Diaphorina citri psyllid: psy2985


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MKFSVRWLAQLTSDLEIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTFWRNWNMPIHQWAVR
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHcccHHHHHHcc
**FSVRWLAQLTSDLEIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTFWRNWNMPIHQWAVR
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFSVRWLAQLTSDLEIPNHLIWLIFFYLFFHSLLNLTGEVLHFADRNFYADWWNADNTDTFWRNWNMPIHQWAVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Diacylglycerol O-acyltransferase 1 Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly.confidentQ9Z2A7
Diacylglycerol O-acyltransferase 1 Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly.confidentQ8MK44
Diacylglycerol O-acyltransferase 1 Major enzyme for oil accumulation in seeds. Catalyzes the acylation of the sn-3 hydroxy group of sn-1,2-diacylglycerol using acyl-CoA. Can use palmitoyl-CoA and oleoyl-CoA as substrates. Has complementary functions with PDAT1 that are essential for triacylglycerol synthesis and normal development of both seeds and pollen.confidentQ9SLD2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010888 [BP]negative regulation of lipid storageprobableGO:0010883, GO:0008150, GO:0065007, GO:0048519, GO:0032879, GO:0050789
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0019992 [MF]diacylglycerol bindingprobableGO:0003674, GO:0008289, GO:0005488
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0003846 [MF]2-acylglycerol O-acyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0016411, GO:0008374, GO:0003674
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0004772 [MF]sterol O-acyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0008374, GO:0003674
GO:0046339 [BP]diacylglycerol metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:0006629, GO:0006639, GO:0006638, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255, GO:0046486
GO:0034379 [BP]very-low-density lipoprotein particle assemblyprobableGO:0034377, GO:0071825, GO:0071827, GO:0022607, GO:0044707, GO:0043933, GO:0071840, GO:0016043, GO:0065003, GO:0032501, GO:0097006, GO:0008150, GO:0065005, GO:0065007, GO:0050789, GO:0044699, GO:0044085
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0004144 [MF]diacylglycerol O-acyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0016411, GO:0008374, GO:0003674
GO:0035220 [BP]wing disc developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035336 [BP]long-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337
GO:0005504 [MF]fatty acid bindingprobableGO:0043168, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0033293
GO:0045477 [BP]regulation of nurse cell apoptotic processprobableGO:2000241, GO:0050794, GO:0043067, GO:0065007, GO:0051239, GO:0008150, GO:0010941, GO:0042981, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted