Diaphorina citri psyllid: psy300

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-

MEKLAKKKKVKKEFKKKGKKKIERKKPDKTKRGRLFIKNLPFKITEEEFKEHFGQYGDIIDAQLLKNADGKLKGCGFINYANKISAVKAILKSNKKPYKGKITEEEFKEHFGQYGDIIDAQLLKNADGKLKGCGFINYANKISAVKAILKSNKKPYKGSENGLISPFHDIPLYSNVKDKIFNMVVEIPRWTNAKMEINLNEPLNPIKQDIKKGNLRYVANVFPHHGYIWNYGALPQTWENPDETDAHTGQKGDGDPIDVLEIGERIAKRGEIIQVKALGVIGLIDEGQTDWKIIAINVNDPNAAKLNDVADIETHFPGYLKATNEWFKIYKIPDGKPENVLNTRVEGESSQGFIPGCRGRTEQVVSSRLETPPLIGSSGSENGLISPFHDIPLYSNVKDKIFNMVVEIPRWTNAKMEVGNAMEMRLYLVCFNLPSPLGYLQLNLLQEQQLN

cHHHHHHHHHHHHHHHccHHHHHcccccccccccEEEEcccccccHHHHHHHHHHcccEEEEEEEEccccccccCEEEEcccHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccccccccEEEcccccccccHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEEEEEEEEEEcccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHcccccccccCEEccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEcccccccHHHHHHccccccccc

*********************************RLFIKNLPFKITEEEFKEHFGQYGDIIDAQLLKNADGKLKGCGFINYANKISAVKAILKSNKKPYKGKITEEEFKEHFGQYGDIIDAQLLKNADGKLKGCGFINYANKISAVKAILKSNKKPYKGSENGLISPFHDIPLYSNVKDKIFNMVVEIPRWTNAKMEINLNEPLNPIKQDIKKGNLRYVANVFPHHGYIWNYGALPQTWENPDETDAHTGQKGDGDPIDVLEIGERIAKRGEIIQVKALGVIGLIDEGQTDWKIIAINVNDPNAAKLNDVADIETHFPGYLKATNEWFKIYKIPDGKPENVLNTRVEGESSQGFIPGCRGRTEQVV**********GSSGSENGLISPFHDIPLYSNVKDKIFNMVVEIPRWTNAKMEVGNAMEMRLYLVCFNLPSPLGYLQLNLLQEQ***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Inorganic pyrophosphatase	Component of NURF (nucleosome remodeling factor), a complex which catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. NURF is required for homeotic gene expression, proper larval blood cell development, normal male X chromosome morphology, ecdysteroid signaling and metamorphosis. Nurf-38 may have adapted to deliver pyrophosphatase to chromatin to assist in replication or transcription by efficient removal of the inhibitory metabolite.	confident	O77460
Inorganic pyrophosphatase		confident	Q6BWA5
Probable inorganic pyrophosphatase 1		confident	Q18680

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0042766 [BP]	nucleosome mobilization	probable	GO:0034728, GO:0071824, GO:0044699, GO:0051276, GO:0006338, GO:0006325, GO:0009987, GO:0016043, GO:0043933, GO:0044763, GO:0071840, GO:0006996, GO:0008150, GO:0016568
GO:0044710 [BP]	single-organism metabolic process	probable	GO:0008150, GO:0008152
GO:0030446 [CC]	hyphal cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0009579 [CC]	thylakoid	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0006793 [BP]	phosphorus metabolic process	probable	GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005576 [CC]	extracellular region	probable	GO:0005575
GO:0004427 [MF]	inorganic diphosphatase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.6.-.-	Acting on acid anhydrides.	probable
3.6.1.-	In phosphorous-containing anhydrides.	probable
3.6.1.1	Inorganic diphosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1E9G, chain A
Confidence level:very confident
Coverage over the Query: 147-369
View the alignment between query and template
View the model in PyMOL

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 30-156
View the alignment between query and template
View the model in PyMOL

Template: 3Q46, chain A
Confidence level:very confident
Coverage over the Query: 385-439
View the alignment between query and template
View the model in PyMOL