BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2988
         (184 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
           Lanuginosus At 3.1 Angstrom Resolution. This File
           Contains The Beta Subunits Of The Fatty Acid Synthase.
           The Entire Crystal Structure Consists Of One
           Heterododecameric Fatty Acid Synthase And Is Described
           In Remark 400
 pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
 pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
           Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
           Resolution. This File Contains The Beta Subunits Of The
           Fatty Acid Synthase. The Entire Crystal Structure
           Consists Of One Heterododecameric Fatty Acid Synthase
           And Is Described In Remark 400
          Length = 2060

 Score = 28.5 bits (62), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 37  PCISLVVRNLLFWQHKRDKLF---KENKKSECKRLRD 70
           P   L  R +LFW+   DK+F   +  + +E K+ RD
Sbjct: 846 PIHKLATRGVLFWKELDDKIFSLDRSKRVAELKKRRD 882


>pdb|2ZU2|A Chain A, Complex Structure Of Cov 229e 3cl Protease With Epdtc
 pdb|2ZU2|B Chain B, Complex Structure Of Cov 229e 3cl Protease With Epdtc
          Length = 302

 Score = 26.6 bits (57), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 99  HVISSSVTEILDYDAANVLVLFTNFFII 126
           HVI+S+ T  +DYD    ++   NF II
Sbjct: 41  HVIASNTTSAIDYDHEYSIMRLHNFSII 68


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.141    0.436 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,484,704
Number of Sequences: 62578
Number of extensions: 140877
Number of successful extensions: 297
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 296
Number of HSP's gapped (non-prelim): 4
length of query: 184
length of database: 14,973,337
effective HSP length: 93
effective length of query: 91
effective length of database: 9,153,583
effective search space: 832976053
effective search space used: 832976053
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 48 (23.1 bits)