BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2988
(184 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described
In Remark 400
pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase
And Is Described In Remark 400
Length = 2060
Score = 28.5 bits (62), Expect = 2.3, Method: Composition-based stats.
Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 3/37 (8%)
Query: 37 PCISLVVRNLLFWQHKRDKLF---KENKKSECKRLRD 70
P L R +LFW+ DK+F + + +E K+ RD
Sbjct: 846 PIHKLATRGVLFWKELDDKIFSLDRSKRVAELKKRRD 882
>pdb|2ZU2|A Chain A, Complex Structure Of Cov 229e 3cl Protease With Epdtc
pdb|2ZU2|B Chain B, Complex Structure Of Cov 229e 3cl Protease With Epdtc
Length = 302
Score = 26.6 bits (57), Expect = 8.5, Method: Compositional matrix adjust.
Identities = 12/28 (42%), Positives = 17/28 (60%)
Query: 99 HVISSSVTEILDYDAANVLVLFTNFFII 126
HVI+S+ T +DYD ++ NF II
Sbjct: 41 HVIASNTTSAIDYDHEYSIMRLHNFSII 68
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.331 0.141 0.436
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,484,704
Number of Sequences: 62578
Number of extensions: 140877
Number of successful extensions: 297
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 296
Number of HSP's gapped (non-prelim): 4
length of query: 184
length of database: 14,973,337
effective HSP length: 93
effective length of query: 91
effective length of database: 9,153,583
effective search space: 832976053
effective search space used: 832976053
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 48 (23.1 bits)