BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2989
(66 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q9YEA0|VATI_AERPE V-type ATP synthase subunit I OS=Aeropyrum pernix (strain ATCC
700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
GN=atpI PE=3 SV=2
Length = 685
Score = 29.6 bits (65), Expect = 5.6, Method: Composition-based stats.
Identities = 14/34 (41%), Positives = 20/34 (58%)
Query: 29 KPLSPVAACYAWNIMNEVIPTLFHTASIWLTLAL 62
KP S V Y + NE++PT+F ++ LT AL
Sbjct: 332 KPFSRVVELYGYPEPNEIVPTVFLAITLPLTFAL 365
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.331 0.137 0.475
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,094,018
Number of Sequences: 539616
Number of extensions: 740460
Number of successful extensions: 1488
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1487
Number of HSP's gapped (non-prelim): 1
length of query: 66
length of database: 191,569,459
effective HSP length: 38
effective length of query: 28
effective length of database: 171,064,051
effective search space: 4789793428
effective search space used: 4789793428
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 55 (25.8 bits)