Diaphorina citri psyllid: psy3003

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MEQLQMGIPYITDCVLGEIEKLGQKYKVALRIIKDPRFERIPCMHKGTYADDCIVNRVTQHKCYIVATCDKDLKRRIRKVPGVPIMYISQHRYTIERMPDAYGAPK
cccccccccccHHHHHHHHHHHccHHHHHHHHHccccEEEEcccccccccHHHHHHHHcccccEEEEcccHHHHHHHHccccccEEEEEccEEEEEcccccccccc
**QLQMGIPYITDCVLGEIEKLGQKYKVALRIIKDPRFERIPCMHKGTYADDCIVNRVTQHKCYIVATCDKDLKRRIRKVPGVPIMYISQHRYTIE**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQLQMGIPYITDCVLGEIEKLGQKYKVALRIIKDPRFERIPCMHKGTYADDCIVNRVTQHKCYIVATCDKDLKRRIRKVPGVPIMYISQHRYTIERMPDAYGAPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
rRNA-processing protein FCF1 homolog Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.confidentQ9Y324
rRNA-processing protein FCF1 homolog Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.confidentQ9CTH6
rRNA-processing protein FCF1 homolog Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.confidentQ32PD0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0040007 [BP]growthprobableGO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O4W, chain A
Confidence level:very confident
Coverage over the Query: 7-92
View the alignment between query and template
View the model in PyMOL