~~Wp~~~IpY~~~~~~~~~~~~~I~~Am~~~e~~TcI~F~~~~-~~~~~~i~~~-~~~gC~S~vG~~~-g~q~i~l~~~c   77 (191)
T PF01400_consen    1 KKWPNGTIPYYIDPSFSSSQRQRIRKAMDEWEKNTCIRFVERT-ENEDDYISFS-NGSGCWSYVGRQG-GEQTINLGDGC   77 (191)
T ss_dssp             -S-GGGEEEEEEETTS-HHHHHHHHHHHHHHHHHSSEEEEE-S-SSSSSEEEEE-SSSSEEEESS--S-SEEEEEE-TTC
T ss_pred             CcCCCCEEEEEECCCCCHHHHHHHHHHHHHHHhCCCEEEEECC-CCCceEEEee-cCccccchhhhcC-cceeEEeccee
Confidence            5899999999999999999999999999999999999999999 3367899997 4789999999995 99999999999


Q ss_pred             chHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         148 DKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      ...|+|+|||||||||.|||+|||||+||+|+|+||+
T Consensus        78 ~~~~~i~HEl~HaLG~~HEh~RpDRd~yi~i~~~~i~  114 (191)
T PF01400_consen   78 FSVGTILHELGHALGFWHEHQRPDRDNYITINWDNIQ  114 (191)
T ss_dssp             -SHHHHHHHHHHHHTB--GGGSTTGGGTEEE-GGGB-
T ss_pred             CCccchHHHHHHHHhhhhhhhccccccEEEEehhcch
Confidence            9999999999999999999999999999999999984


No 4  
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=100.00  E-value=1.9e-40  Score=266.24  Aligned_cols=107  Identities=40%  Similarity=0.835  Sum_probs=100.8

Q ss_pred             ceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCcceeecC-CCCchHHH
Q psy2976          74 VIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIG-KNCDKFGI  152 (184)
Q Consensus        74 ~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~isl~-~~c~~~g~  152 (184)
                      +|||.|+++|++..++.|++||++|++.|||+|++++.  +.+||.|.. +.||||+||+.+ |.|.|+|+ .+|...|+
T Consensus         5 ~IpY~i~~~~~~~~~~~I~~A~~~~~~~TCirF~~~~~--~~~yi~~~~-~~gC~S~vG~~g-g~q~i~l~~~~C~~~G~   80 (182)
T cd04283           5 YVPYVISPQYSENERAVIEKAMQEFETLTCVRFVPRTT--ERDYLNIES-RSGCWSYIGRQG-GRQTVSLQKQGCMYKGI   80 (182)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHhCCceeeEECCC--CCcEEEEEc-CCCceEecCccC-CceeEecCCCCcCccch
Confidence            79999999999999999999999999999999999876  578999984 789999999997 89999997 58999999


Q ss_pred             HHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         153 VVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       153 i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      |+|||||||||+|||+|||||+||+|+|+||.
T Consensus        81 i~HEl~HaLG~~HEhsRpDRD~yV~I~~~nI~  112 (182)
T cd04283          81 IQHELLHALGFYHEQTRSDRDKYVRINWENII  112 (182)
T ss_pred             HHHHHHHHhCCcccccccccCceEEEehhhcC
Confidence            99999999999999999999999999999984


No 5  
>KOG3714|consensus
Probab=100.00  E-value=1.2e-40  Score=296.55  Aligned_cols=127  Identities=52%  Similarity=0.987  Sum_probs=116.3

Q ss_pred             CCCCcccccCCCCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCC
Q psy2976          56 HRDTRAATARKERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRG  135 (184)
Q Consensus        56 ~R~kR~a~~~~~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~  135 (184)
                      .|.+|.++.....+||+++|||.|+++|+...|++|+.||++|+++|||+|+|++.. ..+|+.+.... ||||+||+.|
T Consensus        68 ~~~~r~~~~~~~~~Wp~~~ipY~i~~~~~~~~r~~i~~A~~~~~~~TCi~F~~~~~~-~~~~~~~~~~~-gC~S~VGr~g  145 (411)
T KOG3714|consen   68 KRSRRNGTSNPERRWPNGVIPYYIDGSFTSSQRALIRQAMREIENHTCIRFVERTTP-DKDYLIVFTGG-GCYSYVGRRG  145 (411)
T ss_pred             chhhhhcccChhhcCCCCeeeeEECCCCCHHHHHHHHHHHHHHhhCcceEEEeCCCC-CcceEEEeCCC-cceeeeCccC
Confidence            467788888899999999999999999999999999999999999999999999854 45677666444 9999999999


Q ss_pred             CCcceeecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         136 NGQQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       136 ~g~q~isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      +++|.++|+.+|..+|+|+|||||||||+|||+|||||+||+|+|+||.
T Consensus       146 g~~q~~sl~~~C~~~G~i~HEl~HaLGf~HehsR~DRD~yV~I~~~ni~  194 (411)
T KOG3714|consen  146 GGQQLLSLGDGCDRFGTIVHELMHALGFWHEHSRPDRDNYVSINWDNID  194 (411)
T ss_pred             CCccceecCCCcCcCchhHHHHHHHhhhhhccCcccccCceEEeeccCC
Confidence            6679999999999999999999999999999999999999999999995


No 6  
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=100.00  E-value=6.1e-40  Score=262.86  Aligned_cols=109  Identities=45%  Similarity=0.872  Sum_probs=102.9

Q ss_pred             CCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCcceeecCCCCchHH
Q psy2976          72 YGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGKNCDKFG  151 (184)
Q Consensus        72 ~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~isl~~~c~~~g  151 (184)
                      +++|||.|+++|++.+++.|++||+.|++.|||+|+|++.  +.++|.|.. ..||||+||+.+ +.|.|+|+.+|...|
T Consensus         1 ~~~VpY~i~~~~~~~~~~~I~~A~~~w~~~TcIrF~~~~~--~~~~I~f~~-~~Gc~S~vG~~~-~~q~i~l~~~c~~~g   76 (180)
T cd04280           1 NGTVPYVIDGSFDESDRSLILRAMREIESNTCIRFVPRTT--EKDYIRIVK-GSGCWSYVGRVG-GRQVVSLGSGCFSLG   76 (180)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHhCCcceEEECCC--CCcEEEEEc-CCCcceecCccC-CceeEEeCCCcCcCc
Confidence            4689999999999999999999999999999999999987  578999986 489999999996 899999999999999


Q ss_pred             HHHHHHHHhhCCCCCCCCCCCCCceEeecccCC
Q psy2976         152 IVVHELGHVVGFWHEHTRPDRDNHVQIIRENIM  184 (184)
Q Consensus       152 ~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI~  184 (184)
                      +++|||||||||.|||+|||||+||+|+|+||.
T Consensus        77 ~v~HE~~HalG~~HEh~R~DRD~yv~i~~~ni~  109 (180)
T cd04280          77 TIVHELMHALGFYHEQSRPDRDDYVTINWENIQ  109 (180)
T ss_pred             hhHHHHHHHhcCcchhcccccCCeEEEeecccC
Confidence            999999999999999999999999999999984


No 7  
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=100.00  E-value=1.3e-32  Score=210.65  Aligned_cols=115  Identities=41%  Similarity=0.815  Sum_probs=103.9

Q ss_pred             CCCcCCCceEEEEc-CCCCHHH-HHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCC-Ccc-cccCCCCCCcceee
Q psy2976          67 ERIWDYGVIPYEID-SNFGGQH-KALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPC-GCC-SFVGKRGNGQQAIS  142 (184)
Q Consensus        67 ~~~Wp~g~IpY~~~-~~~~~~~-r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~-gC~-S~vG~~~~g~q~is  142 (184)
                      ..+|++++|+|+|+ +.+++.+ ++.|++||+.|+..+||+|++++.. ...+|.|..... ||+ +++|+.+ |.+.++
T Consensus         2 ~~~W~~~~v~Y~i~~~~~~~~~~~~~i~~A~~~w~~~t~i~F~e~~~~-ad~~I~f~~~~~~g~~~a~~g~~~-g~~~~~   79 (140)
T smart00235        2 SKKWPKGTVPYVIDSSSLSPEEVREAIARAFAEWSDVTCLRFVERTST-ADIYISFGKGDGSGCTLSHAGRPG-GDQHFS   79 (140)
T ss_pred             CCcCCCCcEEEEEcCCCCCHHHHHHHHHHHHHHHhcCCeeEEEECCCC-CCeEEEEEECCCCCcceeeeecCC-CceEEE
Confidence            46999999999997 8888876 9999999999999999999998752 567899986443 998 9999985 889999


Q ss_pred             cCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeecccC
Q psy2976         143 IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENI  183 (184)
Q Consensus       143 l~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI  183 (184)
                      ++.+|...++++|||||||||.|||+|||||+||.|+|+||
T Consensus        80 ~~~~~~~~~~~~HEigHaLGl~H~~~~~drd~~~~~~~~~~  120 (140)
T smart00235       80 LGNGCINTGVAAHELGHALGLYHEQSRSDRDNYMYINYTNI  120 (140)
T ss_pred             ccCCcCCcccHHHHHHHHhcCCcCCCCCcccCeEEEehhhh
Confidence            98899999999999999999999999999999999999987


No 8  
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.97  E-value=2.6e-31  Score=215.52  Aligned_cols=110  Identities=25%  Similarity=0.442  Sum_probs=92.1

Q ss_pred             CCcCCCc-eEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcccccCCCC----CCcceee
Q psy2976          68 RIWDYGV-IPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRG----NGQQAIS  142 (184)
Q Consensus        68 ~~Wp~g~-IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~----~g~q~is  142 (184)
                      ++||+++ ++|.|.+++++..|+.|++||++|+.+|||+|++++......+|.|.. +.||||+||+.+    .+.++|+
T Consensus         1 ~~W~~~~~~~~~f~~~~~~~~r~~I~~A~~~W~~~t~i~F~~~~~~~adi~I~f~~-~~Gc~S~vG~~~~~~~~~~~t~~   79 (198)
T cd04327           1 KLWRNGTVLRIAFLGGPDAFLKDKVRAAAREWLPYANLKFKFVTDADADIRISFTP-GDGYWSYVGTDALLIGADAPTMN   79 (198)
T ss_pred             CCCCCCCeEEEEeCCCCcHHHHHHHHHHHHHHhhhcCeEEEECCCCCCCEEEEEec-CCCCCCCcCCcccccCCCCceee
Confidence            5899985 557888888888999999999999999999999987643455777764 579999999964    2467888


Q ss_pred             cCCC------CchHHHHHHHHHHhhCCCCCCCCCCCCCceEeeccc
Q psy2976         143 IGKN------CDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIREN  182 (184)
Q Consensus       143 l~~~------c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~N  182 (184)
                      |+..      |...++|+|||||||||.|||+|||||    |.|+|
T Consensus        80 l~~~~~~~~~~~~~~~i~HElgHaLG~~HEh~rpdrd----i~w~~  121 (198)
T cd04327          80 LGWFTDDTPDPEFSRVVLHEFGHALGFIHEHQSPAAN----IPWDK  121 (198)
T ss_pred             eeeecCCCchhhHHHHHHHHHHHHhcCcccccCCCCC----CCcCH
Confidence            8753      566799999999999999999999999    77774


No 9  
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=99.91  E-value=7e-25  Score=171.25  Aligned_cols=103  Identities=23%  Similarity=0.343  Sum_probs=85.9

Q ss_pred             CceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEec-----CCCCcccccCCCC-CCcceeecCCC
Q psy2976          73 GVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTE-----KPCGCCSFVGKRG-NGQQAISIGKN  146 (184)
Q Consensus        73 g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~-----~~~gC~S~vG~~~-~g~q~isl~~~  146 (184)
                      ..|+|.|+++++...|+.|++||+.|++.+||+|++.+.. ....|.|..     .+.||++++|... .+.+.|.++..
T Consensus         2 ~~I~y~i~~~~~~~~r~~i~~A~~~W~~~~~i~F~e~~~~-~~~di~i~~~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~   80 (165)
T cd04268           2 KPITYYIDDSVPDKLRAAILDAIEAWNKAFAIGFKNANDV-DPADIRYSVIRWIPYNDGTWSYGPSQVDPLTGEILLARV   80 (165)
T ss_pred             CCEEEEEcCCCCHHHHHHHHHHHHHHHHHhCcCceecccc-CccCceEEEEEeecCCCCccccCCccCCCCCccEEeeEE
Confidence            4799999999999999999999999999999999998764 233444432     2578999999862 35678888776


Q ss_pred             Cc-----------hHHHHHHHHHHhhCCCCCCCCCCCCCce
Q psy2976         147 CD-----------KFGIVVHELGHVVGFWHEHTRPDRDNHV  176 (184)
Q Consensus       147 c~-----------~~g~i~HElgHALG~~HEh~RpDRD~yV  176 (184)
                      |.           ..++++|||||||||.|+++|||||.|+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~HEiGHaLGL~H~~~~~~~~~~~  121 (165)
T cd04268          81 YLYSSFVEYSGARLRNTAEHELGHALGLRHNFAASDRDDNV  121 (165)
T ss_pred             EEchhHHHHHHHHHHHHHHHHHHHHhcccccCcCCccCCcc
Confidence            64           5799999999999999999999999876


No 10 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=99.79  E-value=6.9e-19  Score=137.44  Aligned_cols=103  Identities=26%  Similarity=0.451  Sum_probs=73.1

Q ss_pred             CcCCCceEEEEcCCC----CHHHHHHHHHHHHHhhcccceEEEEcCCC-CCCcEEEEecCCCCc-ccccCCCCC------
Q psy2976          69 IWDYGVIPYEIDSNF----GGQHKALFKQAMRHWENFTCVKFVERSST-EHPNYILFTEKPCGC-CSFVGKRGN------  136 (184)
Q Consensus        69 ~Wp~g~IpY~~~~~~----~~~~r~~I~~A~~~we~~TcV~F~e~~~~-~~~~~I~f~~~~~gC-~S~vG~~~~------  136 (184)
                      |||+++|+|+|++..    ....++.|++||+.|+..+||+|++++.. .....|.|.....+| +++.|..+.      
T Consensus         1 kW~~~~itY~i~~~~~~~~~~~~~~~i~~A~~~W~~~~~l~F~e~~~~~~adi~I~~~~~~~~~~~~~~~~~g~l~~a~~   80 (157)
T cd04278           1 KWSKTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGQEADIRISFARGNHGDGYPFDGPGGTLAHAFF   80 (157)
T ss_pred             CCCCCceeEEEECCCCCCCHHHHHHHHHHHHHHHHhhcCceeEEcccCCCCCEEEEEeecccCCCCCCCCCccccccccC
Confidence            799999999998654    36788999999999999999999998764 224456666544555 344443220      


Q ss_pred             -----C------cceeecC---CCCchHHHHHHHHHHhhCCCCCCCCCC
Q psy2976         137 -----G------QQAISIG---KNCDKFGIVVHELGHVVGFWHEHTRPD  171 (184)
Q Consensus       137 -----g------~q~isl~---~~c~~~g~i~HElgHALG~~HEh~RpD  171 (184)
                           +      ....++.   .++....+++|||||||||.|++.+.+
T Consensus        81 p~~~~g~i~~~~~~~~~~~~~~~~~~~~~~~~HEiGHaLGL~H~~~~~~  129 (157)
T cd04278          81 PGGIGGDIHFDDDEQWTLGSDSGGTDLFSVAAHEIGHALGLGHSSDPDS  129 (157)
T ss_pred             CCCcceeEEECCCcccccCCCCccchHHHHHHHHhccccccCCCCCCcC
Confidence                 1      0111221   235678899999999999999987644


No 11 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=99.70  E-value=9e-17  Score=125.28  Aligned_cols=106  Identities=29%  Similarity=0.511  Sum_probs=79.8

Q ss_pred             ceEEEEcCC--------CCHHHHHHHHHHHHHhhcccceEEEEcCCC--CCCcEEEEecC----CCCcccccCCCC-CCc
Q psy2976          74 VIPYEIDSN--------FGGQHKALFKQAMRHWENFTCVKFVERSST--EHPNYILFTEK----PCGCCSFVGKRG-NGQ  138 (184)
Q Consensus        74 ~IpY~~~~~--------~~~~~r~~I~~A~~~we~~TcV~F~e~~~~--~~~~~I~f~~~----~~gC~S~vG~~~-~g~  138 (184)
                      .|+|.|...        ++...++.|+.|++.|+..+||+|++....  .....+.+...    +.+|++++|... .+.
T Consensus         2 ~i~~~i~~d~~~~~~~~~~~~~~~~v~~a~~~w~~~~~i~f~~~~~~~~~~di~~~~~~~~~~~~~~g~a~~~~~c~~~~   81 (167)
T cd00203           2 VIPYVVVADDRDVEEENLSAQIQSLILIAMQIWRDYLNIRFVLVGVEIDKADIAILVTRQDFDGGTGGWAYLGRVCDSLR   81 (167)
T ss_pred             EEEEEEEecccccchhhhHHHHHHHHHHHHHHHHhhhCceEEEeccCCCcCcEEEEeccccCCCCceEEEecCCccCCCC
Confidence            577777654        667788999999999999999999998763  22333444321    357889998863 233


Q ss_pred             ceeecCCCC----chHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         139 QAISIGKNC----DKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       139 q~isl~~~c----~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      +.+.+...+    ....+++|||||||||.|++.++|||+||++.
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~HElGH~LGl~H~~~~~~~~~~~~~~  126 (167)
T cd00203          82 GVGVLQDNQSGTKEGAQTIAHELGHALGFYHDHDRKDRDDYPTID  126 (167)
T ss_pred             CcEEEecCCcccccchhhHHHHHHHHhCCCccCcCCCCCCCcccc
Confidence            455555443    56789999999999999999999999998873


No 12 
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.61  E-value=5.4e-15  Score=115.23  Aligned_cols=97  Identities=29%  Similarity=0.391  Sum_probs=64.4

Q ss_pred             ceEEEEcCC------CCHHHHHHHHHHHHHhhcccceEEEEcCCC--CCCcEEEEec----C--CCCcccccCCC-----
Q psy2976          74 VIPYEIDSN------FGGQHKALFKQAMRHWENFTCVKFVERSST--EHPNYILFTE----K--PCGCCSFVGKR-----  134 (184)
Q Consensus        74 ~IpY~~~~~------~~~~~r~~I~~A~~~we~~TcV~F~e~~~~--~~~~~I~f~~----~--~~gC~S~vG~~-----  134 (184)
                      .|+|++++.      ...+.++.|++||+.|++.+||+|++....  +....|.|..    .  ++.|.+..+..     
T Consensus         3 ~i~~~i~~~~~~~~~~~~~~~~~v~~A~~~W~~~~~l~F~~~~~~~~~adi~I~f~~~~~~~~~g~~~a~a~~p~~~~~~   82 (156)
T cd04279           3 PIRVYIDPTPAPPDSRAQSWLQAVKQAAAEWENVGPLKFVYNPEEDNDADIVIFFDRPPPVGGAGGGLARAGFPLISDGN   82 (156)
T ss_pred             CeEEEEcCCCCccccchHHHHHHHHHHHHHHHHhCCeEEEEccCCCCCCcEEEEecCCCCCCCCCCceEEecccccCCCc
Confidence            578888754      345788999999999999999999998652  2334455642    1  22343322211     


Q ss_pred             --CCCcceeecCC-----CCchHHHHHHHHHHhhCCCCCCCCC
Q psy2976         135 --GNGQQAISIGK-----NCDKFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       135 --~~g~q~isl~~-----~c~~~g~i~HElgHALG~~HEh~Rp  170 (184)
                        +...-.++++.     .....++++|||||||||.|+++++
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~HEiGHaLGL~H~~~~~  125 (156)
T cd04279          83 RKLFNRTDINLGPGQPRGAENLQAIALHELGHALGLWHHSDRP  125 (156)
T ss_pred             ccccccceEeecCCcCccchHHHHHHHHHhhhhhcCCCCCCCc
Confidence              11122333322     1245789999999999999999998


No 13 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=99.57  E-value=3.4e-14  Score=109.43  Aligned_cols=102  Identities=24%  Similarity=0.431  Sum_probs=67.2

Q ss_pred             CcCCCceEEEEcCCC---C-HHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCC-CCcccccCCCCC-------
Q psy2976          69 IWDYGVIPYEIDSNF---G-GQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKP-CGCCSFVGKRGN-------  136 (184)
Q Consensus        69 ~Wp~g~IpY~~~~~~---~-~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~-~gC~S~vG~~~~-------  136 (184)
                      ||+..+|.|+|....   + .+.+++|++||+.|+..++|+|++.......-.|.|.... ..+..+-|..+.       
T Consensus         1 ~W~~~~ity~i~~~~~~~~~~~~~~~i~~A~~~W~~~~~~~F~~~~~~~adi~i~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (154)
T PF00413_consen    1 KWPKKTITYSISNTTPQLSQSEQRDAIRQAFQAWNDVAPLNFTEVSDGNADIRISFGSNNHGDGYSFDGSGGTLAHAYFP   80 (154)
T ss_dssp             SSSSSEEEEEESSBCTTS-HHHHHHHHHHHHHHHHTTSSEEEEEESSSSCSEEEEEESSSSSSSS-CSSSSSESEEEEES
T ss_pred             CCCCCcEEEEEECCCCCCCHHHHHHHHHHHHHHHHhcCCceEEeccCCCcceeeeeeccccCcccccccceeeeeccccc
Confidence            799999999997532   3 4588899999999999999999999863234456665322 223222222210       


Q ss_pred             C---cceeecCC--------CC-chHHHHHHHHHHhhCCCCCCCCC
Q psy2976         137 G---QQAISIGK--------NC-DKFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       137 g---~q~isl~~--------~c-~~~g~i~HElgHALG~~HEh~Rp  170 (184)
                      +   .-.+.+..        .. ....+++|||||||||.|++.+.
T Consensus        81 ~~~~~~~i~~~~~~~~~~~~~~~~~~~v~~HEiGHaLGL~H~~~~~  126 (154)
T PF00413_consen   81 NNIVSGDIHFNDDESWTIDDSGNDLQSVAIHEIGHALGLDHSNDPN  126 (154)
T ss_dssp             SSTTTTEEEEETTSHEESSSSSEEHHHHHHHHHHHHTTBESSSSTT
T ss_pred             cccccccccccccccchhhhhhhhhhhhhhhccccccCcCcCCCcc
Confidence            0   11222221        11 35689999999999999997653


No 14 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=99.56  E-value=3.1e-14  Score=113.90  Aligned_cols=93  Identities=20%  Similarity=0.364  Sum_probs=66.0

Q ss_pred             CCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCC-----CCcccccCCCC-----CCcceeecC-------
Q psy2976          82 NFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKP-----CGCCSFVGKRG-----NGQQAISIG-------  144 (184)
Q Consensus        82 ~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~-----~gC~S~vG~~~-----~g~q~isl~-------  144 (184)
                      .+++.+|+.|++||+.|+..+||+|++++.. ....|.|....     .+++++.+...     .|.-.++..       
T Consensus        30 ~~~~~~~~~i~~A~~~w~~~~~l~F~e~~~~-~~adI~i~~~~~~~~~~~g~a~~p~~~~~~~~~g~i~~~~~~~~~~~~  108 (186)
T cd04277          30 ALSAAQQAAARDALEAWEDVADIDFVEVSDN-SGADIRFGNSSDPDGNTAGYAYYPGSGSGTAYGGDIWFNSSYDTNSDS  108 (186)
T ss_pred             cCCHHHHHHHHHHHHHHHhhcCceeEECCCC-CcceEEEEeccCCCCCccEEEECCCCCccccccceeEEecCcccccCC
Confidence            5677899999999999999999999999875 33456665322     23444444321     122122221       


Q ss_pred             CCCchHHHHHHHHHHhhCCCCCCCCCCCCCc
Q psy2976         145 KNCDKFGIVVHELGHVVGFWHEHTRPDRDNH  175 (184)
Q Consensus       145 ~~c~~~g~i~HElgHALG~~HEh~RpDRD~y  175 (184)
                      .++....+++|||||||||.|++..++.+.+
T Consensus       109 ~g~~~~~t~~HEiGHaLGL~H~~~~~~~~~~  139 (186)
T cd04277         109 PGSYGYQTIIHEIGHALGLEHPGDYNGGDPV  139 (186)
T ss_pred             CChhhHHHHHHHHHHHhcCCCCCcCCCCCCC
Confidence            2567789999999999999999999887654


No 15 
>KOG1565|consensus
Probab=98.91  E-value=2.9e-09  Score=96.77  Aligned_cols=102  Identities=24%  Similarity=0.418  Sum_probs=71.3

Q ss_pred             CCCcCCCceEEEEcCC---C-CHHHHHHHHHHHHHhhcccceEEEEcCC-CCCCcEEEEecCCCCc-ccccCCCCC----
Q psy2976          67 ERIWDYGVIPYEIDSN---F-GGQHKALFKQAMRHWENFTCVKFVERSS-TEHPNYILFTEKPCGC-CSFVGKRGN----  136 (184)
Q Consensus        67 ~~~Wp~g~IpY~~~~~---~-~~~~r~~I~~A~~~we~~TcV~F~e~~~-~~~~~~I~f~~~~~gC-~S~vG~~~~----  136 (184)
                      ..+|++..++|+|.+.   + ..+.++++.+|+..|+++|.++|.|... ...+..|.|.....|+ +.+-|..+.    
T Consensus       103 ~~kW~k~~lT~ri~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~g~laHA  182 (469)
T KOG1565|consen  103 KPKWNKEHLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPGGVLAHA  182 (469)
T ss_pred             cCcccccccceeccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCCCceecc
Confidence            5699999999999853   2 2468899999999999999999999987 3244467776433333 123333220    


Q ss_pred             --------------CcceeecC--CCCchHHHHHHHHHHhhCCCCCCC
Q psy2976         137 --------------GQQAISIG--KNCDKFGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       137 --------------g~q~isl~--~~c~~~g~i~HElgHALG~~HEh~  168 (184)
                                    ......++  .+-+.+.|++|||||||||.|...
T Consensus       183 f~Pg~~~~G~~hfD~dE~Wt~~~~~g~~l~~Va~HEiGH~LGL~HS~~  230 (469)
T KOG1565|consen  183 FFPGPGIGGDLHFDKDETWTYGDSNGVDLFLVAAHEIGHALGLGHSSD  230 (469)
T ss_pred             cCCCCCCCCccccCcccceeccCCccchhHHHhhhhcccccccCCCCC
Confidence                          11233332  244678999999999999999943


No 16 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=98.80  E-value=3.8e-08  Score=80.72  Aligned_cols=127  Identities=18%  Similarity=0.303  Sum_probs=72.5

Q ss_pred             CceEEccCCcccccccCCCCCcccccCCCCCcC--CCceEEEEcC----CCCHHHHHHHHHHHHHhhcc-cceEEEEc--
Q psy2976          39 STIVVSQTSLPEAYTVHHRDTRAATARKERIWD--YGVIPYEIDS----NFGGQHKALFKQAMRHWENF-TCVKFVER--  109 (184)
Q Consensus        39 ~~i~~~~~~~~~~~~~~~R~kR~a~~~~~~~Wp--~g~IpY~~~~----~~~~~~r~~I~~A~~~we~~-TcV~F~e~--  109 (184)
                      +||.++.+.+.++.....-..++-  .+..+|.  .++|...+..    .++..++..+.+||+.|+.. ..|+|.-.  
T Consensus         5 gDi~~s~~~l~~~~~~~~~~~eqY--rTtnlV~~~~~~I~i~~~~~~~~~l~s~~~~al~~AI~~yNalgl~i~F~~t~g   82 (211)
T PF12388_consen    5 GDIFVSKKQLREMLQSDDGTSEQY--RTTNLVGSSPRTITIIGYTGGSQSLNSAWRTALDEAINNYNALGLSITFTLTFG   82 (211)
T ss_pred             cceEEcHHHHhhhhccCCcchhhe--eeeeeecCCCCEEEEEeCCCccccccHHHHHHHHHHHHHHHhhCCceEEEEecC
Confidence            688898887776652221112221  3355673  3578777776    67778899999999999995 56899521  


Q ss_pred             CCCCCCcEEEEecCC---CCcccccCCC---CCCcceeecCC---C-C-chHHHHHHHHHHhhCCCCCC
Q psy2976         110 SSTEHPNYILFTEKP---CGCCSFVGKR---GNGQQAISIGK---N-C-DKFGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       110 ~~~~~~~~I~f~~~~---~gC~S~vG~~---~~g~q~isl~~---~-c-~~~g~i~HElgHALG~~HEh  167 (184)
                      ......+.+++....   .|-...-|..   |...-.|.+..   . - ....+++|||||+|||.|+-
T Consensus        83 ~~~~~~di~v~~~~~~~~~G~ggsAGFP~s~G~P~~~I~I~~~~~~~~~~~~hvi~HEiGH~IGfRHTD  151 (211)
T PF12388_consen   83 TNYQNADIIVYSNSSNNPSGAGGSAGFPTSNGNPYKFIQIYGLSNYSVNVIEHVITHEIGHCIGFRHTD  151 (211)
T ss_pred             CCcCCCceEEEeccCCCCCCcceeccCCCCCCCCCceEEEEecCCCchhHHHHHHHHHhhhhccccccC
Confidence            222123444543211   1111112222   11112333311   1 1 13569999999999999974


No 17 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=98.58  E-value=6.5e-07  Score=72.98  Aligned_cols=99  Identities=18%  Similarity=0.346  Sum_probs=59.4

Q ss_pred             CCCceEEEEcCCCCHHHHHHHHHHHHHhhcc------cceEEEEcCCCC---CCc-E--EEEecCCCCcccccCC-----
Q psy2976          71 DYGVIPYEIDSNFGGQHKALFKQAMRHWENF------TCVKFVERSSTE---HPN-Y--ILFTEKPCGCCSFVGK-----  133 (184)
Q Consensus        71 p~g~IpY~~~~~~~~~~r~~I~~A~~~we~~------TcV~F~e~~~~~---~~~-~--I~f~~~~~gC~S~vG~-----  133 (184)
                      |+..|.|+|++.++.+.++.|++|++.|++.      ..+.+++..+.+   ... |  |.+.....+-+++ |.     
T Consensus         6 pk~pItyyI~~~~p~~~r~aI~~A~~~Wn~~fe~~Gf~~a~~v~~~p~~~~~~Diry~~ir~~~~~~~~~~~-gps~~dP   84 (197)
T cd04276           6 PKEPIVYYLDNTFPEKYRDAIREGVLYWNKAFEKAGFKNAIIVKVLPDDADPGDIRYNVIRWIHSPNGGWAY-GPSVVDP   84 (197)
T ss_pred             CCCCEEEEecCCCcHHHHHHHHHHHHHHHHHHHhcCCCccEEEEeCCCCcCcccceEEEEEEEecCCCccee-cccccCC
Confidence            4568999999888888999999999999986      455455443321   111 2  4443322122211 21     


Q ss_pred             -CCC-CcceeecCCCC--------------chHHHHHHHHHHhhCCCCCCCCC
Q psy2976         134 -RGN-GQQAISIGKNC--------------DKFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       134 -~~~-g~q~isl~~~c--------------~~~g~i~HElgHALG~~HEh~Rp  170 (184)
                       .|. ..-.|.+..+-              ....+++||+||||||.|.....
T Consensus        85 rTGeIl~a~V~l~~~~~~~~~~~~~~~~~~~~~~~~~he~gh~lGl~hn~~~s  137 (197)
T cd04276          85 RTGEILKADVILYSGFLRQDQLWYEDLLAASLRYLLAHEVGHTLGLRHNFKAS  137 (197)
T ss_pred             CCCCeEEEEEEeCchhhccchhHHHHHHHHHHHHHHHHHHHHHhcCccccccc
Confidence             110 01244444321              12358999999999999976543


No 18 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=98.29  E-value=1.1e-06  Score=66.71  Aligned_cols=86  Identities=26%  Similarity=0.417  Sum_probs=49.8

Q ss_pred             ceEEEEcCCCCHHHHHHHHHHHHHhhc-ccceEEEEcCCCCCCcEEEEecCCCCcccccCCCCCCcceeecCC----CCc
Q psy2976          74 VIPYEIDSNFGGQHKALFKQAMRHWEN-FTCVKFVERSSTEHPNYILFTEKPCGCCSFVGKRGNGQQAISIGK----NCD  148 (184)
Q Consensus        74 ~IpY~~~~~~~~~~r~~I~~A~~~we~-~TcV~F~e~~~~~~~~~I~f~~~~~gC~S~vG~~~~g~q~isl~~----~c~  148 (184)
                      +|+|.-..  -++.+..|.+|.+.|+. +++|+|++....   + +.+......-+|+-...+.|...|-|+.    +-.
T Consensus         3 tv~Ydas~--A~~f~~~i~~aa~iWN~sV~NV~L~~~s~a---~-~~~~~~~~~~~sya~~~g~G~G~I~l~~~~~qgy~   76 (132)
T PF02031_consen    3 TVYYDASR--APEFRSAIAQAAQIWNSSVSNVRLVEGSSA---D-IRYYEGNDPRGSYASTDGLGSGYIFLDYQQNQGYN   76 (132)
T ss_dssp             EEEEEEEE---GGGHHHHHHHHHHHHHH-SSEEEEE-SS----S-EEEEEE--TT--EEEE-SSS-EEEEEEHHHHHHS-
T ss_pred             EEEEeCCC--CchhHHHHHHHHHHHhcccCceEEeecCCC---c-EEEEEecCCCCcccccCCCCcEEEEechHHhhCCc
Confidence            45565442  34567789999999997 689999998773   3 2232112334555555554556777764    234


Q ss_pred             hHHHHHHHHHHhhCCCC
Q psy2976         149 KFGIVVHELGHVVGFWH  165 (184)
Q Consensus       149 ~~g~i~HElgHALG~~H  165 (184)
                      ...+++|||||.|||.-
T Consensus        77 ~~RIaaHE~GHiLGLPD   93 (132)
T PF02031_consen   77 STRIAAHELGHILGLPD   93 (132)
T ss_dssp             HHHHHHHHHHHHHT---
T ss_pred             cceeeeehhccccCCCC
Confidence            56799999999999963


No 19 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=97.30  E-value=0.00038  Score=57.09  Aligned_cols=82  Identities=23%  Similarity=0.389  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEec-CCCC-cccccCCCCC------------C----c--ceeecCC
Q psy2976          86 QHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFTE-KPCG-CCSFVGKRGN------------G----Q--QAISIGK  145 (184)
Q Consensus        86 ~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~-~~~g-C~S~vG~~~~------------g----~--q~isl~~  145 (184)
                      ..++.+.+|++.|++.-++..++...+  .+ |++.. ...| .|...|+...            |    .  -.|.+.+
T Consensus       104 ~wq~a~~tava~wa~~fpl~ive~~ee--aD-Itie~~n~pgtg~~~~grArtal~~~efl~~~~~~~~lnhr~~i~~~p  180 (236)
T COG5549         104 RWQGAYLTAVAGWAKTFPLIIVERFEE--AD-ITIEVGNPPGTGWRQYGRARTALIAYEFLGHALGLGHLNHRGDIMYPP  180 (236)
T ss_pred             hHHHHHHHHHHHHHHhCCceeeeccee--ee-EEEEecCCCCCcccccchHHHHHHHHHHhhhccCcccccccccccCCc
Confidence            457889999999999877766776663  34 44432 1222 2222222110            0    0  1223333


Q ss_pred             CC---chHHHHHHHHHHhhCCC-CCCCCC
Q psy2976         146 NC---DKFGIVVHELGHVVGFW-HEHTRP  170 (184)
Q Consensus       146 ~c---~~~g~i~HElgHALG~~-HEh~Rp  170 (184)
                      +-   ...+++-||+|||||++ |.---.
T Consensus       181 g~~~e~L~~tarhElGhaLgi~ghsd~ks  209 (236)
T COG5549         181 GELRENLNPTARHELGHALGIWGHSDLKS  209 (236)
T ss_pred             ccchhhhhHHHHHhhcchheecccccchh
Confidence            31   24689999999999999 865433


No 20 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=96.74  E-value=0.0008  Score=54.98  Aligned_cols=20  Identities=30%  Similarity=0.713  Sum_probs=17.7

Q ss_pred             hHHHHHHHHHHhhCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~  168 (184)
                      ...+++|||||+||+.|+..
T Consensus       137 ~~~~~aHEiGH~lGl~H~~~  156 (206)
T PF13583_consen  137 GYQTFAHEIGHNLGLRHDFD  156 (206)
T ss_pred             cchHHHHHHHHHhcCCCCcc
Confidence            34679999999999999986


No 21 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=96.74  E-value=0.00073  Score=49.99  Aligned_cols=18  Identities=33%  Similarity=0.685  Sum_probs=12.7

Q ss_pred             hHHHHHHHHHHhhCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHE  166 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HE  166 (184)
                      ...+++|||||.||+.|.
T Consensus       107 ~~~~~~HEiGH~lGl~Hd  124 (124)
T PF13582_consen  107 GVDTFAHEIGHNLGLNHD  124 (124)
T ss_dssp             STTHHHHHHHHHTT----
T ss_pred             cceEeeehhhHhcCCCCC
Confidence            458999999999999994


No 22 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=96.56  E-value=0.0016  Score=51.96  Aligned_cols=21  Identities=33%  Similarity=0.417  Sum_probs=18.2

Q ss_pred             hHHHHHHHHHHhhCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTR  169 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~R  169 (184)
                      ...+++||+||.||+.|....
T Consensus       133 ~~~~~aHElGH~lG~~HD~~~  153 (192)
T cd04267         133 TALTMAHELGHNLGAEHDGGD  153 (192)
T ss_pred             ehhhhhhhHHhhcCCcCCCCC
Confidence            356999999999999999863


No 23 
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=96.47  E-value=0.0016  Score=51.02  Aligned_cols=21  Identities=29%  Similarity=0.523  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHhhCCCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~Rp  170 (184)
                      ..+++||+||-|||.|..+-.
T Consensus        70 g~TltHEvGH~LGL~HtF~~~   90 (154)
T PF05572_consen   70 GKTLTHEVGHWLGLYHTFGGG   90 (154)
T ss_dssp             SHHHHHHHHHHTT---TT---
T ss_pred             ccchhhhhhhhhcccccccCC
Confidence            579999999999999998654


No 24 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=96.19  E-value=0.0028  Score=50.58  Aligned_cols=23  Identities=26%  Similarity=0.345  Sum_probs=15.1

Q ss_pred             chHHHHHHHHHHhhCCCCCCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~HEh~Rp  170 (184)
                      ....+++|||||.||..|.+.-+
T Consensus       141 ~~~~~~AHEiGH~lGa~HD~~~~  163 (196)
T PF13688_consen  141 NGAITFAHEIGHNLGAPHDGDYS  163 (196)
T ss_dssp             HHHHHHHHHHHHHTT-----SSS
T ss_pred             ceehhhHHhHHHhcCCCCCCCCC
Confidence            34679999999999999988864


No 25 
>PF05548 Peptidase_M11:  Gametolysin peptidase M11;  InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M11 (gametolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The type example is gametolysin from the unicellular biflagellated alga, Chlamydomonas reinhardtii Gametolysin is a zinc-containing metallo-protease, which is responsible for the degradation of the cell wall. Homologues of gametolysin have also been reported in the simple multicellular organism, Volvox [, ].
Probab=96.07  E-value=0.02  Score=49.92  Aligned_cols=81  Identities=22%  Similarity=0.352  Sum_probs=44.7

Q ss_pred             CCCHHHHHHHHHHHHHhhccc-ce-EEEEcCCCCCCcEEEEecCCCCc-ccccCCCCCCcce-eec-CCCCchHHHHHHH
Q psy2976          82 NFGGQHKALFKQAMRHWENFT-CV-KFVERSSTEHPNYILFTEKPCGC-CSFVGKRGNGQQA-ISI-GKNCDKFGIVVHE  156 (184)
Q Consensus        82 ~~~~~~r~~I~~A~~~we~~T-cV-~F~e~~~~~~~~~I~f~~~~~gC-~S~vG~~~~g~q~-isl-~~~c~~~g~i~HE  156 (184)
                      ..+....-.+..+.+.+.+.. -+ .|   ..  ....|.+...+..| |.-+|..+ |.+. +.. +.++...++++||
T Consensus        84 ~C~~~d~~~~~~~Ad~~a~~~lG~~~~---s~--y~h~vyvlP~~~~C~w~Gla~v~-G~~~~~~~~~~~~~~~~~~~HE  157 (314)
T PF05548_consen   84 SCSTDDWYGWADAADAAARAQLGVNAF---SS--YTHRVYVLPPGFACGWAGLATVP-GSQSWLWISGYGVQDWATIMHE  157 (314)
T ss_pred             ccchHHHHHHHHHHHHHHHhhcCcccc---cc--cceEEEEcCCCCCCCceEEeecC-CcceeeeecCcccccHHHHHHH
Confidence            333233334566666666554 33 12   11  23345554443346 33333333 4442 222 3356778999999


Q ss_pred             HHHhhCCCCCCC
Q psy2976         157 LGHVVGFWHEHT  168 (184)
Q Consensus       157 lgHALG~~HEh~  168 (184)
                      +||-|||.|...
T Consensus       158 lgHN~GL~Ha~~  169 (314)
T PF05548_consen  158 LGHNLGLWHAGR  169 (314)
T ss_pred             hhhhccccccCC
Confidence            999999999974


No 26 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=96.02  E-value=0.0042  Score=49.32  Aligned_cols=21  Identities=33%  Similarity=0.545  Sum_probs=15.7

Q ss_pred             hHHHHHHHHHHhhCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTR  169 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~R  169 (184)
                      ...+++|||||.||..|...-
T Consensus       111 ~~~~~aHElGH~lGa~Hd~~~  131 (173)
T PF13574_consen  111 GIDTFAHELGHQLGAPHDFDN  131 (173)
T ss_dssp             HHHHHHHHHHHHHT---SSSS
T ss_pred             eeeeehhhhHhhcCCCCCCCC
Confidence            467899999999999999874


No 27 
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=95.85  E-value=0.0072  Score=49.52  Aligned_cols=21  Identities=29%  Similarity=0.428  Sum_probs=18.1

Q ss_pred             hHHHHHHHHHHhhCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTR  169 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~R  169 (184)
                      ...+++|||||.||+.|....
T Consensus       145 ~~~~~AHElGH~lG~~HD~~~  165 (220)
T cd04272         145 GVYTMTHELAHLLGAPHDGSP  165 (220)
T ss_pred             cHHHHHHHHHHHhCCCCCCCC
Confidence            367999999999999998654


No 28 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=95.73  E-value=0.006  Score=48.75  Aligned_cols=19  Identities=37%  Similarity=0.583  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      ..+++|||||.||+.|...
T Consensus       132 a~~~AHElGH~lG~~HD~~  150 (194)
T cd04269         132 AVTMAHELGHNLGMEHDDG  150 (194)
T ss_pred             HHHHHHHHHhhcCCCcCCC
Confidence            5799999999999999764


No 29 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=95.29  E-value=0.0094  Score=49.90  Aligned_cols=19  Identities=37%  Similarity=0.436  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      ..+++|||||.||+.|--.
T Consensus       168 a~t~AHElGHnlGm~HD~~  186 (244)
T cd04270         168 DLVTAHELGHNFGSPHDPD  186 (244)
T ss_pred             HHHHHHHHHHhcCCCCCCC
Confidence            4789999999999999554


No 30 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=95.26  E-value=0.0018  Score=53.84  Aligned_cols=22  Identities=27%  Similarity=0.477  Sum_probs=19.0

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~Rp  170 (184)
                      ...+++||+||.|||+|..+--
T Consensus       137 ~g~t~~HEvGH~lGL~HtF~~~  158 (225)
T cd04275         137 LGDTATHEVGHWLGLYHTFQGG  158 (225)
T ss_pred             ccceeEEeccceeeeeeeecCC
Confidence            3469999999999999999764


No 31 
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=95.19  E-value=0.0073  Score=50.17  Aligned_cols=18  Identities=39%  Similarity=0.722  Sum_probs=15.9

Q ss_pred             HHHHHHHHHhhCCCCCCC
Q psy2976         151 GIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       151 g~i~HElgHALG~~HEh~  168 (184)
                      .+++|||||.||+.|--.
T Consensus       147 ~t~AHElGHnLGm~HD~~  164 (228)
T cd04271         147 QVFAHEIGHTFGAVHDCT  164 (228)
T ss_pred             eehhhhhhhhcCCCCCCC
Confidence            589999999999999754


No 32 
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=95.13  E-value=0.006  Score=49.54  Aligned_cols=20  Identities=40%  Similarity=0.619  Sum_probs=17.6

Q ss_pred             hHHHHHHHHHHhhCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~  168 (184)
                      ...+++|||||.||+.|...
T Consensus       140 ~a~~~aHElGH~LG~~HD~~  159 (207)
T cd04273         140 SAFTIAHELGHVLGMPHDGD  159 (207)
T ss_pred             eEEeeeeechhhcCCCCCCC
Confidence            34689999999999999986


No 33 
>COG1913 Predicted Zn-dependent proteases [General function prediction only]
Probab=95.09  E-value=0.01  Score=47.54  Aligned_cols=20  Identities=40%  Similarity=0.635  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHhhCCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHTR  169 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~R  169 (184)
                      +--++||+||.|||.|=-++
T Consensus       125 ~KEv~HElGH~~GL~HC~N~  144 (181)
T COG1913         125 VKEVLHELGHLLGLSHCPNP  144 (181)
T ss_pred             HHHHHHHhhhhcCcccCCCC
Confidence            45699999999999997654


No 34 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=95.06  E-value=0.021  Score=45.88  Aligned_cols=19  Identities=42%  Similarity=0.665  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      ..+++|||||.||+.|...
T Consensus       132 a~~~AHelGH~lGm~HD~~  150 (199)
T PF01421_consen  132 AVIIAHELGHNLGMPHDGD  150 (199)
T ss_dssp             HHHHHHHHHHHTT---TTT
T ss_pred             HHHHHHHHHHhcCCCCCCC
Confidence            4688999999999999988


No 35 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=94.71  E-value=0.017  Score=46.40  Aligned_cols=16  Identities=50%  Similarity=0.727  Sum_probs=14.1

Q ss_pred             HHHHHHHHHhhCCCCC
Q psy2976         151 GIVVHELGHVVGFWHE  166 (184)
Q Consensus       151 g~i~HElgHALG~~HE  166 (184)
                      ..++||+||.|||.|=
T Consensus       127 k~~~HElGH~lGL~HC  142 (179)
T PRK13267        127 KEVTHELGHTLGLEHC  142 (179)
T ss_pred             HHHHHHHHHHcCCccC
Confidence            4589999999999993


No 36 
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=94.44  E-value=0.021  Score=46.58  Aligned_cols=19  Identities=42%  Similarity=0.602  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      .-.++||+||++||.|=..
T Consensus       146 ~Kea~HElGH~~GL~HC~~  164 (194)
T PF07998_consen  146 CKEAVHELGHLFGLDHCEN  164 (194)
T ss_dssp             HHHHHHHHHHHTT----SS
T ss_pred             HHHHHHHHHHHcCCcCCCC
Confidence            4689999999999999543


No 37 
>PF11350 DUF3152:  Protein of unknown function (DUF3152);  InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function. Some are annotated as membrane proteins, however this cannot be confirmed.
Probab=94.29  E-value=0.02  Score=46.87  Aligned_cols=95  Identities=21%  Similarity=0.385  Sum_probs=54.6

Q ss_pred             CceEEEEc--CCCC-------HHHHHHHHHHH---HHhhcccceEEEEcCCCCCCc-EEEEecC---CCCcc-ccc-CC-
Q psy2976          73 GVIPYEID--SNFG-------GQHKALFKQAM---RHWENFTCVKFVERSSTEHPN-YILFTEK---PCGCC-SFV-GK-  133 (184)
Q Consensus        73 g~IpY~~~--~~~~-------~~~r~~I~~A~---~~we~~TcV~F~e~~~~~~~~-~I~f~~~---~~gC~-S~v-G~-  133 (184)
                      ..+.|++.  .++.       .+.-..|.+.+   +-|....-++|+.+.... .+ .|.+...   ..-|. ..+ |. 
T Consensus        29 ~~~rY~VeVE~Gi~~~~~gg~~~fA~~V~~tL~DpRgW~~~g~~~F~rV~~~~-~Df~I~Lasp~T~~~lC~g~~~~~e~  107 (203)
T PF11350_consen   29 RLYRYRVEVEDGIDVDAYGGDDAFAAMVDATLADPRGWTADGRVRFQRVDSGA-PDFRISLASPGTTDRLCAGLDTSGET  107 (203)
T ss_pred             ceEEEEEEEccCcCCcccccHHHHHHHHHHHhcCCCCCCcCCCEEEEECCCCC-CCEEEEECCcchhhhhccCcCcCcee
Confidence            37888875  3332       23344555555   378888889999998863 45 3666532   23461 111 11 


Q ss_pred             ---CC-CCcceeecCCC------------CchHHHHHHHHHHhhCCCCCCC
Q psy2976         134 ---RG-NGQQAISIGKN------------CDKFGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       134 ---~~-~g~q~isl~~~------------c~~~g~i~HElgHALG~~HEh~  168 (184)
                         .. .+.=.||+.++            -...-+|.||.||+||..||-.
T Consensus       108 SC~~~~g~~VvIN~~RWv~Ga~~f~gdl~~YRqYvINHEVGH~LGh~H~~C  158 (203)
T PF11350_consen  108 SCRNPAGGRVVINLARWVRGAPAFGGDLASYRQYVINHEVGHALGHGHEPC  158 (203)
T ss_pred             EeecCCCCeEEEehHHhhccCcccCCcHHHHHHHhhhhhhhhhcccCCCcC
Confidence               00 12223455432            1134689999999999988853


No 38 
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than Pfam model pfam05547.
Probab=93.48  E-value=0.017  Score=49.53  Aligned_cols=21  Identities=33%  Similarity=0.569  Sum_probs=18.1

Q ss_pred             hHHHHHHHHHHhhCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTR  169 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~R  169 (184)
                      ..|+++||+||+|||.+.-..
T Consensus       165 ~igv~~HE~gH~lGLPDlY~~  185 (286)
T TIGR03296       165 GVGVIAHELGHDLGLPDLYDT  185 (286)
T ss_pred             ceeeeehhhhcccCCCccccC
Confidence            479999999999999887654


No 39 
>PF12044 Metallopep:  Putative peptidase family;  InterPro: IPR021917  This family of proteins is functionally uncharacterised. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 625 to 773 amino acids in length. 
Probab=93.08  E-value=0.063  Score=48.65  Aligned_cols=30  Identities=23%  Similarity=0.398  Sum_probs=21.6

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCCCCCCceEe
Q psy2976         149 KFGIVVHELGHVVGFWHEHTRPDRDNHVQI  178 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~RpDRD~yV~I  178 (184)
                      ..|.++||+||+||+.|.-+=-=-.+|+.+
T Consensus       316 ~iGA~lHEiGH~fg~pH~~~GIM~Rdy~~~  345 (423)
T PF12044_consen  316 GIGAFLHEIGHLFGCPHQEDGIMLRDYDRL  345 (423)
T ss_pred             hhHHHHHHHHHhcCCCCCCCCeeeCCchhh
Confidence            468899999999999998653333335444


No 40 
>PF10462 Peptidase_M66:  Peptidase M66;  InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of metallopeptidases belonging to MEROPS peptidase family M66 (StcE peptidase, clan MA). The StcE peptidase is a virulence factor found in Shiga toxigenic Escherichia coli strains. StcE peptidase cleaves C1 esterase inhibitor []. The SwissProt proteins in this entry have been name "Dictomallein". ; GO: 0004222 metalloendopeptidase activity; PDB: 3UJZ_A.
Probab=92.68  E-value=0.063  Score=46.65  Aligned_cols=17  Identities=41%  Similarity=0.475  Sum_probs=13.6

Q ss_pred             hHHHHHHHHHHhhCCCC
Q psy2976         149 KFGIVVHELGHVVGFWH  165 (184)
Q Consensus       149 ~~g~i~HElgHALG~~H  165 (184)
                      ..++.+||+||++||.|
T Consensus       193 ~~~~f~HE~GH~~GL~H  209 (305)
T PF10462_consen  193 YGNEFSHELGHNFGLGH  209 (305)
T ss_dssp             SHHHHHHHHHHTTT--S
T ss_pred             ccceeehhhhhhcCCCC
Confidence            46799999999999999


No 41 
>PF01457 Peptidase_M8:  Leishmanolysin This Prosite motif covers only the active site. This is family M8 in the peptidase classification. ;  InterPro: IPR001577 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M8 (leishmanolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.   Leishmanolysin is an enzyme found in the eukaryotes including Leishmania and related parasitic protozoa []. The endopeptidase is the most abundant protein on the cell surface during the promastigote stage of the parasite, and is attached to the membrane by a glycosylphosphatidylinositol anchor []. In the amastigote form, the parasite lives in lysosomes of host macrophages, producing a form of the protease that has an acidic pH optimum []. This differs from most other metalloproteases and may be an adaptation to the environment in which the organism survives [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0007155 cell adhesion, 0016020 membrane; PDB: 1LML_A.
Probab=92.43  E-value=0.074  Score=49.29  Aligned_cols=17  Identities=41%  Similarity=0.774  Sum_probs=14.0

Q ss_pred             hHHHHHHHHHHhhCCCC
Q psy2976         149 KFGIVVHELGHVVGFWH  165 (184)
Q Consensus       149 ~~g~i~HElgHALG~~H  165 (184)
                      .+.+++|||+|||||.-
T Consensus       210 ~~~~~~HEi~HaLGFs~  226 (521)
T PF01457_consen  210 FFRTVIHEIAHALGFSS  226 (521)
T ss_dssp             HHHHHHHHHHHHTT-SH
T ss_pred             ccceeeeeeeeeeeecc
Confidence            46799999999999965


No 42 
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=91.72  E-value=0.44  Score=42.14  Aligned_cols=21  Identities=29%  Similarity=0.423  Sum_probs=15.6

Q ss_pred             ecCCCCchHHHHHHHHHHhhC
Q psy2976         142 SIGKNCDKFGIVVHELGHVVG  162 (184)
Q Consensus       142 sl~~~c~~~g~i~HElgHALG  162 (184)
                      ++......+-+++||+|||+=
T Consensus       215 n~~~~~~~v~tl~HE~GHa~h  235 (427)
T cd06459         215 NFNGTLDDVFTLAHELGHAFH  235 (427)
T ss_pred             cCCCChhhHHHHHHHhhHHHH
Confidence            334445668899999999973


No 43 
>PTZ00337 surface protease GP63; Provisional
Probab=91.50  E-value=0.11  Score=48.84  Aligned_cols=18  Identities=39%  Similarity=0.791  Sum_probs=15.3

Q ss_pred             chHHHHHHHHHHhhCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWH  165 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~H  165 (184)
                      ..+.+++|||+|||||.-
T Consensus       228 ~~~~v~~HEi~HALGFs~  245 (567)
T PTZ00337        228 GDVRVAAHELGHALGFVR  245 (567)
T ss_pred             HHHHHHHHHHHHHHccCH
Confidence            357899999999999943


No 44 
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=91.45  E-value=0.45  Score=44.48  Aligned_cols=22  Identities=23%  Similarity=0.277  Sum_probs=15.8

Q ss_pred             ecCCCCchHHHHHHHHHHhhCC
Q psy2976         142 SIGKNCDKFGIVVHELGHVVGF  163 (184)
Q Consensus       142 sl~~~c~~~g~i~HElgHALG~  163 (184)
                      |....-..+.|++||||||+=.
T Consensus       371 N~~~~~~dv~TLaHElGHa~H~  392 (591)
T TIGR00181       371 NWDGTLNSVFTLAHELGHSMHS  392 (591)
T ss_pred             ecCCCcchHHHHHHHhhhHHHH
Confidence            3333345688999999999843


No 45 
>cd02641 R3H_Smubp-2_like R3H domain of Smubp-2_like proteins.  Smubp-2_like proteins also contain a helicase_like and an AN1-like Zinc finger domain and have been shown to bind single-stranded DNA. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA.
Probab=91.11  E-value=0.35  Score=31.91  Aligned_cols=41  Identities=22%  Similarity=0.340  Sum_probs=33.2

Q ss_pred             ceeecCC-CCchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         139 QAISIGK-NCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       139 q~isl~~-~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      ..+.+.+ =+.....++|++.+.+||.|+..-..-+.||.|.
T Consensus        18 ~~l~F~p~ls~~eR~~vH~lA~~~gL~s~S~G~g~~R~v~v~   59 (60)
T cd02641          18 TELEFPPTLSSHDRLLVHELAEELGLRHESTGEGSDRVITVS   59 (60)
T ss_pred             CcEECCCCCCHHHHHHHHHHHHHcCCceEeeCCCCceEEEee
Confidence            4556665 2455689999999999999999988888898874


No 46 
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M3 family of metallopeptidases contains several distinct clades. Oligoendopeptidase F as characterized in Lactococcus, the functionally equivalent oligoendopeptidase B of group B Streptococcus, and closely related sequences are described by TIGR00181. The present family is quite similar but forms a distinct clade, and a number of species have one member of each. A greater sequence difference separates members of TIGR02289, probable oligoendopeptidases of the M3 family that probably should not be designated PepF.
Probab=90.72  E-value=0.57  Score=43.87  Aligned_cols=22  Identities=23%  Similarity=0.318  Sum_probs=15.9

Q ss_pred             ecCCCCchHHHHHHHHHHhhCC
Q psy2976         142 SIGKNCDKFGIVVHELGHVVGF  163 (184)
Q Consensus       142 sl~~~c~~~g~i~HElgHALG~  163 (184)
                      ++......+.|++||+|||+=.
T Consensus       368 N~~~~~~~v~TL~HE~GHa~H~  389 (587)
T TIGR02290       368 NYDGSRRDVSTLAHELGHAYHS  389 (587)
T ss_pred             ecCCCchhHHHHHHHhhHHHHH
Confidence            3333345678999999999943


No 47 
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional
Probab=90.33  E-value=0.16  Score=47.99  Aligned_cols=18  Identities=33%  Similarity=0.551  Sum_probs=15.3

Q ss_pred             chHHHHHHHHHHhhCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWH  165 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~H  165 (184)
                      ..+.+++|||.|||||.-
T Consensus       255 ~~~rv~~HEi~HALGFS~  272 (622)
T PTZ00257        255 GTTRTVTHEVAHALGFSS  272 (622)
T ss_pred             HHHHHHHHHHHHHhcCCH
Confidence            357899999999999943


No 48 
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=88.86  E-value=0.84  Score=42.44  Aligned_cols=17  Identities=24%  Similarity=0.522  Sum_probs=13.8

Q ss_pred             CchHHHHHHHHHHhhCC
Q psy2976         147 CDKFGIVVHELGHVVGF  163 (184)
Q Consensus       147 c~~~g~i~HElgHALG~  163 (184)
                      -..+.|++||+|||+=.
T Consensus       335 ~~dv~TL~HElGHa~H~  351 (549)
T TIGR02289       335 SGDIDVLTHEAGHAFHV  351 (549)
T ss_pred             hhHHHHHHHHhhHHHHH
Confidence            45678999999999843


No 49 
>KOG4525|consensus
Probab=88.58  E-value=0.27  Score=44.80  Aligned_cols=20  Identities=45%  Similarity=0.792  Sum_probs=17.4

Q ss_pred             hHHHHHHHHHHhhCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~  168 (184)
                      ..|.+.|||||+||..|.-.
T Consensus       301 tlGA~~HElGH~lgcpHq~~  320 (614)
T KOG4525|consen  301 TLGAVCHELGHCLGCPHQSE  320 (614)
T ss_pred             HHHHHHHHhhhccCCCCCCC
Confidence            46899999999999999753


No 50 
>PF12725 DUF3810:  Protein of unknown function (DUF3810);  InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 333 and 377 amino acids in length and contain a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterised family of peptidase enzymes.
Probab=87.87  E-value=0.35  Score=42.17  Aligned_cols=21  Identities=33%  Similarity=0.407  Sum_probs=18.4

Q ss_pred             CchHHHHHHHHHHhhCCCCCC
Q psy2976         147 CDKFGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       147 c~~~g~i~HElgHALG~~HEh  167 (184)
                      .....|++||++|-+||..|.
T Consensus       194 ~~~P~T~~HElAHq~G~a~E~  214 (318)
T PF12725_consen  194 YSLPFTICHELAHQLGFASED  214 (318)
T ss_pred             ccccHHHHHHHHHHhCCCCHH
Confidence            456789999999999999884


No 51 
>PF05547 Peptidase_M6:  Immune inhibitor A peptidase M6;  InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M6 (immune inhibitor A family, clan MA(M)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.  InhA of Bacillus thuringiensis (an entomopathogenic bacterium) specifically cleaves antibacterial peptides produced by insect hosts []. B. thuringiensis is highly resistant to the insect immune system due to its production of two factors, inhibitor A (InhA or InA) and inhibitor B (InhB or InB), which selectively block the humoral defence system developed by insects against Escherichia coli and Bacillus cereus []. B. thuringiensis is especially resistant to cecropins and attacins, which are the main classes of inducible antibacterial peptides in various lepidopterans and dipterans [], []. InhA has been shown to specifically hydrolyze cecropins and attacins in the immune hemolymph of Hyalophora cecropia (Cecropia moth) in vitro []. However, it has been suggested that the role of InhA in resistance to the humoral defence system is not consistent with the time course of InhA production []. B. thuringiensis has two proteins belonging to this group (InhA and InhA2), and it has been shown that InhA2 has a vital role in virulence when the host is infected via the oral route []. The B. cereus member has been found as an exosporium component from endospores []. B. thuringiensis InhA is induced at the onset of sporulation and is regulated by Spo0A and AbrB []. Vibrio cholerae PrtV is thought to be encoded in the pathogenicity island []. However, PrtV mutants did not exhibit a reduced virulence phenotype, and thus PrtV is not an indispensable virulence factor []. Annotation note: due to the presence of PKD repeats in some of the members of this group (e.g., V. cholerae VCA0223), spurious similarity hits may appear (involving unrelated proteins), which may lead to the erroneous transfer of functional annotations and protein names. Also, please note that related Bacillus subtilis Bacillopeptidase F (Bpr or Bpf) contains two different protease domains: N-terminal IPR000209 from INTERPRO (peptidase S8, subtilase, a subtilisin-like serine protease) and this C-terminal domain (peptidase M6), which may also complicate annotation.; GO: 0008233 peptidase activity, 0006508 proteolysis
Probab=87.12  E-value=0.074  Score=50.58  Aligned_cols=19  Identities=32%  Similarity=0.560  Sum_probs=16.2

Q ss_pred             hHHHHHHHHHHhhCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh  167 (184)
                      ..|+++|||||.|||.-+=
T Consensus       221 giGVfaHEfGH~LGLPDlY  239 (645)
T PF05547_consen  221 GIGVFAHEFGHDLGLPDLY  239 (645)
T ss_pred             ceEEEEeeccccCCCCCcc
Confidence            4799999999999997543


No 52 
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=86.33  E-value=1.4  Score=29.05  Aligned_cols=42  Identities=10%  Similarity=0.211  Sum_probs=33.4

Q ss_pred             cceeecCCC-CchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         138 QQAISIGKN-CDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       138 ~q~isl~~~-c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      .+.+.++++ ......++|++.+.+||.|+..=...+.||+|.
T Consensus        16 ~~~l~Fpp~ls~~eR~~vH~~a~~~gL~s~S~G~g~~R~v~v~   58 (59)
T cd06007          16 NEEYEFPSSLTNHERAVIHRLCRKLGLKSKSKGKGSNRRLSVY   58 (59)
T ss_pred             ccEEEcCCCCCHHHHHHHHHHHHHcCCCceeecCCCCeEEEEe
Confidence            456666664 445689999999999999998888888888774


No 53 
>KOG3607|consensus
Probab=85.89  E-value=0.45  Score=45.92  Aligned_cols=19  Identities=37%  Similarity=0.656  Sum_probs=16.9

Q ss_pred             hHHHHHHHHHHhhCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh  167 (184)
                      ...+++|||||.||+.|.-
T Consensus       323 ~a~v~AhelgH~lGm~hD~  341 (716)
T KOG3607|consen  323 FAVVLAHELGHNLGMIHDE  341 (716)
T ss_pred             HHHHHHHHHHhhcCccccc
Confidence            3579999999999999986


No 54 
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF). NRF is a nuclear inhibitor of NF-kappaB proteins that can silence the IFNbeta promoter via binding to a negative regulatory element (NRE). Beside R3H NRF also contains a G-patch domain. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=85.42  E-value=1.4  Score=29.14  Aligned_cols=42  Identities=10%  Similarity=0.170  Sum_probs=34.3

Q ss_pred             cceeecCCC-CchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         138 QQAISIGKN-CDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       138 ~q~isl~~~-c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      .+.+.+.+. ......++|++.+.+||.|...=...+.||.|.
T Consensus        17 ~~~l~f~p~lt~~eR~~vH~~a~~~gL~s~S~G~g~~R~v~v~   59 (60)
T cd02640          17 IRDMVFSPEFSKEERALIHQIAQKYGLKSRSYGSGNDRYLVIS   59 (60)
T ss_pred             cceEEcCCCCCHHHHHHHHHHHHHcCCceeeEeCCCCeEEEEe
Confidence            466777764 345689999999999999998888888888874


No 55 
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=82.66  E-value=0.86  Score=38.83  Aligned_cols=14  Identities=50%  Similarity=0.767  Sum_probs=11.9

Q ss_pred             hHHHHHHHHHHhhC
Q psy2976         149 KFGIVVHELGHVVG  162 (184)
Q Consensus       149 ~~g~i~HElgHALG  162 (184)
                      ...+++|||||++|
T Consensus       216 ~~~v~vHE~GHsf~  229 (264)
T PF09471_consen  216 FKQVVVHEFGHSFG  229 (264)
T ss_dssp             HHHHHHHHHHHHTT
T ss_pred             ccceeeeecccccc
Confidence            45799999999876


No 56 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=80.33  E-value=1.8  Score=36.09  Aligned_cols=26  Identities=15%  Similarity=0.502  Sum_probs=18.6

Q ss_pred             CcceeecCCC------CchHHHHHHHHHHhhC
Q psy2976         137 GQQAISIGKN------CDKFGIVVHELGHVVG  162 (184)
Q Consensus       137 g~q~isl~~~------c~~~g~i~HElgHALG  162 (184)
                      ....+.|+..      ....++++||.|||+-
T Consensus        71 ~~k~vrLS~~vy~~~SiaAvaVAAHEvGHAiQ  102 (222)
T PF04298_consen   71 RNKVVRLSEDVYNGRSIAAVAVAAHEVGHAIQ  102 (222)
T ss_pred             CCCEEEeCCccCCCCCHHHHHHHHHHHhHHHh
Confidence            3456777653      2347899999999984


No 57 
>cd02642 R3H_encore_like R3H domain of encore-like and DIP1-like proteins. Drosophila encore is involved in the germline exit after four mitotic divisions, by facilitating SCF-ubiquitin-proteasome-dependent proteolysis. Maize DBF1-interactor protein 1 (DIP1) containing an R3H domain is a potential regulator of DBF1 activity in stress responses. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=80.05  E-value=3.4  Score=27.25  Aligned_cols=41  Identities=12%  Similarity=0.258  Sum_probs=32.3

Q ss_pred             ceeecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEeec
Q psy2976         139 QAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQIIR  180 (184)
Q Consensus       139 q~isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~~  180 (184)
                      +.+.+.+-......++|++....||.|+.+... +.+|.|..
T Consensus        22 ~~~~f~pm~sy~RllvH~la~~~gL~s~s~~~~-~r~vvv~k   62 (63)
T cd02642          22 QSLELPPMNSYYRLLAHRVAQYYGLDHNVDNSG-GKCVIVNK   62 (63)
T ss_pred             CeeEcCCCCcHHHHHHHHHHHHhCCeeEeecCC-ceEEEEEe
Confidence            344554434456899999999999999999998 88888753


No 58 
>TIGR00043 metalloprotein, YbeY/UPF0054 family. This minimally protein family is represented by a single member sequence only in nearly every bacterium. Crystallography demonstrates metal-binding activity, possibly to nickel. It is a predicted to be a metallohydrolase, and somewhat more weakly to be a metalloproteinase.
Probab=79.16  E-value=1.4  Score=32.50  Aligned_cols=19  Identities=37%  Similarity=0.573  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      .-.++|=++|.|||.|+..
T Consensus        74 ~~l~iHG~LHLlGyDH~~~   92 (110)
T TIGR00043        74 AHLTVHGLLHLLGYDHETE   92 (110)
T ss_pred             HHHHHHHHHHHcCCCCCCh
Confidence            4579999999999999853


No 59 
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=78.98  E-value=5.7  Score=31.52  Aligned_cols=18  Identities=39%  Similarity=0.263  Sum_probs=15.7

Q ss_pred             hHHHHHHHHHHhhCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHE  166 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HE  166 (184)
                      ...+|+|||.|..-..|.
T Consensus       164 idYVvvHEL~Hl~~~nHs  181 (205)
T PF01863_consen  164 IDYVVVHELCHLRHPNHS  181 (205)
T ss_pred             HHHHHHHHHHHhccCCCC
Confidence            357999999999998886


No 60 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=78.73  E-value=1.1  Score=37.08  Aligned_cols=12  Identities=42%  Similarity=0.584  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHhh
Q psy2976         150 FGIVVHELGHVV  161 (184)
Q Consensus       150 ~g~i~HElgHAL  161 (184)
                      .=+++|||||+|
T Consensus        73 rFtlAHELGH~l   84 (213)
T COG2856          73 RFTLAHELGHAL   84 (213)
T ss_pred             HHHHHHHHhHHH
Confidence            459999999997


No 61 
>cd02646 R3H_G-patch R3H domain of a group of fungal and plant proteins with unknown function, who also contain a G-patch domain. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the R3H domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=78.52  E-value=4.8  Score=26.08  Aligned_cols=41  Identities=10%  Similarity=0.127  Sum_probs=32.1

Q ss_pred             ceeecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         139 QAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       139 q~isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      +.+.+.+=....-.++|+|..++||.++..-...+.||.|.
T Consensus        17 ~~~~fppm~~~~R~~vH~lA~~~~L~S~S~G~g~~R~v~v~   57 (58)
T cd02646          17 DSLSFPPMDKHGRKTIHKLANCYNLKSKSRGKGKKRFVTVT   57 (58)
T ss_pred             ceEecCCCCHHHHHHHHHHHHHcCCcccccccCCceEEEEE
Confidence            45555553334568999999999999999988888888874


No 62 
>PF02130 UPF0054:  Uncharacterized protein family UPF0054;  InterPro: IPR002036 These, as yet, uncharacterised proteins are of 17 to 21 kDa. They contain a conserved region with three histidines at the C terminus. The protein family is represented by a single member sequence only in nearly every bacterium. The crystal structure of the protein from the hyperthermophilic bacteria Aquifex aeolicus has been determined. The overall fold consists of one central alpha-helix surrounded by a four-stranded beta-sheet and four other alpha-helices. Structure-based homology analysis reveals a good resemblance to the metal-dependent proteinases such as collagenases and gelatinases. However, experimental tests for collagenase and gelatinase-type function show no detectable activity under standard assay conditions [].; GO: 0046872 metal ion binding; PDB: 1TVI_A 1OZ9_A 1XM5_A 1XAX_A.
Probab=76.17  E-value=1.9  Score=33.31  Aligned_cols=17  Identities=41%  Similarity=0.690  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHhhCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHE  166 (184)
Q Consensus       150 ~g~i~HElgHALG~~HE  166 (184)
                      .-.++|=++|.|||.|+
T Consensus       109 ~~l~vHG~LHLlGyDH~  125 (145)
T PF02130_consen  109 ARLLVHGLLHLLGYDHE  125 (145)
T ss_dssp             HHHHHHHHHHHTT-SST
T ss_pred             hHHHHHHHHHHcCCCCC
Confidence            46899999999999999


No 63 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=75.84  E-value=1.7  Score=30.76  Aligned_cols=24  Identities=33%  Similarity=0.458  Sum_probs=15.6

Q ss_pred             cceeecCCCC---chHHHHHHHHHHhh
Q psy2976         138 QQAISIGKNC---DKFGIVVHELGHVV  161 (184)
Q Consensus       138 ~q~isl~~~c---~~~g~i~HElgHAL  161 (184)
                      ...|-+..+.   ...-+++|||||.+
T Consensus        28 ~~~I~in~~~~~~~~~f~laHELgH~~   54 (122)
T PF06114_consen   28 NPIIFINSNLSPERQRFTLAHELGHIL   54 (122)
T ss_dssp             TTEEEEESSS-HHHHHHHHHHHHHHHH
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHH
Confidence            3455554442   23569999999986


No 64 
>COG0319 Predicted metal-dependent hydrolase [General function prediction only]
Probab=73.57  E-value=2.4  Score=33.29  Aligned_cols=19  Identities=26%  Similarity=0.560  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      .-.++|=++|.|||.|+..
T Consensus       109 ~~l~vHG~LHLlGYDH~~~  127 (153)
T COG0319         109 AHLTIHGILHLLGYDHEED  127 (153)
T ss_pred             HHHHHHHHHHHccCCCCCc
Confidence            3589999999999999875


No 65 
>PF06262 DUF1025:  Possibl zinc metallo-peptidase;  InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=73.28  E-value=2.3  Score=30.89  Aligned_cols=17  Identities=35%  Similarity=0.526  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHhhCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHE  166 (184)
Q Consensus       150 ~g~i~HElgHALG~~HE  166 (184)
                      ..+++||++|-+|+.-|
T Consensus        74 ~~tlvhEiah~fG~~~e   90 (97)
T PF06262_consen   74 RDTLVHEIAHHFGISDE   90 (97)
T ss_dssp             HHHHHHHHHHHTT--HH
T ss_pred             HHHHHHHHHHHcCCCHH
Confidence            36899999999998643


No 66 
>COG1164 Oligoendopeptidase F [Amino acid transport and metabolism]
Probab=73.24  E-value=7.8  Score=36.73  Aligned_cols=17  Identities=35%  Similarity=0.380  Sum_probs=13.9

Q ss_pred             CchHHHHHHHHHHhhCC
Q psy2976         147 CDKFGIVVHELGHVVGF  163 (184)
Q Consensus       147 c~~~g~i~HElgHALG~  163 (184)
                      -..+-|++||+||++=.
T Consensus       378 ~~dV~TLaHElGHs~Hs  394 (598)
T COG1164         378 LRDVFTLAHELGHSVHS  394 (598)
T ss_pred             hhHHHHHHHHccHHHHH
Confidence            45688999999999743


No 67 
>PRK00016 metal-binding heat shock protein; Provisional
Probab=72.42  E-value=2.4  Score=33.28  Aligned_cols=18  Identities=28%  Similarity=0.481  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHhhCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh  167 (184)
                      .-.++|=++|.|||.|+.
T Consensus       114 ~~l~iHG~LHLlGYDH~~  131 (159)
T PRK00016        114 AHLTVHGILHLLGYDHIE  131 (159)
T ss_pred             HHHHHHhhHHhcCCCCCC
Confidence            357999999999999974


No 68 
>PF11667 DUF3267:  Protein of unknown function (DUF3267);  InterPro: IPR021683  This family of proteins has no known function. 
Probab=71.69  E-value=1.8  Score=31.54  Aligned_cols=20  Identities=35%  Similarity=0.247  Sum_probs=17.7

Q ss_pred             HHHHHHHHHhhCCCCCCCCC
Q psy2976         151 GIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       151 g~i~HElgHALG~~HEh~Rp  170 (184)
                      ..++||+.|+|.+..--.++
T Consensus         6 ~~~~HEliH~l~~~~~~~~~   25 (111)
T PF11667_consen    6 LIPLHELIHGLFFKLFGKKP   25 (111)
T ss_pred             eHHHHHHHHHHHHHHhCCCC
Confidence            46899999999999888877


No 69 
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=70.65  E-value=2.5  Score=36.78  Aligned_cols=14  Identities=43%  Similarity=0.847  Sum_probs=12.0

Q ss_pred             chHHHHHHHHHHhh
Q psy2976         148 DKFGIVVHELGHVV  161 (184)
Q Consensus       148 ~~~g~i~HElgHAL  161 (184)
                      ..+.++.||||||+
T Consensus       153 ~~v~tl~HE~GHa~  166 (365)
T cd06258         153 DDINTLFHEFGHAV  166 (365)
T ss_pred             HHHHHHHHHHhHHH
Confidence            34679999999998


No 70 
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=69.35  E-value=2.9  Score=37.69  Aligned_cols=15  Identities=27%  Similarity=0.507  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHhhCC
Q psy2976         149 KFGIVVHELGHVVGF  163 (184)
Q Consensus       149 ~~g~i~HElgHALG~  163 (184)
                      .+.|+.||||||+=.
T Consensus       242 ~v~tLfHE~GHa~H~  256 (458)
T PF01432_consen  242 DVETLFHEFGHAMHS  256 (458)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHhHHHHH
Confidence            467999999999843


No 71 
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=68.99  E-value=3.1  Score=34.56  Aligned_cols=13  Identities=38%  Similarity=0.598  Sum_probs=11.0

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ...++.||+||||
T Consensus        92 ~~~~l~HE~GHAl  104 (220)
T PF14247_consen   92 VLFTLYHELGHAL  104 (220)
T ss_pred             HHHHHHHHHHHHH
Confidence            3578999999997


No 72 
>PRK13963 unkown domain/putative metalloprotease fusion protein; Provisional
Probab=68.89  E-value=3.4  Score=35.15  Aligned_cols=17  Identities=35%  Similarity=0.483  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHhhCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHE  166 (184)
Q Consensus       150 ~g~i~HElgHALG~~HE  166 (184)
                      .-.++|=++|.|||.|+
T Consensus       216 ~~LlIHGlLHLLGYDHe  232 (258)
T PRK13963        216 AHLLVHGALHAQGYDHE  232 (258)
T ss_pred             HHHHHHHHHHHcCCCCC
Confidence            46899999999999999


No 73 
>cd06455 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24.15; soluble metallo-endopeptidase; EC 3.4.24.15) family also includes neurolysin (endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurotensin endopeptidase, soluble angiotensin II-binding protein, thimet oligopeptidase II) which hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A. TOP and neurolysin are neuropeptidases expressed abundantly in the testis, but also found in the liver, lung and kidney. They are involved in the metabolism of neuropeptides under 20 amino acid residues long and cleave most bioactive peptides at the same sites, but recognize different positions on some naturally occurring and synthetic peptides; they cleave at distinct sites on the 13-residue bioactive peptide neurotensin, which modulates central dopaminergic and cholinergic circuits.  TOP has been shown to degrade peptides released by the proteasom
Probab=65.71  E-value=3.7  Score=37.52  Aligned_cols=13  Identities=38%  Similarity=0.790  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      .+-|+.|||||||
T Consensus       263 ~V~TLfHEfGHal  275 (472)
T cd06455         263 EVETFFHEFGHVI  275 (472)
T ss_pred             HHHHHHHHHHHHH
Confidence            4678999999999


No 74 
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=64.95  E-value=3.7  Score=33.73  Aligned_cols=24  Identities=17%  Similarity=0.542  Sum_probs=16.9

Q ss_pred             ceeecCC------CCchHHHHHHHHHHhhC
Q psy2976         139 QAISIGK------NCDKFGIVVHELGHVVG  162 (184)
Q Consensus       139 q~isl~~------~c~~~g~i~HElgHALG  162 (184)
                      +.+.|+.      .....++++||.|||+-
T Consensus        76 kvvrLSe~~y~g~Sia~~aVAAHEVGHAiQ  105 (226)
T COG2738          76 KVVRLSEANYYGPSIAAIAVAAHEVGHAIQ  105 (226)
T ss_pred             heeeccccccCCccHHHHHHHHHHhhHHHh
Confidence            4566643      23457899999999984


No 75 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=64.76  E-value=3.9  Score=31.84  Aligned_cols=12  Identities=50%  Similarity=0.758  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHhh
Q psy2976         150 FGIVVHELGHVV  161 (184)
Q Consensus       150 ~g~i~HElgHAL  161 (184)
                      .-+++|||.|++
T Consensus       136 lDVvaHEltHGV  147 (150)
T PF01447_consen  136 LDVVAHELTHGV  147 (150)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             cceeeecccccc
Confidence            569999999985


No 76 
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=63.58  E-value=4.1  Score=37.56  Aligned_cols=16  Identities=38%  Similarity=0.808  Sum_probs=13.6

Q ss_pred             CchHHHHHHHHHHhhC
Q psy2976         147 CDKFGIVVHELGHVVG  162 (184)
Q Consensus       147 c~~~g~i~HElgHALG  162 (184)
                      -...|+++||+||..|
T Consensus       128 sElagViAHEigHv~q  143 (484)
T COG4783         128 SELAGVIAHEIGHVAQ  143 (484)
T ss_pred             HHHHHHHHHHHHHHhh
Confidence            3467999999999987


No 77 
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=63.42  E-value=3.3  Score=31.45  Aligned_cols=30  Identities=20%  Similarity=0.400  Sum_probs=20.9

Q ss_pred             CcceeecCCC-----Cc---------hHHHHHHHHHHhhCCCCC
Q psy2976         137 GQQAISIGKN-----CD---------KFGIVVHELGHVVGFWHE  166 (184)
Q Consensus       137 g~q~isl~~~-----c~---------~~g~i~HElgHALG~~HE  166 (184)
                      ++..|.|.+.     |.         ...+++||+||-.|+.-+
T Consensus        83 ~P~rItlYRrailDywae~eetlgd~vthvliHEIgHhFGLsDd  126 (136)
T COG3824          83 LPDRITLYRRALLDYWAENEETLGDQVTHVLIHEIGHHFGLSDD  126 (136)
T ss_pred             CCceeeeeHHHHHHHHhhhhhhHhhHhhhhhhhhhhhhcCCChh
Confidence            5677777642     32         135899999999998643


No 78 
>cd06457 M3A_MIP Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3.4.24.59) belongs to the widespread subfamily M3A, that show similarity to the Thimet oligopeptidase (TOP). It is one of three peptidases responsible for the proteolytic processing of both, nuclear and mitochondrial encoded precursor polypeptides targeted to the various subcompartments of the mitochondria. It cleaves intermediate-size proteins initially processed by mitochondrial processing peptidase (MPP) to yield a processing intermediate with a typical N-terminal octapeptide that is sequentially cleaved by MIP to mature-size protein.  MIP cleaves precursor proteins of respiratory components, including subunits of the electron transport chain and tri-carboxylic acid cycle enzymes, and components of the mitochondrial genetic machinery, including ribosomal proteins, translation factors, and proteins required for mitochondrial DNA metabolism. It has been suggested that the human MIP (HMIP polypeptide; gene symbo
Probab=62.96  E-value=4.4  Score=36.90  Aligned_cols=17  Identities=24%  Similarity=0.421  Sum_probs=13.2

Q ss_pred             hHHHHHHHHHHhhCCCC
Q psy2976         149 KFGIVVHELGHVVGFWH  165 (184)
Q Consensus       149 ~~g~i~HElgHALG~~H  165 (184)
                      .+.|+.|||||||=..-
T Consensus       248 ~v~TLfHEfGHalH~~l  264 (458)
T cd06457         248 EVETLFHEMGHAMHSML  264 (458)
T ss_pred             HHHHHHHHHhHHHHHHH
Confidence            36799999999985433


No 79 
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=61.19  E-value=5.3  Score=34.35  Aligned_cols=16  Identities=44%  Similarity=0.466  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHhhCCC
Q psy2976         149 KFGIVVHELGHVVGFW  164 (184)
Q Consensus       149 ~~g~i~HElgHALG~~  164 (184)
                      ..++++||++||+=-.
T Consensus       135 ~isvvvHElgHal~A~  150 (277)
T cd06162         135 LISGVVHEMGHGVAAV  150 (277)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4578999999997433


No 80 
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=60.49  E-value=5.5  Score=33.87  Aligned_cols=23  Identities=35%  Similarity=0.398  Sum_probs=15.8

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTRPD  171 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~RpD  171 (184)
                      ...+++||+||++=-..+..+.+
T Consensus       118 ~isv~iHElgHa~~Ar~~G~~V~  140 (263)
T cd06159         118 VVGVVVHELSHGILARVEGIKVK  140 (263)
T ss_pred             HHHHHHHHHHHHHHHHHcCCEEC
Confidence            45789999999975554444433


No 81 
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=58.94  E-value=6.2  Score=32.06  Aligned_cols=24  Identities=25%  Similarity=0.296  Sum_probs=16.3

Q ss_pred             chHHHHHHHHHHhhCCCCCCCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWHEHTRPD  171 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~HEh~RpD  171 (184)
                      ....++.||+||++=..+-..|..
T Consensus        37 l~~~v~iHElgH~~~A~~~G~~v~   60 (208)
T cd06161          37 LFLSVLLHELGHALVARRYGIRVR   60 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCcc
Confidence            346789999999975544444433


No 82 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=58.55  E-value=6.8  Score=31.17  Aligned_cols=14  Identities=36%  Similarity=0.650  Sum_probs=12.0

Q ss_pred             hHHHHHHHHHHhhC
Q psy2976         149 KFGIVVHELGHVVG  162 (184)
Q Consensus       149 ~~g~i~HElgHALG  162 (184)
                      ..++++||+||..+
T Consensus        89 l~aVlaHElgH~~~  102 (226)
T PF01435_consen   89 LAAVLAHELGHIKH  102 (226)
T ss_dssp             HHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHc
Confidence            46899999999874


No 83 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=58.23  E-value=6.5  Score=27.86  Aligned_cols=12  Identities=33%  Similarity=0.432  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHhh
Q psy2976         150 FGIVVHELGHVV  161 (184)
Q Consensus       150 ~g~i~HElgHAL  161 (184)
                      ..+++||+.|++
T Consensus        26 ~~~l~HE~~H~~   37 (128)
T PF13485_consen   26 DRVLAHELAHQW   37 (128)
T ss_pred             HHHHHHHHHHHH
Confidence            489999999996


No 84 
>cd06460 M32_Taq Peptidase family M32 is a subclass of metallocarboxypeptidases which are distributed mainly in bacteria and archaea, and contain a HEXXH motif that coordinates a divalent cation such as Zn2+ or Co2+, so far only observed in the active site of neutral metallopeptidases but not in carboxypeptidases. M32 includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). Novel peptidases from protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, are the first eukaryotic M32 enzymes identified so far, thus making these enzymes an attractive potential target for drug development against these o
Probab=58.00  E-value=7.2  Score=35.17  Aligned_cols=20  Identities=30%  Similarity=0.466  Sum_probs=15.0

Q ss_pred             chHHHHHHHHHHhhCCCCCCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~HEh~Rp  170 (184)
                      ...-+++||+||||   |||+-|
T Consensus       158 ~~l~t~iHE~GHal---ye~~l~  177 (396)
T cd06460         158 SALFSTIHETGHAL---YEQGLP  177 (396)
T ss_pred             HHHHHHHHHhhHHH---HHhcCC
Confidence            34568999999997   666544


No 85 
>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70) enzyme. DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from E. coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called  peptidyl dipeptidase A). Oligopeptidase A (OpdA) may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala.
Probab=57.59  E-value=6.3  Score=35.61  Aligned_cols=13  Identities=31%  Similarity=0.708  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      .+-|+.|||||||
T Consensus       208 ~v~tLfHEfGHal  220 (422)
T cd06456         208 EVTTLFHEFGHAL  220 (422)
T ss_pred             HHHHHHHHHHHHH
Confidence            4678999999999


No 86 
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=54.23  E-value=8.2  Score=31.93  Aligned_cols=22  Identities=23%  Similarity=0.222  Sum_probs=14.8

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~Rp  170 (184)
                      ...+++||+||++=......++
T Consensus        53 ~~~v~iHElgH~~~A~~~G~~v   74 (227)
T cd06164          53 FASVLLHELGHSLVARRYGIPV   74 (227)
T ss_pred             HHHHHHHHHHHHHHHHHcCCeE
Confidence            3578999999997444443333


No 87 
>PF14521 Aspzincin_M35:  Lysine-specific metallo-endopeptidase ; PDB: 2X3C_A 2X3A_A 2X3B_A 1GE7_B 1GE6_A 1GE5_A 1G12_A.
Probab=54.05  E-value=7.9  Score=29.86  Aligned_cols=14  Identities=50%  Similarity=0.847  Sum_probs=11.9

Q ss_pred             hHHHHHHHHHH--hhC
Q psy2976         149 KFGIVVHELGH--VVG  162 (184)
Q Consensus       149 ~~g~i~HElgH--ALG  162 (184)
                      ..++++||+-|  +.|
T Consensus        96 k~~TLiHE~SHf~~~~  111 (148)
T PF14521_consen   96 KEGTLIHEWSHFTAVG  111 (148)
T ss_dssp             HHHHHHHHHHHSCCCT
T ss_pred             hHHHHHHhhhhhhhhc
Confidence            57999999999  655


No 88 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=52.97  E-value=8.5  Score=29.42  Aligned_cols=15  Identities=27%  Similarity=0.344  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHhhCC
Q psy2976         149 KFGIVVHELGHVVGF  163 (184)
Q Consensus       149 ~~g~i~HElgHALG~  163 (184)
                      ...|++|||.|++=+
T Consensus        59 l~~~l~HEm~H~~~~   73 (146)
T smart00731       59 LRETLLHELCHAALY   73 (146)
T ss_pred             HHhhHHHHHHHHHHH
Confidence            457999999999854


No 89 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=52.78  E-value=9.3  Score=29.07  Aligned_cols=18  Identities=17%  Similarity=0.495  Sum_probs=14.4

Q ss_pred             chHHHHHHHHHHhhCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWH  165 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~H  165 (184)
                      ....|++|||.|+.=+..
T Consensus        59 ~~~~tL~HEm~H~~~~~~   76 (157)
T PF10263_consen   59 ELIDTLLHEMAHAAAYVF   76 (157)
T ss_pred             HHHHHHHHHHHHHHhhhc
Confidence            346899999999987654


No 90 
>KOG2921|consensus
Probab=51.54  E-value=8.4  Score=34.95  Aligned_cols=18  Identities=44%  Similarity=0.639  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHhhCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh  167 (184)
                      ...++||+||||--.-|+
T Consensus       132 i~~vvHElGHalAA~seg  149 (484)
T KOG2921|consen  132 ITVVVHELGHALAAASEG  149 (484)
T ss_pred             HHHHHHHhhHHHHHHhcC
Confidence            568999999999655554


No 91 
>PLN02887 hydrolase family protein
Probab=51.01  E-value=10  Score=35.91  Aligned_cols=19  Identities=47%  Similarity=0.590  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      .-.++|=++|.|||.|+..
T Consensus       231 ~~l~vHG~LHLlGyDH~~~  249 (580)
T PLN02887        231 RILVVHGLLHLLGFDHEIS  249 (580)
T ss_pred             HHHHHHHHHHhcCCCCCCC
Confidence            3579999999999999974


No 92 
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=49.22  E-value=10  Score=31.34  Aligned_cols=13  Identities=38%  Similarity=0.381  Sum_probs=10.8

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ...+++||+|||-
T Consensus        93 ~gsiLAHE~mHa~  105 (212)
T PF12315_consen   93 TGSILAHELMHAW  105 (212)
T ss_pred             HhhHHHHHHHHHH
Confidence            3468999999995


No 93 
>KOG3658|consensus
Probab=48.12  E-value=6.1  Score=37.98  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=15.4

Q ss_pred             HHHHHHHHHhhCCCCCCC
Q psy2976         151 GIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       151 g~i~HElgHALG~~HEh~  168 (184)
                      -|++|||||..|-.|.-.
T Consensus       394 lt~AHEiGHNfGSpHDp~  411 (764)
T KOG3658|consen  394 LTLAHEIGHNFGSPHDPD  411 (764)
T ss_pred             eeehhhhccccCCCCCCC
Confidence            489999999999999643


No 94 
>PRK10911 oligopeptidase A; Provisional
Probab=48.12  E-value=10  Score=36.45  Aligned_cols=13  Identities=31%  Similarity=0.534  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      .+.|+.|||||||
T Consensus       463 ~v~tlfHEfGHal  475 (680)
T PRK10911        463 EVITLFHEFGHGL  475 (680)
T ss_pred             HHHHHHHHHhHHH
Confidence            4679999999998


No 95 
>PRK03982 heat shock protein HtpX; Provisional
Probab=48.04  E-value=11  Score=32.14  Aligned_cols=14  Identities=36%  Similarity=0.703  Sum_probs=11.6

Q ss_pred             chHHHHHHHHHHhh
Q psy2976         148 DKFGIVVHELGHVV  161 (184)
Q Consensus       148 ~~~g~i~HElgHAL  161 (184)
                      +..++++||+||.-
T Consensus       124 El~AVlAHElgHi~  137 (288)
T PRK03982        124 ELEGVIAHELTHIK  137 (288)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35799999999964


No 96 
>PRK03072 heat shock protein HtpX; Provisional
Probab=47.96  E-value=11  Score=32.28  Aligned_cols=14  Identities=43%  Similarity=0.665  Sum_probs=11.6

Q ss_pred             chHHHHHHHHHHhh
Q psy2976         148 DKFGIVVHELGHVV  161 (184)
Q Consensus       148 ~~~g~i~HElgHAL  161 (184)
                      +..++++||+||.-
T Consensus       126 El~aVlAHElgHi~  139 (288)
T PRK03072        126 ELRGVLGHELSHVY  139 (288)
T ss_pred             HHHHHHHHHHHHHh
Confidence            35799999999964


No 97 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=47.42  E-value=12  Score=25.97  Aligned_cols=14  Identities=43%  Similarity=0.638  Sum_probs=11.9

Q ss_pred             hHHHHHHHHHHhhC
Q psy2976         149 KFGIVVHELGHVVG  162 (184)
Q Consensus       149 ~~g~i~HElgHALG  162 (184)
                      ....++|||.|++-
T Consensus        61 ~~~llaHEl~Hv~Q   74 (79)
T PF13699_consen   61 GRALLAHELAHVVQ   74 (79)
T ss_pred             cchhHhHHHHHHHh
Confidence            46799999999973


No 98 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=47.34  E-value=12  Score=31.34  Aligned_cols=14  Identities=36%  Similarity=0.710  Sum_probs=11.7

Q ss_pred             chHHHHHHHHHHhh
Q psy2976         148 DKFGIVVHELGHVV  161 (184)
Q Consensus       148 ~~~g~i~HElgHAL  161 (184)
                      +..++++||+||..
T Consensus       156 El~aVlaHElgHi~  169 (302)
T COG0501         156 ELEAVLAHELGHIK  169 (302)
T ss_pred             HHHHHHHHHHHHHh
Confidence            35799999999975


No 99 
>KOG3538|consensus
Probab=47.31  E-value=4  Score=40.11  Aligned_cols=21  Identities=33%  Similarity=0.450  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHhhCCCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHTRP  170 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~Rp  170 (184)
                      .-+++||+||.+|+.|--.-.
T Consensus       318 aftiahE~GH~~gm~hd~~~~  338 (845)
T KOG3538|consen  318 AFTIAHELGHNFGMEHDGRGN  338 (845)
T ss_pred             ceeeeeccccccCcccCCcCC
Confidence            458999999999999975444


No 100
>PRK05457 heat shock protein HtpX; Provisional
Probab=46.13  E-value=12  Score=31.99  Aligned_cols=13  Identities=23%  Similarity=0.629  Sum_probs=11.1

Q ss_pred             chHHHHHHHHHHh
Q psy2976         148 DKFGIVVHELGHV  160 (184)
Q Consensus       148 ~~~g~i~HElgHA  160 (184)
                      +..++++||+||.
T Consensus       133 El~aVlAHElgHi  145 (284)
T PRK05457        133 EVEAVLAHEISHI  145 (284)
T ss_pred             HHHHHHHHHHHHH
Confidence            3579999999995


No 101
>PRK03001 M48 family peptidase; Provisional
Probab=46.11  E-value=12  Score=31.75  Aligned_cols=14  Identities=43%  Similarity=0.729  Sum_probs=11.6

Q ss_pred             chHHHHHHHHHHhh
Q psy2976         148 DKFGIVVHELGHVV  161 (184)
Q Consensus       148 ~~~g~i~HElgHAL  161 (184)
                      +..++++||+||.-
T Consensus       123 El~aVlAHElgHi~  136 (283)
T PRK03001        123 EIRGVMAHELAHVK  136 (283)
T ss_pred             HHHHHHHHHHHHHh
Confidence            35799999999974


No 102
>PF06167 Peptidase_M90:  Glucose-regulated metallo-peptidase M90;  InterPro: IPR010384  MtfA (earlier known as YeeI) is a transcription factor that binds Mlc (make large colonies), itself a repressor of glucose and hence a protein important in regulation of the phosphoenolpyruvate:glucose-phosphotransferase (PtsG) system, the major glucose transporter in Escherichia coli. Mlc is a repressor of ptsG, and MtfA is found to bind and inactivate Mlc with high affinity []. The membrane-bound protein EIICBGlc encoded by the ptsG gene is the major glucose transporter in E. coli. ; PDB: 3DL1_A 3KHI_A.
Probab=45.17  E-value=12  Score=31.56  Aligned_cols=17  Identities=29%  Similarity=0.571  Sum_probs=12.0

Q ss_pred             chHHHHHHHHHHhhCCC
Q psy2976         148 DKFGIVVHELGHVVGFW  164 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~  164 (184)
                      +..-+++|||.|+|=+.
T Consensus       153 dg~NVviHEfAH~LD~~  169 (253)
T PF06167_consen  153 DGHNVVIHEFAHKLDME  169 (253)
T ss_dssp             SS--HHHHHHHHHHHCT
T ss_pred             CCcchHHHHHHHHHHhh
Confidence            34679999999999443


No 103
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=44.87  E-value=13  Score=28.02  Aligned_cols=36  Identities=31%  Similarity=0.398  Sum_probs=22.2

Q ss_pred             CCCcccccCCCCCCcceeecCCCCchHHHHHHHHHHhhCC
Q psy2976         124 PCGCCSFVGKRGNGQQAISIGKNCDKFGIVVHELGHVVGF  163 (184)
Q Consensus       124 ~~gC~S~vG~~~~g~q~isl~~~c~~~g~i~HElgHALG~  163 (184)
                      ++-|.+++|..--.+  -+-.+||.  -++.||+.|+--|
T Consensus        58 ~~LCG~~~~~i~IDP--~~~~KGC~--~TL~HEL~H~WQ~   93 (141)
T PHA02456         58 QDLCGQFVGWIEIDP--DYANKGCR--DTLAHELNHAWQF   93 (141)
T ss_pred             cchhhcceeEEEECC--cccccchH--HHHHHHHHHHHhh
Confidence            455888877642111  11134674  6899999998654


No 104
>PRK01345 heat shock protein HtpX; Provisional
Probab=44.79  E-value=13  Score=32.34  Aligned_cols=14  Identities=43%  Similarity=0.759  Sum_probs=11.8

Q ss_pred             chHHHHHHHHHHhh
Q psy2976         148 DKFGIVVHELGHVV  161 (184)
Q Consensus       148 ~~~g~i~HElgHAL  161 (184)
                      +..++++|||||..
T Consensus       123 EL~aVlAHElgHi~  136 (317)
T PRK01345        123 EVAGVMAHELAHVK  136 (317)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35799999999975


No 105
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=44.24  E-value=15  Score=29.46  Aligned_cols=25  Identities=16%  Similarity=0.218  Sum_probs=18.5

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTRPDRD  173 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~RpDRD  173 (184)
                      ....+.||+||++-......+..+-
T Consensus        41 ~~~l~iHElgH~~~A~~~G~~~~~~   65 (183)
T cd06160          41 LAILGIHEMGHYLAARRHGVKASLP   65 (183)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCccce
Confidence            3568899999998776666666553


No 106
>PRK04897 heat shock protein HtpX; Provisional
Probab=44.01  E-value=14  Score=31.83  Aligned_cols=13  Identities=31%  Similarity=0.601  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ..++++||+||.-
T Consensus       137 l~aVlAHElgHi~  149 (298)
T PRK04897        137 LEGVIGHEISHIR  149 (298)
T ss_pred             HHHHHHHHHHHHh
Confidence            5799999999964


No 107
>cd02639 R3H_RRM R3H domain of mainly fungal proteins which are associated with a RNA recognition motif (RRM) domain. Present in this group is the RNA-binding post-transcriptional regulator Cip2 (Csx1-interacting protein 2) involved in counteracting Csx1 function. Csx1 plays a central role in controlling gene expression during oxidative stress. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=43.99  E-value=16  Score=24.14  Aligned_cols=28  Identities=18%  Similarity=0.218  Sum_probs=20.6

Q ss_pred             ceeecCCCC-chHHHHHHHHHHhhCCCCC
Q psy2976         139 QAISIGKNC-DKFGIVVHELGHVVGFWHE  166 (184)
Q Consensus       139 q~isl~~~c-~~~g~i~HElgHALG~~HE  166 (184)
                      ..+.++++- .....++|.+.|-||+.|.
T Consensus        18 ~eL~Fp~~ls~~eRriih~la~~lGL~~~   46 (60)
T cd02639          18 DELAFPSSLSPAERRIVHLLASRLGLNHV   46 (60)
T ss_pred             eEEEcCCCCCHHHHHHHHHHHHHcCCceE
Confidence            345554442 3467899999999999997


No 108
>PF15639 Tox-MPTase3:  Metallopeptidase toxin 3
Probab=43.75  E-value=46  Score=25.49  Aligned_cols=70  Identities=23%  Similarity=0.218  Sum_probs=40.0

Q ss_pred             HHHHHHHHHhhcccceEEEEcCCCCCCcEEEEecCCCCcc--cccCCCCCCcceeecCC--------CC---------ch
Q psy2976          89 ALFKQAMRHWENFTCVKFVERSSTEHPNYILFTEKPCGCC--SFVGKRGNGQQAISIGK--------NC---------DK  149 (184)
Q Consensus        89 ~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~~~~~gC~--S~vG~~~~g~q~isl~~--------~c---------~~  149 (184)
                      ..|-.||+.|-..+-+...+.-.=....+|.|.....||+  .+.+..  +.|.|.+..        +-         ..
T Consensus        23 p~iv~A~~K~~~l~~~~l~~~l~WGkGP~IkI~~~~~~~A~G~t~p~~--~~~~i~I~~~lV~~~Ek~~~~~r~~~~~~v  100 (135)
T PF15639_consen   23 PAIVKAYKKWGGLNKAKLQEALTWGKGPYIKITPLVGGTAYGYTTPDD--GSQVIRIDGDLVNMFEKGPGERRAGNVYLV  100 (135)
T ss_pred             hHHHHHHHHHcccchhhhhhccccCCCCEEEEeecccceeeeeecCCC--CCcEEEeeHHHhhhhhcCCcccccceEEEe
Confidence            3467888888776555444332111345788886667784  222222  345665521        11         12


Q ss_pred             HHHHHHHHHHh
Q psy2976         150 FGIVVHELGHV  160 (184)
Q Consensus       150 ~g~i~HElgHA  160 (184)
                      ..|++||+-|=
T Consensus       101 ~~TlLHEliHw  111 (135)
T PF15639_consen  101 GSTLLHELIHW  111 (135)
T ss_pred             ehHHHHHHHHh
Confidence            47999999984


No 109
>KOG2556|consensus
Probab=43.50  E-value=13  Score=34.48  Aligned_cols=18  Identities=33%  Similarity=0.397  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHhhCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEH  167 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh  167 (184)
                      ..+|.||+.|||||.--+
T Consensus       256 ~stVkhE~~halgfsaGl  273 (666)
T KOG2556|consen  256 ASTVKHERDHALGFSAGL  273 (666)
T ss_pred             HHHHHHHHHhhhccccee
Confidence            578999999999996433


No 110
>PF07108 PipA:  PipA protein;  InterPro: IPR010777 This family consists of several Salmonella PipA (pathogenicity island-encoded protein A) and related phage sequences. PipA is thought to contribute to enteric but not to systemic salmonellosis [].
Probab=42.84  E-value=9.5  Score=30.39  Aligned_cols=44  Identities=16%  Similarity=0.153  Sum_probs=26.5

Q ss_pred             CcEEEEecCCCCcccccCCCC--CCcceeecCCCCchHHHHHHHHHHhhCCC
Q psy2976         115 PNYILFTEKPCGCCSFVGKRG--NGQQAISIGKNCDKFGIVVHELGHVVGFW  164 (184)
Q Consensus       115 ~~~I~f~~~~~gC~S~vG~~~--~g~q~isl~~~c~~~g~i~HElgHALG~~  164 (184)
                      ...|.++.....|.++--.-.  .|+|.+.      .....+||+.|||-..
T Consensus       122 rkvIcLnlDd~dd~~~~E~Yes~~G~qlFd------~~RsFiHEiVHALt~L  167 (200)
T PF07108_consen  122 RKVICLNLDDSDDDSYPEHYESNEGPQLFD------TKRSFIHEIVHALTHL  167 (200)
T ss_pred             ceEEEeecCCcccccchhhhhccCCccchh------HHHHHHHHHHHHHhhc
Confidence            445666555566766543321  2444443      3568999999999643


No 111
>PRK02870 heat shock protein HtpX; Provisional
Probab=42.75  E-value=15  Score=32.33  Aligned_cols=13  Identities=31%  Similarity=0.677  Sum_probs=11.3

Q ss_pred             chHHHHHHHHHHh
Q psy2976         148 DKFGIVVHELGHV  160 (184)
Q Consensus       148 ~~~g~i~HElgHA  160 (184)
                      +..++++||+||.
T Consensus       172 EL~aVlAHELgHi  184 (336)
T PRK02870        172 ELQAVMAHELSHI  184 (336)
T ss_pred             HHHHHHHHHHHHH
Confidence            3579999999997


No 112
>PF13203 DUF2201_N:  Putative metallopeptidase domain
Probab=42.25  E-value=18  Score=30.64  Aligned_cols=22  Identities=27%  Similarity=0.587  Sum_probs=17.7

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCCC
Q psy2976         149 KFGIVVHELGHVVGFWHEHTRPD  171 (184)
Q Consensus       149 ~~g~i~HElgHALG~~HEh~RpD  171 (184)
                      ..++++||++|++ |.|-.-+..
T Consensus        60 ~~~~l~HevlH~~-~~H~~r~~~   81 (292)
T PF13203_consen   60 RVGLLLHEVLHCL-LRHPWRRGG   81 (292)
T ss_pred             HHHHHHHHHHHHH-ccchhhhcc
Confidence            4578999999987 777777776


No 113
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=41.74  E-value=15  Score=31.86  Aligned_cols=12  Identities=42%  Similarity=0.620  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHhh
Q psy2976         150 FGIVVHELGHVV  161 (184)
Q Consensus       150 ~g~i~HElgHAL  161 (184)
                      ..+++||+||.+
T Consensus       171 ayVlAHEyGHHV  182 (292)
T PF04228_consen  171 AYVLAHEYGHHV  182 (292)
T ss_pred             HHHHHHHHHHHH
Confidence            358999999974


No 114
>PRK02391 heat shock protein HtpX; Provisional
Probab=40.91  E-value=16  Score=31.42  Aligned_cols=13  Identities=38%  Similarity=0.657  Sum_probs=11.0

Q ss_pred             chHHHHHHHHHHh
Q psy2976         148 DKFGIVVHELGHV  160 (184)
Q Consensus       148 ~~~g~i~HElgHA  160 (184)
                      +..++++||+||.
T Consensus       132 El~aVlaHElgHi  144 (296)
T PRK02391        132 ELEAVLAHELSHV  144 (296)
T ss_pred             HHHHHHHHHHHHH
Confidence            3579999999995


No 115
>PRK01265 heat shock protein HtpX; Provisional
Probab=40.64  E-value=17  Score=31.96  Aligned_cols=13  Identities=38%  Similarity=0.659  Sum_probs=11.0

Q ss_pred             chHHHHHHHHHHh
Q psy2976         148 DKFGIVVHELGHV  160 (184)
Q Consensus       148 ~~~g~i~HElgHA  160 (184)
                      +..++++||+||.
T Consensus       139 El~aVlAHElgHi  151 (324)
T PRK01265        139 EIKAVAGHELGHL  151 (324)
T ss_pred             HHHHHHHHHHHHH
Confidence            3579999999995


No 116
>KOG3624|consensus
Probab=39.07  E-value=21  Score=34.10  Aligned_cols=30  Identities=23%  Similarity=0.335  Sum_probs=23.1

Q ss_pred             HHHHHHHHHhhCCCCCCCCCCCCCceEeeccc
Q psy2976         151 GIVVHELGHVVGFWHEHTRPDRDNHVQIIREN  182 (184)
Q Consensus       151 g~i~HElgHALG~~HEh~RpDRD~yV~I~~~N  182 (184)
                      .+++|||+|  ||....-..|..-.+.-.|++
T Consensus       520 ~vigHEl~H--~FD~~G~~~D~~Gn~~~ww~~  549 (687)
T KOG3624|consen  520 FVIGHELTH--GFDDQGRQYDESGNLRDWWDT  549 (687)
T ss_pred             HHHHHHHhh--cccccccccCCCcccccCCCH
Confidence            378999999  888888888877776665553


No 117
>PF02102 Peptidase_M35:  Deuterolysin metalloprotease (M35) family;  InterPro: IPR001384 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M35 (deuterolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Deuterolysin is a microbial zinc-containing metalloprotease that shows some similarity to thermolysin []. The protein is expressed with a possible 19-residue signal sequence, a 155-residue propeptide, and an active peptide of 177 residues []. The latter contains an HEXXH motif towards the C terminus, but the other zinc ligands are as yet undetermined [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 1EB6_A.
Probab=38.76  E-value=22  Score=31.78  Aligned_cols=20  Identities=20%  Similarity=0.544  Sum_probs=14.2

Q ss_pred             CCCc---hHHHHHHHHHHhhCCC
Q psy2976         145 KNCD---KFGIVVHELGHVVGFW  164 (184)
Q Consensus       145 ~~c~---~~g~i~HElgHALG~~  164 (184)
                      ..|.   ..++++|||-|+.+..
T Consensus       290 ~~C~~qDqatt~LHE~TH~~~V~  312 (359)
T PF02102_consen  290 NRCHAQDQATTTLHEMTHAPAVY  312 (359)
T ss_dssp             -STT---HHHHHHHHHHT-TTTS
T ss_pred             ccccCCCccchhhhhhhcccccc
Confidence            4574   3579999999999863


No 118
>cd02325 R3H R3H domain. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. R3H domains are found in proteins together with ATPase domains, SF1 helicase domains, SF2 DEAH helicase domains, Cys-rich repeats, ring-type zinc fingers, and KH domains. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=38.44  E-value=50  Score=19.97  Aligned_cols=41  Identities=15%  Similarity=0.199  Sum_probs=31.5

Q ss_pred             ceeecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         139 QAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       139 q~isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      ..+.+.+-....--++|++.-..|+.++..-.+-+.+|.|.
T Consensus        18 ~~~~~~p~~~~~R~~vH~la~~~~L~s~s~g~~~~r~v~i~   58 (59)
T cd02325          18 KSLELPPMNSYERKLIHDLAEYYGLKSESEGEGPNRRVVIT   58 (59)
T ss_pred             CeEEcCCCCHHHHHHHHHHHHHCCCEEEEecCCCCcEEEEe
Confidence            34444443345678999999999999999998888888774


No 119
>cd06006 R3H_unknown_2 R3H domain of a group of fungal proteins with unknown function. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA  or ssRNA in a sequence-specific manner.
Probab=38.09  E-value=33  Score=22.54  Aligned_cols=39  Identities=18%  Similarity=0.290  Sum_probs=30.2

Q ss_pred             eecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         141 ISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       141 isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      +.+.+=......++||+..+.||.=|..-++-+.||-|.
T Consensus        20 ~~f~pM~~~~R~~vHdla~~~gl~SeS~d~Ep~R~V~v~   58 (59)
T cd06006          20 LRFPPMRSPQRAFIHELAKDYGLYSESQDPEPKRSVFVK   58 (59)
T ss_pred             eeCCCCCHHHHHHHHHHHHHcCCeeEecCCCCCcEEEEe
Confidence            344332334678999999999999999999888888763


No 120
>PRK04351 hypothetical protein; Provisional
Probab=36.18  E-value=22  Score=27.65  Aligned_cols=13  Identities=46%  Similarity=0.652  Sum_probs=11.2

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ..+||.|||.|.+
T Consensus        61 l~~vv~HElcH~~   73 (149)
T PRK04351         61 LIGIIKHELCHYH   73 (149)
T ss_pred             HHhhHHHHHHHHH
Confidence            4689999999985


No 121
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=36.16  E-value=19  Score=28.65  Aligned_cols=20  Identities=35%  Similarity=0.333  Sum_probs=12.5

Q ss_pred             HHHHHHHHHhhCCCCCCCCCCC
Q psy2976         151 GIVVHELGHVVGFWHEHTRPDR  172 (184)
Q Consensus       151 g~i~HElgHALG~~HEh~RpDR  172 (184)
                      .+++|||+||+.  .+....|-
T Consensus        38 ~ilahel~hafd--~~g~~~D~   57 (206)
T PF01431_consen   38 FILAHELMHAFD--PEGINYDE   57 (206)
T ss_dssp             HHHHHHHHHCTS--TTGGGB-T
T ss_pred             HHHHHHHHHHHH--HhHhhcCc
Confidence            479999999654  34433443


No 122
>PF14891 Peptidase_M91:  Effector protein
Probab=35.42  E-value=25  Score=27.69  Aligned_cols=19  Identities=26%  Similarity=0.445  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHhhCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHT  168 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~  168 (184)
                      +.++.|||.||.-+.+=-.
T Consensus       104 ~v~L~HEL~HA~~~~~Gt~  122 (174)
T PF14891_consen  104 FVVLYHELIHAYDYMNGTM  122 (174)
T ss_pred             HHHHHHHHHHHHHHHCCCC
Confidence            5689999999987766544


No 123
>PRK10280 dipeptidyl carboxypeptidase II; Provisional
Probab=35.12  E-value=23  Score=34.21  Aligned_cols=13  Identities=31%  Similarity=0.552  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHhhC
Q psy2976         150 FGIVVHELGHVVG  162 (184)
Q Consensus       150 ~g~i~HElgHALG  162 (184)
                      +-|+-|||||||=
T Consensus       465 V~TlFHEfGHalH  477 (681)
T PRK10280        465 VITLFHEFGHTLH  477 (681)
T ss_pred             HHHHHHHHHHHHH
Confidence            5689999999984


No 124
>PRK04860 hypothetical protein; Provisional
Probab=34.25  E-value=26  Score=27.59  Aligned_cols=13  Identities=38%  Similarity=0.539  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ..++|.||+.|.+
T Consensus        63 l~~~v~HEl~H~~   75 (160)
T PRK04860         63 IDEVVPHELAHLL   75 (160)
T ss_pred             HHhHHHHHHHHHH
Confidence            4689999999975


No 125
>PLN02791 Nudix hydrolase homolog
Probab=33.78  E-value=20  Score=35.15  Aligned_cols=20  Identities=20%  Similarity=0.124  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHhhCCCCCCCC
Q psy2976         150 FGIVVHELGHVVGFWHEHTR  169 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~R  169 (184)
                      ..|+.||+||.+|=.+....
T Consensus       586 ~~v~lHElgHGsG~~~~~~~  605 (770)
T PLN02791        586 THTICHECCHGIGPHTITLP  605 (770)
T ss_pred             HHHHHHHhhccccccceecC
Confidence            57999999999998776554


No 126
>PRK15410 DgsA anti-repressor MtfA; Provisional
Probab=32.82  E-value=21  Score=30.45  Aligned_cols=18  Identities=22%  Similarity=0.650  Sum_probs=14.9

Q ss_pred             chHHHHHHHHHHhhCCCC
Q psy2976         148 DKFGIVVHELGHVVGFWH  165 (184)
Q Consensus       148 ~~~g~i~HElgHALG~~H  165 (184)
                      ...-+++|||.|.|=+..
T Consensus       141 dg~NVvIHEFAH~LDm~~  158 (260)
T PRK15410        141 SGFNLIIHEVAHKLDMRN  158 (260)
T ss_pred             CCcchhHhHHHhHhhhhc
Confidence            345699999999998866


No 127
>PF10460 Peptidase_M30:  Peptidase M30;  InterPro: IPR019501 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This family contains metallopeptidases belonging to MEROPS peptidase family M30 (hyicolysin family, clan MA). Hyicolysin has a zinc ion which is liganded by two histidine and one glutamate residue. 
Probab=32.58  E-value=28  Score=31.15  Aligned_cols=16  Identities=25%  Similarity=0.789  Sum_probs=13.6

Q ss_pred             hHHHHHHHHHHhhCCC
Q psy2976         149 KFGIVVHELGHVVGFW  164 (184)
Q Consensus       149 ~~g~i~HElgHALG~~  164 (184)
                      ..+|++|||.|.+=|.
T Consensus       139 ~~sTlAHEfQHmInfy  154 (366)
T PF10460_consen  139 VYSTLAHEFQHMINFY  154 (366)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4689999999999665


No 128
>COG2317 Zn-dependent carboxypeptidase [Amino acid transport and metabolism]
Probab=30.22  E-value=24  Score=32.68  Aligned_cols=11  Identities=36%  Similarity=0.492  Sum_probs=9.2

Q ss_pred             HHHHHHHHHhh
Q psy2976         151 GIVVHELGHVV  161 (184)
Q Consensus       151 g~i~HElgHAL  161 (184)
                      -.++||.||||
T Consensus       261 ~g~iHE~GHAl  271 (497)
T COG2317         261 FGTIHETGHAL  271 (497)
T ss_pred             HHHHHhhhhHH
Confidence            35789999997


No 129
>KOG0201|consensus
Probab=27.43  E-value=20  Score=32.88  Aligned_cols=30  Identities=23%  Similarity=0.450  Sum_probs=26.1

Q ss_pred             HHHHHHHHHHhhCCCCCCCCCCCCCceEeecccC
Q psy2976         150 FGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENI  183 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI  183 (184)
                      .+++++|+++||+|.|.+.---||    |.=.||
T Consensus       113 i~~ilre~l~~l~ylH~~~kiHrD----IKaani  142 (467)
T KOG0201|consen  113 IAVILREVLKGLDYLHSEKKIHRD----IKAANI  142 (467)
T ss_pred             eeeehHHHHHHhhhhhhcceeccc----ccccce
Confidence            578999999999999999988888    666665


No 130
>smart00393 R3H Putative single-stranded nucleic acids-binding domain.
Probab=27.16  E-value=73  Score=21.52  Aligned_cols=39  Identities=21%  Similarity=0.156  Sum_probs=28.5

Q ss_pred             eecCCCCchHHHHHHHHHHhhCCCCCCCCCCCCCceEee
Q psy2976         141 ISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDNHVQII  179 (184)
Q Consensus       141 isl~~~c~~~g~i~HElgHALG~~HEh~RpDRD~yV~I~  179 (184)
                      +.|.+=.....-++|+++..+|+.++..-..-+.+|.|.
T Consensus        39 ~~~~pm~~~~R~~iH~~a~~~~l~s~S~g~g~~R~vvv~   77 (79)
T smart00393       39 VELPPMNSYERKIVHELAEKYGLESESFGEGPKRRVVIS   77 (79)
T ss_pred             EEcCCCCHHHHHHHHHHHHHcCCEEEEEcCCCCcEEEEE
Confidence            333332235678999999999999998777777777764


No 131
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=26.00  E-value=44  Score=27.35  Aligned_cols=16  Identities=25%  Similarity=0.401  Sum_probs=13.0

Q ss_pred             hHHHHHHHHHHhhCCC
Q psy2976         149 KFGIVVHELGHVVGFW  164 (184)
Q Consensus       149 ~~g~i~HElgHALG~~  164 (184)
                      ..|++.||+.|+.-..
T Consensus        96 i~Gvl~HE~~H~~Q~~  111 (205)
T PF04450_consen   96 IIGVLYHEMVHCWQWD  111 (205)
T ss_pred             HHHHHHHHHHHHhhcC
Confidence            4799999999996543


No 132
>PF01434 Peptidase_M41:  Peptidase family M41 This is family M41 in the peptidase classification. ;  InterPro: IPR000642 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The peptidase M41 family belong to a larger family of zinc metalloproteases. This family includes the cell division protein FtsH, and the yeast mitochondrial respiratory chain complexes assembly protein, which is a putative ATP-dependent protease required for assembly of the mitochondrial respiratory chain and ATPase complexes. FtsH is an integral membrane protein, which seems to act as an ATP-dependent zinc metallopeptidase that binds one zinc ion.; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0006508 proteolysis; PDB: 4EIW_C 2DHR_E 1IY1_A 1IY2_A 1IY0_A 1IXZ_A 2CE7_F 2CEA_F 3KDS_E 2QZ4_A ....
Probab=24.24  E-value=45  Score=27.04  Aligned_cols=13  Identities=54%  Similarity=0.680  Sum_probs=11.3

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ..-++.||-||||
T Consensus        28 ~~~~A~HEAGhAv   40 (213)
T PF01434_consen   28 KRRIAYHEAGHAV   40 (213)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            4679999999997


No 133
>PF02074 Peptidase_M32:  Carboxypeptidase Taq (M32) metallopeptidase;  InterPro: IPR001333 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M32 (carboxypeptidase Taq family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.  Carboxypeptidase Taq is a zinc-containing thermostable metallopeptidase. It was originally discovered and purified from Thermus aquaticus; optimal enzymatic activity occurs at 80 celcius. Although very little is known about this enzyme, it is thought either to be associated with a membrane or to be particle bound.; GO: 0004181 metallocarboxypeptidase activity, 0006508 proteolysis; PDB: 1K9X_A 1KA4_A 1KA2_A 3DWC_A 1WGZ_A 3HQ2_A 3HOA_B.
Probab=24.20  E-value=43  Score=31.15  Aligned_cols=13  Identities=31%  Similarity=0.526  Sum_probs=10.7

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ..-.++||.||||
T Consensus       259 ~l~s~iHE~GHal  271 (494)
T PF02074_consen  259 ALFSTIHETGHAL  271 (494)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            3567899999997


No 134
>PF09768 Peptidase_M76:  Peptidase M76 family;  InterPro: IPR019165 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. Mitochondrial inner membrane protease ATP23 has two roles in the assembly of mitochondrial ATPase. Firstly, it acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Secondly, it is involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring [, ].; GO: 0004222 metalloendopeptidase activity
Probab=23.17  E-value=48  Score=26.47  Aligned_cols=14  Identities=29%  Similarity=0.228  Sum_probs=11.7

Q ss_pred             hHHHHHHHHHHhhC
Q psy2976         149 KFGIVVHELGHVVG  162 (184)
Q Consensus       149 ~~g~i~HElgHALG  162 (184)
                      ...+++|||-||--
T Consensus        71 l~~~l~HELIHayD   84 (173)
T PF09768_consen   71 LEDTLTHELIHAYD   84 (173)
T ss_pred             HHHHHHHHHHHHHH
Confidence            35799999999964


No 135
>COG0339 Dcp Zn-dependent oligopeptidases [Amino acid transport and metabolism]
Probab=22.56  E-value=49  Score=32.04  Aligned_cols=24  Identities=17%  Similarity=0.279  Sum_probs=16.4

Q ss_pred             HHHHHHHHHhhcccceEEEEcCCC
Q psy2976          89 ALFKQAMRHWENFTCVKFVERSST  112 (184)
Q Consensus        89 ~~I~~A~~~we~~TcV~F~e~~~~  112 (184)
                      ++|.--++..+.-=.|+|+|..+.
T Consensus       365 ~Vl~GlF~~~~rLfGI~~~e~~~~  388 (683)
T COG0339         365 KVLEGLFEVAKRLFGITFVERKDI  388 (683)
T ss_pred             HHHHHHHHHHHHHcCeEEEECCCC
Confidence            455445567777778999997543


No 136
>KOG2719|consensus
Probab=22.40  E-value=46  Score=30.44  Aligned_cols=13  Identities=38%  Similarity=0.764  Sum_probs=10.8

Q ss_pred             chHHHHHHHHHHh
Q psy2976         148 DKFGIVVHELGHV  160 (184)
Q Consensus       148 ~~~g~i~HElgHA  160 (184)
                      +..++++||+||-
T Consensus       279 el~AVl~HELGHW  291 (428)
T KOG2719|consen  279 ELVAVLAHELGHW  291 (428)
T ss_pred             HHHHHHHHHhhHH
Confidence            3578999999994


No 137
>KOG3314|consensus
Probab=21.66  E-value=56  Score=26.27  Aligned_cols=24  Identities=29%  Similarity=0.439  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHhhCCCCCCCCCCCCCceEeecccC
Q psy2976         150 FGIVVHELGHVVGFWHEHTRPDRDNHVQIIRENI  183 (184)
Q Consensus       150 ~g~i~HElgHALG~~HEh~RpDRD~yV~I~~~NI  183 (184)
                      .-+++|||.||.-    +-|.      .|+|.|+
T Consensus        92 n~vv~HElIH~fD----d~r~------~vDW~Nl  115 (194)
T KOG3314|consen   92 NQVVIHELIHAFD----DCRA------KVDWTNL  115 (194)
T ss_pred             HHHHHHHHHHHHH----hhhh------hcccchh
Confidence            4699999999973    2222      2778876


No 138
>PF07023 DUF1315:  Protein of unknown function (DUF1315);  InterPro: IPR009749 This family consists of several bacterial proteins of around 90 residues in length. The function of this family is unknown.
Probab=21.59  E-value=1.3e+02  Score=21.67  Aligned_cols=47  Identities=15%  Similarity=0.160  Sum_probs=33.2

Q ss_pred             CCCcCCCceEEEEcCCCCHHHHHHHHHHHHHhhcccceEEEEcCCCCCCcEEEEe
Q psy2976          67 ERIWDYGVIPYEIDSNFGGQHKALFKQAMRHWENFTCVKFVERSSTEHPNYILFT  121 (184)
Q Consensus        67 ~~~Wp~g~IpY~~~~~~~~~~r~~I~~A~~~we~~TcV~F~e~~~~~~~~~I~f~  121 (184)
                      ..|||+|       ..+++++|+.-.+|+=.|+...++.=.+.+-. ...||...
T Consensus        22 lGKWpDG-------~~LT~eQre~~mQaVm~yq~~~n~~~e~~ti~-~~G~I~~k   68 (93)
T PF07023_consen   22 LGKWPDG-------RALTPEQRESCMQAVMLYQARHNLPEEHRTIG-ADGYIDMK   68 (93)
T ss_pred             hCcCCCC-------CCCCHHHHHHHHHHHHHHHHHcCCCHHHcccC-CCCEEccc
Confidence            6799998       46899999999999999998765532333321 23566664


No 139
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither h
Probab=21.25  E-value=58  Score=30.11  Aligned_cols=16  Identities=38%  Similarity=0.738  Sum_probs=13.3

Q ss_pred             chHHHHHHHHHHhhCC
Q psy2976         148 DKFGIVVHELGHVVGF  163 (184)
Q Consensus       148 ~~~g~i~HElgHALG~  163 (184)
                      ..+-++.||+||+..|
T Consensus       246 ~D~~t~~HE~GH~~yy  261 (477)
T cd06461         246 EDFVTVHHEMGHIQYY  261 (477)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3578999999999954


No 140
>KOG3854|consensus
Probab=21.02  E-value=84  Score=29.20  Aligned_cols=40  Identities=23%  Similarity=0.570  Sum_probs=24.5

Q ss_pred             CCCcccccCCCCCCcceeecCCC-Cch----HHHHHHHHHHhhCC
Q psy2976         124 PCGCCSFVGKRGNGQQAISIGKN-CDK----FGIVVHELGHVVGF  163 (184)
Q Consensus       124 ~~gC~S~vG~~~~g~q~isl~~~-c~~----~g~i~HElgHALG~  163 (184)
                      ..||....-+.+.+...|.|+.. |.+    .-|++||+.||.-+
T Consensus       321 tag~cl~~~~~~kr~A~IeLs~kV~tTAERir~TLiHEmCHaAaW  365 (505)
T KOG3854|consen  321 TAGCCLNGDAHGKRYAKIELSDKVCTTAERIRDTLIHEMCHAAAW  365 (505)
T ss_pred             cccccccchhccCceeEEEehhhhhhHHHHHHHHHHHHHHHHHHh
Confidence            45665543333334556777654 543    34799999999744


No 141
>PF05452 Clavanin:  Clavanin;  InterPro: IPR008453 This family consists of clavanin proteins from the haemocytes of the invertebrate Styela clava (Sea squirt), a solitary tunicate. The family is made up of four alpha-helical antimicrobial peptides, clavanins A, B, C and D. The tunicate peptides resemble magainins in size, primary sequence and antibacterial activity. Synthetic clavanin A displays comparable antimicrobial activity to magainins and cecropins. The presence of alpha-helical antimicrobial peptides in the haemocytes of a urochordate suggests that such peptides are primeval effectors of innate immunity in the vertebrate lineage [].; GO: 0005576 extracellular region
Probab=20.76  E-value=28  Score=23.74  Aligned_cols=13  Identities=46%  Similarity=0.797  Sum_probs=8.1

Q ss_pred             HHHHHHHHHHhhC
Q psy2976         150 FGIVVHELGHVVG  162 (184)
Q Consensus       150 ~g~i~HElgHALG  162 (184)
                      .|..+|-|+||||
T Consensus        41 VGnfVhgfshvfg   53 (80)
T PF05452_consen   41 VGNFVHGFSHVFG   53 (80)
T ss_pred             hhhhhhcceeecc
Confidence            3555666667766


No 142
>KOG2661|consensus
Probab=20.76  E-value=56  Score=29.23  Aligned_cols=12  Identities=33%  Similarity=0.573  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHhh
Q psy2976         150 FGIVVHELGHVV  161 (184)
Q Consensus       150 ~g~i~HElgHAL  161 (184)
                      ..+++||++||+
T Consensus       276 AtvLgHE~aHaV  287 (424)
T KOG2661|consen  276 ATVLGHEIAHAV  287 (424)
T ss_pred             HHHHHHHHHHHH
Confidence            468999999996


No 143
>COG4900 Predicted metallopeptidase [General function prediction only]
Probab=20.47  E-value=55  Score=24.63  Aligned_cols=15  Identities=40%  Similarity=0.997  Sum_probs=11.8

Q ss_pred             CC-chHHHHHHHHHHh
Q psy2976         146 NC-DKFGIVVHELGHV  160 (184)
Q Consensus       146 ~c-~~~g~i~HElgHA  160 (184)
                      .| +...+++||++|-
T Consensus        76 s~~ekvKviiHEllHI   91 (133)
T COG4900          76 SCAEKVKVIIHELLHI   91 (133)
T ss_pred             ChHHHHHHHHHHHhcC
Confidence            35 3578999999994


No 144
>PF10023 DUF2265:  Predicted aminopeptidase (DUF2265);  InterPro: IPR014553 This group represents a predicted aminopeptidase.
Probab=20.08  E-value=79  Score=28.04  Aligned_cols=13  Identities=31%  Similarity=0.493  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHhh
Q psy2976         149 KFGIVVHELGHVV  161 (184)
Q Consensus       149 ~~g~i~HElgHAL  161 (184)
                      ....|.|||.|..
T Consensus       165 LA~LIfHELaHq~  177 (337)
T PF10023_consen  165 LARLIFHELAHQT  177 (337)
T ss_pred             HHHHHHHHHhhce
Confidence            4689999999975


Done!