BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2991
         (71 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YEQ|A Chain A, Structure Of Phod
 pdb|2YEQ|B Chain B, Structure Of Phod
          Length = 527

 Score = 25.8 bits (55), Expect = 6.1,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1   MESGNLNDKKELLPE-HAAWVTWLSVDFYFTAYYTFRVLFVHT 42
           ++S NLN+   L  + HA+W + L VDF  T+   F   FV T
Sbjct: 366 IKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGT 408


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.458 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,432,575
Number of Sequences: 62578
Number of extensions: 78352
Number of successful extensions: 132
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 132
Number of HSP's gapped (non-prelim): 2
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)