Diaphorina citri psyllid: psy3038

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MNKSAEHAQFTKDQWKELIKYPWQTYSNQDLRRQYKMYSILGSAALPYEKFQKCLKANVQYRETFDRRRLNEKYGDKVVNRRGPIPAHLLGNMWAQTWGNIYDIVVPYPEKTPPDVSAELVRQGYTVHKMFRTAEEFFTSINMSAMPPEFWERSMLEKPQGREVVCHASAWDFHDGKDFRIKMCTRVNEEDLFTIHHEMGHVEYFIQYKDQPMAFREGANPGKNTRGWTALKDGLSFYESWVAEIGLAGTVGSVVMRLLAMQKFVPFPLVINRKFGIRTKINSDKTIFMVEAIFLFKIDTFLINTFVNIMMDLWRWGVFKKDISHEEYNKHWWKLRHDYQGVEPPTHRSEDDFDPGAKYHIVASVPYIRYFVSFVIQFQFHRALCEKAGEFDPNDPSKQPLHECDIYRSTEAGNLLKNMLAMGSSKPWPDAMEAITGQREMDASALLQYFEPLYKWLEEENARTGEHIGWEATDKKVFRSDAEKSRYMEEHEAYLRKQV
ccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccc
***SAEHAQFTKDQWKELIKYPWQTYSNQDLRRQYKMYSILGSAALPYEKFQKCLKANVQYRETFDRRRLNEKYGDKVVNRRGPIPAHLLGNMWAQTWGNIYDIVVPYPEKTPPDVSAELVRQGYTVHKMFRTAEEFFTSINMSAMPPEFWERSMLEKPQGREVVCHASAWDFHDGKDFRIKMCTRVNEEDLFTIHHEMGHVEYFIQYKDQPMAFREGANPGKNTRGWTALKDGLSFYESWVAEIGLAGTVGSVVMRLLAMQKFVPFPLVINRKFGIRTKINSDKTIFMVEAIFLFKIDTFLINTFVNIMMDLWRWGVFKKDISHEEYNKHWWKLRHDYQGVEPPTHRSEDDFDPGAKYHIVASVPYIRYFVSFVIQFQFHRALCEKAGEFDPNDPSKQPLHECDIYRSTEAGNLLKNMLAM*SSKPWPDAMEAITGQREMDASALLQYFEPLYKWLEEENARTGEHIGWEATDKKVFR**************YLRKQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKSAEHAQFTKDQWKELIKYPWQTYSNQDLRRQYKMYSILGSAALPYEKFQKCLKANVQYRETFDRRRLNEKYGDKVVNRRGPIPAHLLGNMWAQTWGNIYDIVVPYPEKTPPDVSAELVRQGYTVHKMFRTAEEFFTSINMSAMPPEFWERSMLEKPQGREVVCHASAWDFHDGKDFRIKMCTRVNEEDLFTIHHEMGHVEYFIQYKDQPMAFREGANPGKNTRGWTALKDGLSFYESWVAEIGLAGTVGSVVMRLLAMQKFVPFPLVINRKFGIRTKINSDKTIFMVEAIFLFKIDTFLINTFVNIMMDLWRWGVFKKDISHEEYNKHWWKLRHDYQGVEPPTHRSEDDFDPGAKYHIVASVPYIRYFVSFVIQFQFHRALCEKAGEFDPNDPSKQPLHECDIYRSTEAGNLLKNMLAMGSSKPWPDAMEAITGQREMDASALLQYFEPLYKWLEEENARTGEHIGWEATDKKVFRSDAEKSRYMEEHEAYLRKQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Angiotensin-converting enzyme May be involved in the specific maturation or degradation of a number of bioactive peptides. May play a role in the contractions of the heart, gut and testes, and in spermatid differentiation.confidentQ10714
Angiotensin-converting enzyme (Fragment) Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin.confidentQ10751

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031711 [MF]bradykinin receptor bindingprobableGO:0001664, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031404 [MF]chloride ion bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0043167
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0050482 [BP]arachidonic acid secretionprobableGO:0006869, GO:0046717, GO:0006820, GO:0015718, GO:0044699, GO:1901571, GO:0071702, GO:0033036, GO:0015909, GO:0015908, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0008150, GO:0051234, GO:0010876, GO:0051179, GO:0046942, GO:0046903, GO:0071715, GO:0032309
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0043171 [BP]peptide catabolic processprobableGO:1901575, GO:1901564, GO:1901565, GO:0043603, GO:0009987, GO:0044237, GO:0044248, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006518, GO:0009056
GO:0014910 [BP]regulation of smooth muscle cell migrationprobableGO:0040012, GO:0051270, GO:0050794, GO:0008150, GO:0030334, GO:2000145, GO:0065007, GO:0032879, GO:0050789

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.15.-Peptidyl-dipeptidases.probable
3.4.15.1Peptidyl-dipeptidase A.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NXQ, chain A
Confidence level:very confident
Coverage over the Query: 2-234,245-478
View the alignment between query and template
View the model in PyMOL
Template: 1J36, chain A
Confidence level:very confident
Coverage over the Query: 67-222,237-240,251-477
View the alignment between query and template
View the model in PyMOL