BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy2991
(71 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2YEQ|A Chain A, Structure Of Phod
pdb|2YEQ|B Chain B, Structure Of Phod
Length = 527
Score = 25.8 bits (55), Expect = 6.1, Method: Composition-based stats.
Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
Query: 1 MESGNLNDKKELLPE-HAAWVTWLSVDFYFTAYYTFRVLFVHT 42
++S NLN+ L + HA+W + L VDF T+ F FV T
Sbjct: 366 IKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGT 408
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.138 0.458
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,432,575
Number of Sequences: 62578
Number of extensions: 78352
Number of successful extensions: 132
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 132
Number of HSP's gapped (non-prelim): 2
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)