Diaphorina citri psyllid: psy2983

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370

MRPAYSDDLSPEERDARTIFCMQLSQRIRTRDLEEFFSSVGKVRDVRLITCNKTRRFKGIAYIEFKDPESVPLAMGLNGQKLLGIPIIVQPTQAEKNRAGNTLPNLQPRGTGGPMRLYIGSLHFNITEDMLRGIFEPFGKIDNIQLMVDPDTGRSKGYGFITFHSADDAKKAQEQLNGFELAGRPMKVGTVTDRNESVGGGPSNLDTDEMERAGVDLGATGRLQLMFKLAEGTGLELPPAAASALNLAQNAILNSSTPQVSSSTAPPIATQCFLLANMFDPATETNPTWDVEIRDDVIEECNKHGVGASTVCFIYSVIFLKLWSYVQVNLWCRHARKQDNPGHQRRQSMSANATSIEILSSHGLLALVIS

cccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEEccccccccEEEEEEcccccHHHHHHccccCCccCEEEEccccccccccccccccccccccccccEEEEccccccccHHHHHHHccccccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHcccccccccCEEEEccccccccccccccccccHHHHHccccccccHHHHccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccCEEEEEEEEEEEEEcccccEEEEEEEcccccccHHHHcccccccHHHHHHHHHccEEEEEcc

*****************TIFCMQLSQRIRTRDLEEFFSSVGKVRDVRLITCNKTRRFKGIAYIEFKDPESVPLAMGLNGQKLLGIPIIVQ***********************PMRLYIGSLHFNITEDMLRGIFEPFGKIDNIQLMVDPDTGRSKGYGFITFHSADDAKKAQEQLNGFELAGRPMKVG**************************DLGATGRLQLMFKLAEGTGLEL******************************IATQCFLLANMFDPATETNPTWDVEIRDDVIEECNKHGVGASTVCFIYSVIFLKLWSYVQVNLWCRHARKQ************ANATSIEILSSHGLLALVIS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
RNA-binding protein 39	Transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. May be involved in pre-mRNA splicing process.	confident	Q8VH51
RNA-binding protein 39	Transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1 (By similarity). May be involved in pre-mRNA splicing process.	confident	Q5RC80

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044428 [CC]	nuclear part	confident	GO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0000166 [MF]	nucleotide binding	probable	GO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:2000112 [BP]	regulation of cellular macromolecule biosynthetic process	probable	GO:0009889, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0050794, GO:0010556, GO:0065007, GO:0008150, GO:0050789
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0006397 [BP]	mRNA processing	probable	GO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0003713 [MF]	transcription coactivator activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0000381 [BP]	regulation of alternative mRNA splicing, via spliceosome	probable	GO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0008380 [BP]	RNA splicing	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B7F, chain A
Confidence level:very confident
Coverage over the Query: 15-97,111-191
View the alignment between query and template
View the model in PyMOL

Template: 1B7F, chain A
Confidence level:very confident
Coverage over the Query: 113-246
View the alignment between query and template
View the model in PyMOL

Template: 3S6E, chain A
Confidence level:very confident
Coverage over the Query: 266-311
View the alignment between query and template
View the model in PyMOL

Template: 2LYV, chain A
Confidence level:probable
Coverage over the Query: 6-171
View the alignment between query and template
View the model in PyMOL