Query         psy3060
Match_columns 268
No_of_seqs    90 out of 92
Neff          1.8 
Searched_HMMs 46136
Date          Sat Aug 17 00:40:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3060.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3060hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00853 Runt:  Runt domain;  I 100.0 4.3E-73 9.3E-78  468.3  11.2  120   22-141     1-131 (135)
  2 KOG3982|consensus              100.0 5.5E-73 1.2E-77  530.4   9.0  154   18-171    94-260 (475)
  3 cd04159 Arl10_like Arl10-like   68.0     2.5 5.4E-05   30.4   0.9   16  107-122     1-16  (159)
  4 cd01858 NGP_1 NGP-1.  Autoanti  64.9     2.5 5.4E-05   33.0   0.4   13  110-122   107-119 (157)
  5 PRK14238 phosphate transporter  56.9      11 0.00024   32.5   2.9   52   75-127     4-72  (271)
  6 PF12846 AAA_10:  AAA-like doma  56.1     3.5 7.6E-05   33.6  -0.2   16  110-125     6-21  (304)
  7 cd01852 AIG1 AIG1 (avrRpt2-ind  55.7     4.7  0.0001   32.6   0.5   15  108-122     3-17  (196)
  8 TIGR03729 acc_ester putative p  53.8      12 0.00026   31.5   2.6   42   74-115    61-110 (239)
  9 PF00005 ABC_tran:  ABC transpo  53.6     5.5 0.00012   29.7   0.5   20  108-127    14-33  (137)
 10 COG2274 SunT ABC-type bacterio  53.5      12 0.00026   38.4   3.0   51   77-135   477-532 (709)
 11 TIGR02788 VirB11 P-type DNA tr  53.0      21 0.00047   31.8   4.2   53   25-88     42-97  (308)
 12 cd01856 YlqF YlqF.  Proteins o  52.9     5.2 0.00011   31.9   0.3   45   75-120    77-130 (171)
 13 PF01926 MMR_HSR1:  50S ribosom  49.8     6.8 0.00015   28.7   0.5   12  108-119     2-13  (116)
 14 PF13304 AAA_21:  AAA domain; P  48.0       6 0.00013   29.2   0.0   16  110-125     4-19  (303)
 15 cd03279 ABC_sbcCD SbcCD and ot  47.8      10 0.00022   31.5   1.3   16  109-124    32-47  (213)
 16 cd01876 YihA_EngB The YihA (En  47.7     8.7 0.00019   27.8   0.8   17  107-123     1-17  (170)
 17 smart00175 RAB Rab subfamily o  46.4     7.9 0.00017   28.7   0.4   12  109-120     4-15  (164)
 18 PRK13891 conjugal transfer pro  45.8     8.5 0.00018   39.5   0.7   95   25-124   396-507 (852)
 19 cd01881 Obg_like The Obg-like   45.7       7 0.00015   29.3   0.0   10  110-119     1-10  (176)
 20 COG1132 MdlB ABC-type multidru  45.4     8.1 0.00018   36.5   0.4   10  110-119   360-369 (567)
 21 COG1116 TauB ABC-type nitrate/  44.8     8.3 0.00018   35.5   0.4   17  109-125    33-49  (248)
 22 cd03273 ABC_SMC2_euk Eukaryoti  44.5     8.8 0.00019   32.5   0.5   15  109-123    29-43  (251)
 23 TIGR02323 CP_lyasePhnK phospho  44.2      14  0.0003   31.0   1.6   17  109-125    33-49  (253)
 24 cd03292 ABC_FtsE_transporter F  44.0      15 0.00032   29.8   1.6   19  108-126    30-48  (214)
 25 cd04114 Rab30 Rab30 subfamily.  43.5      11 0.00025   28.3   0.9   17  104-120     6-22  (169)
 26 cd00820 PEPCK_HprK Phosphoenol  42.4      10 0.00022   30.4   0.5   18  108-125    18-35  (107)
 27 PF13555 AAA_29:  P-loop contai  42.0      10 0.00022   28.0   0.4   20  101-120    15-38  (62)
 28 COG3638 ABC-type phosphate/pho  41.5      16 0.00034   34.2   1.7   14  110-123    35-48  (258)
 29 cd01853 Toc34_like Toc34-like   41.2      10 0.00022   33.4   0.4   15  108-122    34-48  (249)
 30 cd01898 Obg Obg subfamily.  Th  40.9      12 0.00027   28.0   0.7   13  107-119     2-14  (170)
 31 PF03193 DUF258:  Protein of un  40.8      11 0.00023   32.1   0.4   33   81-121    19-51  (161)
 32 PF13207 AAA_17:  AAA domain; P  40.5      12 0.00025   27.3   0.5   11  110-120     4-14  (121)
 33 cd03272 ABC_SMC3_euk Eukaryoti  40.3      12 0.00025   31.1   0.5   13  109-121    27-39  (243)
 34 cd04155 Arl3 Arl3 subfamily.    39.0      12 0.00027   28.3   0.5   13  108-120    17-29  (173)
 35 TIGR02868 CydC thiol reductant  39.0      12 0.00025   34.9   0.4   31   90-124   350-380 (529)
 36 cd04119 RJL RJL (RabJ-Like) su  38.9      12 0.00026   27.6   0.4   11  109-119     4-14  (168)
 37 TIGR03263 guanyl_kin guanylate  38.8      12 0.00026   29.3   0.4   17  109-125     5-21  (180)
 38 TIGR00157 ribosome small subun  37.8      13 0.00028   32.3   0.5   38   76-122   100-137 (245)
 39 cd04104 p47_IIGP_like p47 (47-  37.4      13 0.00028   30.4   0.4   12  108-119     4-15  (197)
 40 cd03263 ABC_subfamily_A The AB  37.2      13 0.00029   30.2   0.4   19  108-126    31-49  (220)
 41 cd00154 Rab Rab family.  Rab G  37.1      13 0.00029   26.5   0.4   12  108-119     3-14  (159)
 42 PF01935 DUF87:  Domain of unkn  36.9      11 0.00023   31.1  -0.2   17  110-126    28-44  (229)
 43 cd01857 HSR1_MMR1 HSR1/MMR1.    35.8      32  0.0007   26.5   2.3   14  107-120    85-98  (141)
 44 cd03224 ABC_TM1139_LivF_branch  35.8      14 0.00031   30.0   0.4   19  108-126    29-47  (222)
 45 cd01859 MJ1464 MJ1464.  This f  35.8      13 0.00028   28.7   0.1   44   76-120    73-116 (156)
 46 cd03225 ABC_cobalt_CbiO_domain  35.6      15 0.00032   29.8   0.4   19  108-126    30-48  (211)
 47 cd01879 FeoB Ferrous iron tran  35.5      12 0.00027   27.5   0.0   10  110-119     1-10  (158)
 48 TIGR01166 cbiO cobalt transpor  35.3      15 0.00032   29.5   0.4   19  108-126    21-39  (190)
 49 TIGR02528 EutP ethanolamine ut  35.2      15 0.00032   27.2   0.4   12  108-119     3-14  (142)
 50 cd03278 ABC_SMC_barmotin Barmo  35.1      15 0.00033   30.6   0.5   16  109-124    26-41  (197)
 51 cd03235 ABC_Metallic_Cations A  34.8      15 0.00033   29.9   0.4   18  109-126    29-46  (213)
 52 PF04665 Pox_A32:  Poxvirus A32  34.7      16 0.00034   33.1   0.5   14  109-122    17-30  (241)
 53 cd03264 ABC_drug_resistance_li  34.6      15 0.00033   29.8   0.4   19  108-126    28-46  (211)
 54 cd01918 HprK_C HprK/P, the bif  34.6      16 0.00034   30.8   0.4   12  108-119    17-28  (149)
 55 cd04160 Arfrp1 Arfrp1 subfamil  34.5      16 0.00036   27.4   0.5   12  108-119     2-13  (167)
 56 cd01868 Rab11_like Rab11-like.  34.5      16 0.00034   27.6   0.4   13  108-120     6-18  (165)
 57 cd03274 ABC_SMC4_euk Eukaryoti  34.4      16 0.00035   30.9   0.5   17  109-125    29-45  (212)
 58 PRK11174 cysteine/glutathione   34.3      15 0.00033   34.7   0.4   13  109-121   380-392 (588)
 59 cd00882 Ras_like_GTPase Ras-li  34.3      13 0.00029   25.3  -0.0   11  110-120     1-11  (157)
 60 PRK12288 GTPase RsgA; Reviewed  34.3      15 0.00033   34.1   0.4   40   75-123   184-223 (347)
 61 cd04164 trmE TrmE (MnmE, ThdF,  34.2      16 0.00035   26.5   0.4   12  108-119     4-15  (157)
 62 cd03261 ABC_Org_Solvent_Resist  34.2      16 0.00034   30.3   0.4   18  108-125    29-46  (235)
 63 PRK14257 phosphate ABC transpo  33.9      16 0.00034   33.2   0.4   19  108-126   111-129 (329)
 64 TIGR02673 FtsE cell division A  33.8      16 0.00035   29.6   0.4   18  109-126    32-49  (214)
 65 PF04548 AIG1:  AIG1 family;  I  33.8      16 0.00035   30.5   0.4   12  110-121     5-16  (212)
 66 cd04123 Rab21 Rab21 subfamily.  33.7      19 0.00041   26.4   0.7   14  108-121     3-16  (162)
 67 TIGR03797 NHPM_micro_ABC2 NHPM  33.7      16 0.00035   35.5   0.4   17  108-124   482-498 (686)
 68 PF05356 Phage_Coat_B:  Phage C  33.6      14  0.0003   29.8   0.0   15   97-111     3-17  (83)
 69 cd03277 ABC_SMC5_euk Eukaryoti  33.5      26 0.00056   29.8   1.6   32   91-123     8-41  (213)
 70 PF10442 FIST_C:  FIST C domain  33.3      15 0.00033   28.0   0.2   34   65-98     50-83  (136)
 71 TIGR01193 bacteriocin_ABC ABC-  33.0      17 0.00036   35.5   0.4   19  108-126   503-521 (708)
 72 TIGR00231 small_GTP small GTP-  32.9      17 0.00038   25.4   0.4   12  109-120     5-16  (161)
 73 PRK13539 cytochrome c biogenes  32.9      17 0.00037   29.8   0.4   18  109-126    32-49  (207)
 74 PRK13894 conjugal transfer ATP  32.8      82  0.0018   29.0   4.8   92   22-123    66-166 (319)
 75 PRK11176 lipid transporter ATP  32.8      17 0.00037   34.2   0.4   18  108-125   372-389 (582)
 76 cd03269 ABC_putative_ATPase Th  32.7      17 0.00037   29.5   0.4   19  108-126    29-47  (210)
 77 cd03262 ABC_HisP_GlnQ_permease  32.5      18 0.00038   29.3   0.4   18  109-126    30-47  (213)
 78 cd03265 ABC_DrrA DrrA is the A  32.5      18 0.00038   29.7   0.4   18  109-126    30-47  (220)
 79 cd04138 H_N_K_Ras_like H-Ras/N  32.5      18 0.00038   26.6   0.4   12  108-119     4-15  (162)
 80 COG4987 CydC ABC-type transpor  32.3      16 0.00036   37.4   0.3   20  109-128   368-387 (573)
 81 TIGR00960 3a0501s02 Type II (G  32.3      18 0.00039   29.5   0.4   19  108-126    32-50  (216)
 82 PLN03232 ABC transporter C fam  32.2      17 0.00037   39.5   0.4   25   91-119  1252-1276(1495)
 83 PRK00098 GTPase RsgA; Reviewed  32.1      18 0.00038   32.3   0.4   39   76-123   144-182 (298)
 84 cd03266 ABC_NatA_sodium_export  31.6      18  0.0004   29.4   0.4   19  108-126    34-52  (218)
 85 cd04171 SelB SelB subfamily.    31.6      20 0.00043   26.5   0.5   11  109-119     4-14  (164)
 86 PRK10790 putative multidrug tr  31.5      18  0.0004   34.3   0.4   19  109-127   371-389 (592)
 87 cd00876 Ras Ras family.  The R  31.3      19 0.00041   26.4   0.4   13  109-121     3-15  (160)
 88 cd01120 RecA-like_NTPases RecA  31.3      18 0.00038   26.4   0.2   16  110-125     4-19  (165)
 89 cd00844 MPP_Dbr1_N Dbr1 RNA la  31.2      83  0.0018   28.3   4.4   44   78-121    77-129 (262)
 90 cd03293 ABC_NrtD_SsuB_transpor  31.0      19 0.00042   29.5   0.4   18  108-125    33-50  (220)
 91 PRK10584 putative ABC transpor  30.9      19 0.00042   29.6   0.4   19  108-126    39-57  (228)
 92 cd03257 ABC_NikE_OppD_transpor  30.4      20 0.00043   29.2   0.4   19  108-126    34-52  (228)
 93 PRK14241 phosphate transporter  30.4      20 0.00043   30.3   0.4   20  108-127    33-52  (258)
 94 COG1135 AbcC ABC-type metal io  30.3      19 0.00041   34.9   0.3   14  109-122    36-49  (339)
 95 cd04139 RalA_RalB RalA/RalB su  30.2      23  0.0005   26.1   0.7   12  108-119     3-14  (164)
 96 cd01860 Rab5_related Rab5-rela  30.2      20 0.00044   26.7   0.4   14  108-121     4-17  (163)
 97 PLN03130 ABC transporter C fam  30.2      19 0.00042   39.7   0.4   13  108-120  1268-1280(1622)
 98 COG1126 GlnQ ABC-type polar am  30.2      23  0.0005   33.0   0.8   15  108-122    31-45  (240)
 99 cd03219 ABC_Mj1267_LivG_branch  30.0      20 0.00044   29.5   0.4   18  109-126    30-47  (236)
100 TIGR03796 NHPM_micro_ABC1 NHPM  30.0      20 0.00043   34.9   0.4   18  108-125   508-525 (710)
101 TIGR03410 urea_trans_UrtE urea  29.9      21 0.00045   29.4   0.4   19  108-126    29-47  (230)
102 cd04106 Rab23_lke Rab23-like s  29.8      21 0.00045   26.6   0.4   12  108-119     3-14  (162)
103 cd03270 ABC_UvrA_I The excisio  29.8      21 0.00045   30.2   0.4   14  109-122    25-38  (226)
104 TIGR02746 TraC-F-type type-IV   29.7      17 0.00037   35.8  -0.1   18  108-125   433-450 (797)
105 cd01861 Rab6 Rab6 subfamily.    29.7      21 0.00046   26.6   0.4   12  109-120     4-15  (161)
106 PF02463 SMC_N:  RecF/RecN/SMC   29.6      29 0.00064   28.2   1.3   29   91-119     7-38  (220)
107 TIGR03608 L_ocin_972_ABC putat  29.6      21 0.00046   28.7   0.4   19  109-127    28-46  (206)
108 PRK14245 phosphate ABC transpo  29.6      21 0.00045   30.0   0.4   17  109-125    33-49  (250)
109 PRK10078 ribose 1,5-bisphospho  29.4      21 0.00046   28.9   0.4   17  109-125     6-22  (186)
110 cd03255 ABC_MJ0796_Lo1CDE_FtsE  29.4      21 0.00046   29.0   0.4   17  109-125    34-50  (218)
111 TIGR02204 MsbA_rel ABC transpo  29.4      21 0.00045   33.5   0.4   15  108-122   369-383 (576)
112 PRK15467 ethanolamine utilizat  29.4      21 0.00046   28.2   0.4   15  108-122     4-18  (158)
113 KOG3587|consensus               29.3      48   0.001   27.0   2.4   21  116-136    86-106 (143)
114 COG1124 DppF ABC-type dipeptid  29.3      24 0.00053   32.8   0.8   18  108-125    36-53  (252)
115 TIGR01184 ntrCD nitrate transp  29.2      21 0.00046   29.8   0.4   17  109-125    15-31  (230)
116 PRK09825 idnK D-gluconate kina  29.2      21 0.00046   29.4   0.4   17  108-124     6-22  (176)
117 cd03218 ABC_YhbG The ABC trans  29.2      21 0.00046   29.3   0.4   18  108-125    29-46  (232)
118 cd03258 ABC_MetN_methionine_tr  29.2      21 0.00047   29.4   0.4   18  108-125    34-51  (233)
119 TIGR00957 MRP_assoc_pro multi   29.1      21 0.00045   38.9   0.4   26   90-119  1301-1326(1522)
120 cd03259 ABC_Carb_Solutes_like   29.1      22 0.00047   29.0   0.4   19  108-126    29-47  (213)
121 PF10662 PduV-EutP:  Ethanolami  29.1      21 0.00047   30.0   0.4   12  108-119     4-15  (143)
122 COG4988 CydD ABC-type transpor  29.0      21 0.00047   36.3   0.5   31  105-135   347-380 (559)
123 cd03231 ABC_CcmA_heme_exporter  29.0      22 0.00047   29.0   0.4   19  108-126    29-47  (201)
124 PRK10522 multidrug transporter  28.6      22 0.00047   33.7   0.4   18  108-125   352-369 (547)
125 cd03254 ABCC_Glucan_exporter_l  28.6      30 0.00066   28.3   1.2   18  109-126    33-50  (229)
126 cd03216 ABC_Carb_Monos_I This   28.6      23 0.00049   28.3   0.4   19  110-128    31-49  (163)
127 cd01864 Rab19 Rab19 subfamily.  28.5      23 0.00049   26.9   0.4   12  108-119     6-17  (165)
128 PRK10418 nikD nickel transport  28.5      22 0.00049   30.0   0.4   18  108-125    32-49  (254)
129 cd03234 ABCG_White The White s  28.4      23  0.0005   29.3   0.5   21  108-128    36-56  (226)
130 PRK14249 phosphate ABC transpo  28.2      23 0.00049   29.8   0.4   19  109-127    34-52  (251)
131 TIGR01271 CFTR_protein cystic   28.2      22 0.00048   38.7   0.4   12  108-119  1248-1259(1490)
132 cd01363 Motor_domain Myosin an  28.2      28  0.0006   28.6   0.9   14  111-124    30-43  (186)
133 PRK05541 adenylylsulfate kinas  28.2      23  0.0005   28.0   0.4   14  108-121    10-23  (176)
134 PRK13652 cbiO cobalt transport  28.2      23 0.00049   30.7   0.4   18  109-126    34-51  (277)
135 cd00879 Sar1 Sar1 subfamily.    28.1      23 0.00051   27.6   0.4   13  108-120    22-34  (190)
136 PRK04213 GTP-binding protein;   28.1      23  0.0005   28.0   0.4   13  108-120    12-24  (201)
137 cd04115 Rab33B_Rab33A Rab33B/R  28.1      23  0.0005   27.3   0.4   12  108-119     5-16  (170)
138 KOG0214|consensus               28.0      41 0.00088   37.0   2.3   65  152-216   444-510 (1141)
139 cd03250 ABCC_MRP_domain1 Domai  28.0      34 0.00075   27.7   1.4   19  108-126    34-52  (204)
140 cd01894 EngA1 EngA1 subfamily.  27.9      21 0.00046   26.0   0.1   10  110-119     2-11  (157)
141 cd03260 ABC_PstB_phosphate_tra  27.7      24 0.00051   29.0   0.4   21  108-128    29-49  (227)
142 PRK10261 glutathione transport  27.7      43 0.00093   32.8   2.2   18  109-126    46-63  (623)
143 PRK10744 pstB phosphate transp  27.7      23 0.00051   30.0   0.4   18  109-126    43-60  (260)
144 TIGR02211 LolD_lipo_ex lipopro  27.7      24 0.00052   28.8   0.4   17  109-125    35-51  (221)
145 cd03301 ABC_MalK_N The N-termi  27.5      24 0.00052   28.6   0.4   18  109-126    30-47  (213)
146 cd03214 ABC_Iron-Siderophores_  27.4      24 0.00053   28.3   0.4   18  110-127    30-47  (180)
147 PRK00300 gmk guanylate kinase;  27.4      25 0.00054   28.3   0.5   12  108-119     8-19  (205)
148 cd04177 RSR1 RSR1 subgroup.  R  27.4      24 0.00052   27.1   0.4   14  108-121     4-17  (168)
149 TIGR02857 CydD thiol reductant  27.4      24 0.00052   33.0   0.4   20  108-127   351-370 (529)
150 cd03226 ABC_cobalt_CbiO_domain  27.3      24 0.00053   28.6   0.4   19  108-126    29-47  (205)
151 PRK00454 engB GTP-binding prot  27.3      25 0.00054   27.3   0.5   15  107-121    26-40  (196)
152 PRK13638 cbiO cobalt transport  27.3      24 0.00052   30.2   0.4   19  108-126    30-48  (271)
153 PF00004 AAA:  ATPase family as  27.2      22 0.00048   25.6   0.1   18  110-127     3-20  (132)
154 TIGR01978 sufC FeS assembly AT  27.2      25 0.00054   29.0   0.5   20  108-127    29-48  (243)
155 PRK14250 phosphate ABC transpo  27.1      25 0.00053   29.6   0.4   19  108-126    32-50  (241)
156 cd08365 APC10-like1 APC10-like  27.1 1.7E+02  0.0036   24.6   5.3   21   75-95     67-87  (131)
157 PTZ00243 ABC transporter; Prov  27.1      24 0.00052   38.8   0.4   13  108-120  1339-1351(1560)
158 TIGR00235 udk uridine kinase.   27.0      25 0.00053   29.0   0.4   13  108-120     9-21  (207)
159 CHL00131 ycf16 sulfate ABC tra  27.0      25 0.00054   29.4   0.4   18  110-127    38-55  (252)
160 cd03247 ABCC_cytochrome_bd The  27.0      25 0.00054   28.1   0.4   19  108-126    31-49  (178)
161 PRK14261 phosphate ABC transpo  26.9      25 0.00054   29.6   0.4   18  109-126    36-53  (253)
162 PRK14251 phosphate ABC transpo  26.9      25 0.00054   29.4   0.4   18  108-125    33-50  (251)
163 PRK10359 lipopolysaccharide co  26.9 1.5E+02  0.0032   26.5   5.3   74  104-183    32-105 (232)
164 PRK15177 Vi polysaccharide exp  26.8      25 0.00055   29.3   0.4   18  109-126    17-34  (213)
165 cd03296 ABC_CysA_sulfate_impor  26.8      25 0.00054   29.3   0.4   19  108-126    31-49  (239)
166 cd01887 IF2_eIF5B IF2/eIF5B (i  26.8      27 0.00058   26.1   0.5   11  109-119     4-14  (168)
167 PRK13538 cytochrome c biogenes  26.7      25 0.00055   28.7   0.4   18  109-126    31-48  (204)
168 PRK14269 phosphate ABC transpo  26.7      25 0.00055   29.5   0.4   17  109-125    32-48  (246)
169 TIGR02315 ABC_phnC phosphonate  26.7      25 0.00055   29.1   0.4   17  109-125    32-48  (243)
170 COG1136 SalX ABC-type antimicr  26.7      24 0.00051   31.8   0.2   16  110-125    36-51  (226)
171 PF00910 RNA_helicase:  RNA hel  26.7      24 0.00051   26.6   0.2   15  110-124     3-17  (107)
172 PRK13657 cyclic beta-1,2-gluca  26.6      25 0.00054   33.5   0.4   21  108-128   364-384 (588)
173 cd03289 ABCC_CFTR2 The CFTR su  26.5      25 0.00055   31.1   0.4   15  108-122    33-47  (275)
174 cd00880 Era_like Era (E. coli   26.5      23 0.00049   24.8   0.1   14  110-123     1-14  (163)
175 PRK12289 GTPase RsgA; Reviewed  26.5      26 0.00056   32.8   0.5   38   76-122   152-189 (352)
176 PRK15093 antimicrobial peptide  26.4      25 0.00055   31.6   0.4   19  108-126    36-54  (330)
177 smart00382 AAA ATPases associa  26.4      26 0.00057   23.8   0.4   17  109-125     6-22  (148)
178 cd01854 YjeQ_engC YjeQ/EngC.    26.4      25 0.00055   31.1   0.4   40   77-125   142-181 (287)
179 cd04163 Era Era subfamily.  Er  26.3      27 0.00058   25.1   0.5   12  108-119     6-17  (168)
180 PRK11231 fecE iron-dicitrate t  26.3      26 0.00056   29.6   0.4   19  108-126    31-49  (255)
181 COG0218 Predicted GTPase [Gene  26.2      26 0.00056   31.4   0.4   13  108-120    27-39  (200)
182 cd03217 ABC_FeS_Assembly ABC-t  26.2      26 0.00057   28.7   0.4   19  109-127    30-48  (200)
183 PRK15112 antimicrobial peptide  26.1      26 0.00056   30.1   0.4   17  108-124    42-58  (267)
184 cd03249 ABC_MTABC3_MDL1_MDL2 M  26.1      27 0.00059   28.9   0.5   18  109-126    33-50  (238)
185 PRK03846 adenylylsulfate kinas  26.1      26 0.00057   28.7   0.4   14  107-120    26-39  (198)
186 PRK10575 iron-hydroxamate tran  26.1      26 0.00057   29.9   0.4   18  109-126    41-58  (265)
187 PRK14239 phosphate transporter  26.0      26 0.00057   29.2   0.4   18  108-125    34-51  (252)
188 TIGR03864 PQQ_ABC_ATP ABC tran  25.9      27 0.00058   29.1   0.4   17  109-125    31-47  (236)
189 cd01866 Rab2 Rab2 subfamily.    25.9      27 0.00058   26.9   0.4   12  108-119     7-18  (168)
190 cd03230 ABC_DR_subfamily_A Thi  25.9      27 0.00058   27.9   0.4   19  108-126    29-47  (173)
191 PRK10908 cell division protein  25.9      27 0.00058   28.7   0.4   17  109-125    32-48  (222)
192 TIGR02324 CP_lyasePhnL phospho  25.9      27 0.00058   28.7   0.4   19  108-126    37-55  (224)
193 cd03300 ABC_PotA_N PotA is an   25.8      27 0.00058   29.1   0.4   17  108-124    29-45  (232)
194 PRK13541 cytochrome c biogenes  25.8      27 0.00058   28.3   0.4   18  109-126    30-47  (195)
195 cd03256 ABC_PhnC_transporter A  25.6      27 0.00059   28.7   0.4   19  108-126    30-48  (241)
196 cd00267 ABC_ATPase ABC (ATP-bi  25.6      28  0.0006   27.1   0.4   17  109-125    29-45  (157)
197 PF06709 DUF1196:  Protein of u  25.5      18 0.00038   26.9  -0.6   11  232-242    36-46  (51)
198 PRK14260 phosphate ABC transpo  25.5      27 0.00059   29.6   0.4   19  108-126    36-54  (259)
199 PF13671 AAA_33:  AAA domain; P  25.5      26 0.00057   26.0   0.3   14  110-123     4-17  (143)
200 PRK10771 thiQ thiamine transpo  25.4      27  0.0006   28.9   0.4   18  108-125    28-45  (232)
201 TIGR03375 type_I_sec_LssB type  25.4      27 0.00058   34.0   0.4   15  108-122   494-508 (694)
202 PRK11701 phnK phosphonate C-P   25.4      28  0.0006   29.5   0.4   18  109-126    36-53  (258)
203 PRK14248 phosphate ABC transpo  25.4      27 0.00059   29.8   0.4   19  108-126    50-68  (268)
204 PRK14242 phosphate transporter  25.4      28  0.0006   29.2   0.4   18  109-126    36-53  (253)
205 cd03229 ABC_Class3 This class   25.3      28  0.0006   27.9   0.4   18  109-126    30-47  (178)
206 PRK05480 uridine/cytidine kina  25.3      28  0.0006   28.4   0.4   14  108-121     9-22  (209)
207 COG1125 OpuBA ABC-type proline  25.3      24 0.00052   33.9   0.0   18  108-125    30-47  (309)
208 PRK11124 artP arginine transpo  25.2      28  0.0006   29.0   0.4   17  109-125    32-48  (242)
209 cd03298 ABC_ThiQ_thiamine_tran  25.2      32 0.00069   28.0   0.7   18  108-125    27-44  (211)
210 cd04145 M_R_Ras_like M-Ras/R-R  25.1      28 0.00061   25.9   0.4   15  108-122     5-19  (164)
211 PRK14240 phosphate transporter  25.1      28 0.00061   29.1   0.4   19  108-126    32-50  (250)
212 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  25.0      29 0.00062   26.3   0.4   12  108-119     5-16  (166)
213 cd04127 Rab27A Rab27a subfamil  25.0      29 0.00062   26.6   0.4   13  108-120     7-19  (180)
214 PRK13645 cbiO cobalt transport  25.0      28 0.00061   30.2   0.4   18  108-125    40-57  (289)
215 PF13476 AAA_23:  AAA domain; P  25.0      30 0.00065   26.5   0.5   13  110-122    24-36  (202)
216 TIGR00968 3a0106s01 sulfate AB  24.9      29 0.00062   29.1   0.4   18  108-125    29-46  (237)
217 cd03290 ABCC_SUR1_N The SUR do  24.9      32  0.0007   28.2   0.7   20  108-127    30-49  (218)
218 PRK13639 cbiO cobalt transport  24.9      28 0.00062   30.0   0.4   19  108-126    31-49  (275)
219 cd04156 ARLTS1 ARLTS1 subfamil  24.8      30 0.00065   25.8   0.5   13  109-121     3-15  (160)
220 cd03238 ABC_UvrA The excision   24.8      29 0.00062   29.0   0.4   17  109-125    25-41  (176)
221 cd03215 ABC_Carb_Monos_II This  24.7      29 0.00063   27.9   0.4   18  109-126    30-47  (182)
222 PRK11629 lolD lipoprotein tran  24.7      29 0.00063   28.8   0.4   18  109-126    39-56  (233)
223 PRK10253 iron-enterobactin tra  24.7      29 0.00062   29.7   0.4   18  109-126    37-54  (265)
224 PRK10895 lipopolysaccharide AB  24.7      29 0.00063   28.9   0.4   19  108-126    32-50  (241)
225 TIGR03005 ectoine_ehuA ectoine  24.6      29 0.00063   29.1   0.4   18  108-125    29-46  (252)
226 PF13481 AAA_25:  AAA domain; P  24.6      28 0.00061   27.4   0.3   14  109-122    36-49  (193)
227 PRK10619 histidine/lysine/argi  24.6      29 0.00063   29.3   0.4   18  109-126    35-52  (257)
228 cd01849 YlqF_related_GTPase Yl  24.5      33 0.00072   26.8   0.7   48   76-124    62-119 (155)
229 PRK09473 oppD oligopeptide tra  24.5      26 0.00057   31.7   0.1   21  108-128    45-65  (330)
230 TIGR03597 GTPase_YqeH ribosome  24.5      30 0.00065   31.8   0.5   39   76-119   130-168 (360)
231 PRK14267 phosphate ABC transpo  24.4      29 0.00063   29.1   0.4   19  109-127    34-52  (253)
232 PRK14273 phosphate ABC transpo  24.4      30 0.00064   29.1   0.4   20  108-127    36-55  (254)
233 PRK13647 cbiO cobalt transport  24.4      29 0.00062   30.1   0.3   20  108-127    34-53  (274)
234 PF13401 AAA_22:  AAA domain; P  24.4      24 0.00052   25.7  -0.1   18  110-127     9-26  (131)
235 cd03297 ABC_ModC_molybdenum_tr  24.3      30 0.00065   28.3   0.4   17  108-124    26-42  (214)
236 cd01372 KISc_KIF4 Kinesin moto  24.2      35 0.00076   30.5   0.9   12  111-122    80-91  (341)
237 TIGR01189 ccmA heme ABC export  24.2      30 0.00065   28.0   0.4   17  109-125    30-46  (198)
238 PRK13646 cbiO cobalt transport  24.2      30 0.00064   30.2   0.4   19  108-126    36-54  (286)
239 PRK13900 type IV secretion sys  24.2      76  0.0017   29.3   3.1   90   24-124    58-179 (332)
240 PRK13632 cbiO cobalt transport  24.2      30 0.00065   29.8   0.4   17  109-125    39-55  (271)
241 PRK09493 glnQ glutamine ABC tr  24.1      30 0.00066   28.7   0.4   18  109-126    31-48  (240)
242 cd03221 ABCF_EF-3 ABCF_EF-3  E  24.0      31 0.00067   27.2   0.4   20  109-128    30-49  (144)
243 cd02023 UMPK Uridine monophosp  23.9      31 0.00067   27.9   0.4   14  110-123     4-17  (198)
244 TIGR03411 urea_trans_UrtD urea  23.9      31 0.00066   28.7   0.4   19  108-126    31-49  (242)
245 PRK13547 hmuV hemin importer A  23.9      30 0.00066   30.2   0.4   19  109-127    31-49  (272)
246 TIGR01360 aden_kin_iso1 adenyl  23.8      32 0.00069   26.8   0.5   17  109-125     7-23  (188)
247 cd00009 AAA The AAA+ (ATPases   23.8      32  0.0007   23.9   0.5   20  107-126    21-40  (151)
248 cd03240 ABC_Rad50 The catalyti  23.7      50  0.0011   27.6   1.6   16  109-124    26-41  (204)
249 cd01862 Rab7 Rab7 subfamily.    23.7      31 0.00068   25.8   0.4   15  108-122     3-17  (172)
250 PRK11545 gntK gluconate kinase  23.7      27 0.00058   28.2   0.0   13  111-123     1-13  (163)
251 PRK13159 cytochrome c-type bio  23.7   1E+02  0.0022   26.9   3.5   33   57-89     91-129 (155)
252 PRK13543 cytochrome c biogenes  23.6      31 0.00068   28.4   0.4   18  109-126    41-58  (214)
253 cd00157 Rho Rho (Ras homology)  23.5      32  0.0007   25.7   0.4   12  108-119     3-14  (171)
254 cd03220 ABC_KpsT_Wzt ABC_KpsT_  23.5      31 0.00068   28.8   0.4   18  109-126    52-69  (224)
255 PRK09580 sufC cysteine desulfu  23.5      32 0.00068   28.6   0.4   21  108-128    30-50  (248)
256 PRK11022 dppD dipeptide transp  23.5      30 0.00065   31.3   0.3   20  108-127    36-55  (326)
257 PRK13548 hmuV hemin importer A  23.4      32 0.00068   29.4   0.4   19  108-126    31-49  (258)
258 TIGR02769 nickel_nikE nickel i  23.3      32 0.00069   29.4   0.4   19  108-126    40-58  (265)
259 COG3839 MalK ABC-type sugar tr  23.3      19 0.00042   34.1  -0.9   18  108-125    32-49  (338)
260 PLN03073 ABC transporter F fam  23.3      32 0.00069   35.0   0.5   19  109-127   207-225 (718)
261 cd07386 MPP_DNA_pol_II_small_a  23.3 1.1E+02  0.0023   26.0   3.5   20   69-88     76-95  (243)
262 PRK14262 phosphate ABC transpo  23.2      32  0.0007   28.7   0.4   19  109-127    33-51  (250)
263 TIGR03719 ABC_ABC_ChvD ATP-bin  23.2      32  0.0007   32.8   0.5   18  109-126    35-52  (552)
264 PRK14247 phosphate ABC transpo  23.1      32  0.0007   28.8   0.4   20  108-127    32-51  (250)
265 TIGR03598 GTPase_YsxC ribosome  23.1      33 0.00072   27.0   0.5   14  107-120    20-33  (179)
266 PRK14270 phosphate ABC transpo  23.1      32  0.0007   28.8   0.4   19  108-126    33-51  (251)
267 TIGR02203 MsbA_lipidA lipid A   23.1      30 0.00065   32.3   0.2   15  110-124   363-377 (571)
268 PF01580 FtsK_SpoIIIE:  FtsK/Sp  23.0      25 0.00055   28.5  -0.2   18  108-125    41-58  (205)
269 cd00878 Arf_Arl Arf (ADP-ribos  23.0      40 0.00087   25.2   0.9   12  108-119     2-13  (158)
270 PRK14255 phosphate ABC transpo  22.9      33 0.00071   28.7   0.4   19  108-126    34-52  (252)
271 PRK11300 livG leucine/isoleuci  22.9      33 0.00071   28.7   0.4   18  109-126    35-52  (255)
272 cd01371 KISc_KIF3 Kinesin moto  22.9      38 0.00083   30.5   0.8   13  111-123    88-100 (333)
273 PRK13540 cytochrome c biogenes  22.8      33 0.00072   27.9   0.4   17  110-126    32-48  (200)
274 cd03275 ABC_SMC1_euk Eukaryoti  22.7      34 0.00074   29.1   0.5   10  110-119    27-36  (247)
275 PRK11264 putative amino-acid A  22.7      33 0.00072   28.6   0.4   18  108-125    32-49  (250)
276 cd03222 ABC_RNaseL_inhibitor T  22.7      30 0.00066   28.9   0.2   19  108-126    28-46  (177)
277 PRK11831 putative ABC transpor  22.7      33 0.00072   29.4   0.4   18  109-126    37-54  (269)
278 PTZ00132 GTP-binding nuclear p  22.7      33 0.00073   27.8   0.4   15  108-122    12-26  (215)
279 TIGR00958 3a01208 Conjugate Tr  22.6      33 0.00071   34.0   0.4   16  108-123   510-525 (711)
280 cd01376 KISc_KID_like Kinesin   22.6      40 0.00086   30.2   0.9   13  111-123    87-99  (319)
281 TIGR00929 VirB4_CagE type IV s  22.5      27 0.00059   34.1  -0.1   17  108-124   437-453 (785)
282 PRK07261 topology modulation p  22.5      35 0.00075   27.8   0.5   11  109-119     4-14  (171)
283 cd05721 IgV_CTLA-4 Immunoglobu  22.5 4.5E+02  0.0097   21.7   7.0   76   31-126     4-80  (115)
284 cd02021 GntK Gluconate kinase   22.5      35 0.00075   26.1   0.4   12  110-121     4-15  (150)
285 cd03248 ABCC_TAP TAP, the Tran  22.4      34 0.00074   28.1   0.4   19  108-126    43-61  (226)
286 PRK13649 cbiO cobalt transport  22.3      34 0.00074   29.4   0.4   18  109-126    37-54  (280)
287 PRK11247 ssuB aliphatic sulfon  22.3      34 0.00074   29.7   0.4   19  108-126    41-59  (257)
288 PRK14252 phosphate ABC transpo  22.3      34 0.00074   29.1   0.4   17  109-125    46-62  (265)
289 TIGR00972 3a0107s01c2 phosphat  22.3      34 0.00074   28.6   0.4   20  108-127    30-49  (247)
290 cd03276 ABC_SMC6_euk Eukaryoti  22.3      55  0.0012   27.4   1.6   14  109-122    25-38  (198)
291 cd01863 Rab18 Rab18 subfamily.  22.2      35 0.00076   25.5   0.4   12  109-120     4-15  (161)
292 PRK13633 cobalt transporter AT  22.1      35 0.00075   29.6   0.4   19  108-126    39-57  (280)
293 PRK09984 phosphonate/organopho  22.1      35 0.00075   29.0   0.4   20  108-127    33-52  (262)
294 PF07887 Calmodulin_bind:  Calm  22.1      93   0.002   29.6   3.2   33   95-127    91-125 (299)
295 PRK13636 cbiO cobalt transport  22.1      35 0.00075   29.7   0.4   18  108-125    35-52  (283)
296 PRK13637 cbiO cobalt transport  22.0      34 0.00074   29.9   0.4   18  109-126    37-54  (287)
297 PRK10247 putative ABC transpor  22.0      35 0.00077   28.3   0.4   18  109-126    37-54  (225)
298 cd04140 ARHI_like ARHI subfami  21.9      35 0.00076   26.1   0.4   15  108-122     4-18  (165)
299 cd01364 KISc_BimC_Eg5 Kinesin   21.9      42  0.0009   30.3   0.9   19  105-123    81-100 (352)
300 PF13191 AAA_16:  AAA ATPase do  21.9      26 0.00057   26.7  -0.3   19  106-124    25-43  (185)
301 cd01895 EngA2 EngA2 subfamily.  21.9      37 0.00079   24.9   0.4   14  109-122     6-19  (174)
302 PRK11248 tauB taurine transpor  21.8      35 0.00077   29.2   0.4   17  109-125    31-47  (255)
303 cd03299 ABC_ModC_like Archeal   21.8      36 0.00077   28.5   0.4   17  109-125    29-45  (235)
304 COG1123 ATPase components of v  21.8      33 0.00072   34.7   0.3   19  108-126    38-56  (539)
305 PRK14256 phosphate ABC transpo  21.7      36 0.00077   28.6   0.4   18  108-125    33-50  (252)
306 TIGR01288 nodI ATP-binding ABC  21.6      36 0.00078   29.9   0.4   19  108-126    33-51  (303)
307 cd04157 Arl6 Arl6 subfamily.    21.6      38 0.00082   25.1   0.5   13  109-121     3-15  (162)
308 cd01878 HflX HflX subfamily.    21.6      36 0.00079   27.1   0.4   13  108-120    44-56  (204)
309 PRK14244 phosphate ABC transpo  21.6      36 0.00079   28.6   0.4   16  110-125    36-51  (251)
310 PRK14268 phosphate ABC transpo  21.5      36 0.00079   28.8   0.4   19  109-127    42-60  (258)
311 cd03233 ABC_PDR_domain1 The pl  21.5      37 0.00079   28.0   0.4   21  109-129    37-57  (202)
312 TIGR03771 anch_rpt_ABC anchore  21.5      36 0.00078   28.3   0.4   17  109-125    10-26  (223)
313 cd04154 Arl2 Arl2 subfamily.    21.5      38 0.00082   26.2   0.5   12  108-119    17-28  (173)
314 cd03223 ABCD_peroxisomal_ALDP   21.4      37  0.0008   27.2   0.4   19  108-126    30-48  (166)
315 PRK15079 oligopeptide ABC tran  21.3      36 0.00079   30.9   0.4   19  108-126    50-68  (331)
316 PRK14265 phosphate ABC transpo  21.2      37 0.00081   29.4   0.4   19  108-126    49-67  (274)
317 cd03295 ABC_OpuCA_Osmoprotecti  21.2      38 0.00081   28.3   0.4   18  109-126    31-48  (242)
318 cd03244 ABCC_MRP_domain2 Domai  21.1      38 0.00082   27.6   0.4   18  109-126    34-51  (221)
319 PRK11308 dppF dipeptide transp  21.0      37  0.0008   30.8   0.4   19  108-126    44-62  (327)
320 PRK09544 znuC high-affinity zi  21.0      38 0.00082   29.1   0.4   19  108-126    33-51  (251)
321 TIGR02982 heterocyst_DevA ABC   20.9      38 0.00083   27.9   0.4   18  109-126    35-52  (220)
322 cd03271 ABC_UvrA_II The excisi  20.9      39 0.00085   30.2   0.5   13  110-122    26-38  (261)
323 cd04125 RabA_like RabA-like su  20.9      38 0.00083   26.6   0.4   11  109-119     4-14  (188)
324 PRK14272 phosphate ABC transpo  20.9      38 0.00083   28.2   0.4   19  109-127    34-52  (252)
325 PRK15134 microcin C ABC transp  20.8      37 0.00081   32.0   0.4   20  108-127    38-57  (529)
326 cd04118 Rab24 Rab24 subfamily.  20.7      39 0.00084   26.5   0.4   11  109-119     4-14  (193)
327 cd01897 NOG NOG1 is a nucleola  20.7      46 0.00099   25.0   0.8   12  108-119     3-14  (168)
328 cd01374 KISc_CENP_E Kinesin mo  20.7      45 0.00097   29.7   0.8   22  102-123    70-92  (321)
329 TIGR03740 galliderm_ABC gallid  20.7      39 0.00084   27.8   0.4   17  109-125    30-46  (223)
330 TIGR02314 ABC_MetN D-methionin  20.7      38 0.00083   31.2   0.4   18  108-125    34-51  (343)
331 PRK15056 manganese/iron transp  20.7      39 0.00084   29.1   0.4   17  109-125    37-53  (272)
332 PRK13650 cbiO cobalt transport  20.7      39 0.00084   29.4   0.4   18  109-126    37-54  (279)
333 PRK14237 phosphate transporter  20.6      39 0.00085   29.0   0.4   20  108-127    49-68  (267)
334 COG0488 Uup ATPase components   20.6      38 0.00082   33.6   0.4   18  109-126    33-50  (530)
335 cd04136 Rap_like Rap-like subf  20.6      40 0.00087   25.0   0.4   12  109-120     5-16  (163)
336 PRK14235 phosphate transporter  20.5      39 0.00086   29.0   0.4   19  109-127    49-67  (267)
337 cd04151 Arl1 Arl1 subfamily.    20.4      41 0.00089   25.4   0.5   11  109-119     3-13  (158)
338 cd01365 KISc_KIF1A_KIF1B Kines  20.4      48   0.001   30.1   1.0   13  111-123    95-107 (356)
339 cd03268 ABC_BcrA_bacitracin_re  20.4      40 0.00087   27.3   0.4   16  110-125    31-46  (208)
340 cd03237 ABC_RNaseL_inhibitor_d  20.4      40 0.00086   29.1   0.4   18  109-126    29-46  (246)
341 PRK14259 phosphate ABC transpo  20.3      40 0.00086   29.1   0.4   18  109-126    43-60  (269)
342 PRK14266 phosphate ABC transpo  20.3      40 0.00087   28.2   0.4   17  109-125    33-49  (250)
343 TIGR02322 phosphon_PhnN phosph  20.2      41 0.00088   26.5   0.4   14  110-123     6-19  (179)
344 cd04101 RabL4 RabL4 (Rab-like4  20.1      47   0.001   24.9   0.7   15  108-122     3-17  (164)
345 PRK10789 putative multidrug tr  20.1      40 0.00087   32.2   0.4   18  108-125   344-361 (569)
346 PRK13643 cbiO cobalt transport  20.0      39 0.00084   29.6   0.3   18  108-125    35-52  (288)
347 TIGR01277 thiQ thiamine ABC tr  20.0      41 0.00089   27.5   0.4   16  108-123    27-42  (213)
348 cd01850 CDC_Septin CDC/Septin.  20.0      41  0.0009   29.8   0.5   12  108-119     7-18  (276)
349 PRK11153 metN DL-methionine tr  20.0      40 0.00087   30.6   0.4   18  109-126    35-52  (343)

No 1  
>PF00853 Runt:  Runt domain;  InterPro: IPR013524 The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia []. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene []. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.  In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.  The protein is a heterodimer of alpha- and beta-subunits. The alpha-subunit binds DNA as a monomer, and appears to have a role in the development of normal hematopoiesis. CBF is a nuclear protein expressed in numerous tissue types, except brain and heart; highest levels have been found to occur in thymus, bone marrow and peripheral blood. This domain occurs towards the N terminus of the proteins in this entry.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1E50_E 1LJM_A 1CO1_A 1H9D_C 1CMO_A 1EAO_B 1HJC_D 1HJB_F 2J6W_B 1EAN_A ....
Probab=100.00  E-value=4.3e-73  Score=468.34  Aligned_cols=120  Identities=66%  Similarity=1.003  Sum_probs=105.9

Q ss_pred             hhhhhHHhhcCCCCccccCCCceEEeecCcccccCCCCCcceEEEEeeecCCCeEEEEeecCCCccccccccceeeeccc
Q psy3060          22 ERTLDSLLAEHPGELTRTGCPHVVCTVLPTHWRSNKTLPVAFKVVALGDVMDGTIVTIRAGNDENYCGELRNCTAVMKNQ  101 (268)
Q Consensus        22 er~l~~~l~eh~geLV~T~sP~~lCs~LP~HWRsNKtLP~aFkVvaLg~VpDGT~Vtv~AGNDEN~~AELRN~tAvMKNq  101 (268)
                      ||+|.|+|+|||||||+||||+|+||+||+||||||+||.+|||||||+|||||+|||+|||||||||||||++|+||||
T Consensus         1 er~~~~~l~~~~~~lv~T~sP~~lcs~LP~HWR~NKsLP~~FkVvalg~V~DGT~Vtv~AGNDEn~~aElRN~tavmknq   80 (135)
T PF00853_consen    1 ERTLHEALAEHPGELVRTDSPNFLCSVLPSHWRSNKSLPVAFKVVALGDVPDGTLVTVMAGNDENYCAELRNATAVMKNQ   80 (135)
T ss_dssp             ---HHHHHHHSTCCEEECSSTTEEEES-TSEEETTSS-SS-EEEEESSS-STTEEEEEEEEESSCSSBBEES-EEEEETT
T ss_pred             CccHHHHHHhCCcccccCCCCCEEeecccccccccCCCCCceeEEEEEEcCCCcEEEEEecCCchhhhhhhchhhhhhcc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecceeeeeccCCCceeeceEee-------eeeeeEEee----ecCccc
Q psy3060         102 VAKFNDLRFVGRSGREAEASPKDWV-------GTLIWLIGI----KNKHQQ  141 (268)
Q Consensus       102 VArFNDLRFVGRSGRGKsFtlti~v-------~t~~~~i~v----~~~hrq  141 (268)
                      |||||||||||||||||||+|||+|       +||++||||    ||++|.
T Consensus        81 vA~FnDLRFvGRSGRGKsFtltItv~t~PpqvAty~~AIKVTVDGPRePR~  131 (135)
T PF00853_consen   81 VARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRS  131 (135)
T ss_dssp             EEEESS-EECST-TTTSEEEEEEEE-SSS-EEEEECCEEEEESS-SSCCG-
T ss_pred             cccccccccccccCCccceEEEEEEeCCCchHHhheeeEEEEecCCCCCcc
Confidence            9999999999999999999999996       889999999    555554


No 2  
>KOG3982|consensus
Probab=100.00  E-value=5.5e-73  Score=530.35  Aligned_cols=154  Identities=56%  Similarity=0.811  Sum_probs=144.8

Q ss_pred             HHHhhhhhhHHhhcCCCCccccCCCceEEeecCcccccCCCCCcceEEEEeeecCCCeEEEEeecCCCccccccccceee
Q psy3060          18 EVLAERTLDSLLAEHPGELTRTGCPHVVCTVLPTHWRSNKTLPVAFKVVALGDVMDGTIVTIRAGNDENYCGELRNCTAV   97 (268)
Q Consensus        18 ~~~~er~l~~~l~eh~geLV~T~sP~~lCs~LP~HWRsNKtLP~aFkVvaLg~VpDGT~Vtv~AGNDEN~~AELRN~tAv   97 (268)
                      +.+.||+|+|+|+|||||||+||||+|||++||+|||||||||++|||||||||||||+||||||||||||||||||+|+
T Consensus        94 mt~~~rt~~~~laehpgeLvrT~SPn~lcs~LP~HWRsNKtlp~aFkVvaLgdVpDgT~Vti~aGNDEnyc~ElRN~tA~  173 (475)
T KOG3982|consen   94 MTLVFRTVVEFLAEHPGELVRTSSPNFLCSVLPTHWRSNKTLPVAFKVVALGDVPDGTLVTIMAGNDENYCAELRNCTAV  173 (475)
T ss_pred             hhhhHHHHHHHHHhCccceeecCCCceeeecCcchhccCCcccceeEEEEecccCCCcEEEEEecCCcchhHHhhhhHHH
Confidence            56799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccceeeecceeeeeccCCCceeeceEee-------eeeeeEEee----ecCcc-cchhhh-hhhhhhhhhhhHHHHHhh
Q psy3060          98 MKNQVAKFNDLRFVGRSGREAEASPKDWV-------GTLIWLIGI----KNKHQ-QYEIEI-SFLINQITASISELLRMY  164 (268)
Q Consensus        98 MKNqVArFNDLRFVGRSGRGKsFtlti~v-------~t~~~~i~v----~~~hr-q~~~~~-~~~~~~~s~~lsel~r~~  164 (268)
                      |||||||||||||||||||||||||||+|       +||+++|||    ||+.| +|..+. .....+|.+++++++|+.
T Consensus       174 mknQVAkFNDLRFVGRSGRGKsFtLTIti~TnP~qvATy~kaIKVTVDGPRepRr~K~~~~~k~~~~~~~~r~~~~~~~~  253 (475)
T KOG3982|consen  174 MKNQVAKFNDLRFVGRSGRGKSFTLTITIFTNPPQVATYHKAIKVTVDGPREPRRSKLSDQTKPQAEQFPDRFGDLERLP  253 (475)
T ss_pred             HHhhhhhhccceeecccCCCcceEEEEEEecCCcceeeeeceEEEeccCCCccccccccccccCCccccccccCchhhcC
Confidence            99999999999999999999999999996       889999999    78888 766554 223358999999999999


Q ss_pred             hhhcccc
Q psy3060         165 EKTLRLG  171 (268)
Q Consensus       165 ~~~mr~~  171 (268)
                      ...||++
T Consensus       254 ~~pm~~~  260 (475)
T KOG3982|consen  254 GPPMRVT  260 (475)
T ss_pred             CCCcccC
Confidence            9999997


No 3  
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=67.99  E-value=2.5  Score=30.43  Aligned_cols=16  Identities=13%  Similarity=0.229  Sum_probs=12.8

Q ss_pred             ceeeeeccCCCceeec
Q psy3060         107 DLRFVGRSGREAEASP  122 (268)
Q Consensus       107 DLRFVGRSGRGKsFtl  122 (268)
                      |+-++|++|.|||=-+
T Consensus         1 ~i~i~G~~~~GKssl~   16 (159)
T cd04159           1 EITLVGLQNSGKTTLV   16 (159)
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            5678999999998443


No 4  
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=64.94  E-value=2.5  Score=32.99  Aligned_cols=13  Identities=15%  Similarity=0.243  Sum_probs=11.0

Q ss_pred             eeeccCCCceeec
Q psy3060         110 FVGRSGREAEASP  122 (268)
Q Consensus       110 FVGRSGRGKsFtl  122 (268)
                      |+|+||.|||=-+
T Consensus       107 ~~G~~nvGKStli  119 (157)
T cd01858         107 FIGYPNVGKSSII  119 (157)
T ss_pred             EEeCCCCChHHHH
Confidence            8999999998543


No 5  
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=56.92  E-value=11  Score=32.52  Aligned_cols=52  Identities=17%  Similarity=0.227  Sum_probs=30.6

Q ss_pred             eEEEEeecCCCccc-------cccccceeeeccceeeeccee----------eeeccCCCceeeceEeee
Q psy3060          75 TIVTIRAGNDENYC-------GELRNCTAVMKNQVAKFNDLR----------FVGRSGREAEASPKDWVG  127 (268)
Q Consensus        75 T~Vtv~AGNDEN~~-------AELRN~tAvMKNqVArFNDLR----------FVGRSGRGKsFtlti~v~  127 (268)
                      |+|-|...|+|..-       =+++|-+-...+. .-|+|+-          .+|.||.|||=-|.+..+
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~-~il~~vsl~i~~Ge~~~I~G~nGsGKSTLl~~i~G   72 (271)
T PRK14238          4 TVVNVQVKNEEKIETAPKKVVFDTQNLNLWYGED-HALKNINLDIHENEVTAIIGPSGCGKSTYIKTLNR   72 (271)
T ss_pred             eEEEEEecchhhhccCCCceEEEEeeeEEEECCc-ceeeeeEEEEcCCCEEEEECCCCCCHHHHHHHHHh
Confidence            67777777777532       2445544433322 2345543          589999999965555443


No 6  
>PF12846 AAA_10:  AAA-like domain
Probab=56.08  E-value=3.5  Score=33.57  Aligned_cols=16  Identities=19%  Similarity=0.410  Sum_probs=13.6

Q ss_pred             eeeccCCCceeeceEe
Q psy3060         110 FVGRSGREAEASPKDW  125 (268)
Q Consensus       110 FVGRSGRGKsFtlti~  125 (268)
                      ++|.+|.|||+.+.-.
T Consensus         6 i~G~tGsGKT~~~~~l   21 (304)
T PF12846_consen    6 ILGKTGSGKTTLLKNL   21 (304)
T ss_pred             EECCCCCcHHHHHHHH
Confidence            6899999999988744


No 7  
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=55.66  E-value=4.7  Score=32.58  Aligned_cols=15  Identities=33%  Similarity=0.567  Sum_probs=11.8

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +=+|||+|.|||=.+
T Consensus         3 i~lvG~~g~GKSsl~   17 (196)
T cd01852           3 LVLVGKTGAGKSATG   17 (196)
T ss_pred             EEEECCCCCCHHHHH
Confidence            347999999998544


No 8  
>TIGR03729 acc_ester putative phosphoesterase. Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system.
Probab=53.76  E-value=12  Score=31.52  Aligned_cols=42  Identities=26%  Similarity=0.482  Sum_probs=28.2

Q ss_pred             CeEEEEeecCCCcc----ccccccc--eeeeccceeee--cceeeeeccC
Q psy3060          74 GTIVTIRAGNDENY----CGELRNC--TAVMKNQVAKF--NDLRFVGRSG  115 (268)
Q Consensus        74 GT~Vtv~AGNDEN~----~AELRN~--tAvMKNqVArF--NDLRFVGRSG  115 (268)
                      +..|.+-.||-|.+    ..+++..  .-.+.+....|  +++||+|=.|
T Consensus        61 ~~pv~~v~GNHD~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~ig~~g  110 (239)
T TIGR03729        61 GIKVTFNAGNHDMLKDLTYEEIESNDSPLYLHNRFIDIPNTQWRIIGNNG  110 (239)
T ss_pred             CCcEEEECCCCCCCCCCCHHHHHhccchhhhcccccccCCCceEEEeecc
Confidence            45677889999975    2335542  12456666677  8999999664


No 9  
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=53.56  E-value=5.5  Score=29.67  Aligned_cols=20  Identities=25%  Similarity=0.380  Sum_probs=15.1

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +-++|++|.|||=-|.+..+
T Consensus        14 ~~i~G~nGsGKStLl~~l~g   33 (137)
T PF00005_consen   14 VAIVGPNGSGKSTLLKALAG   33 (137)
T ss_dssp             EEEEESTTSSHHHHHHHHTT
T ss_pred             EEEEccCCCccccceeeecc
Confidence            35799999999976665543


No 10 
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=53.50  E-value=12  Score=38.36  Aligned_cols=51  Identities=29%  Similarity=0.293  Sum_probs=35.6

Q ss_pred             EEEeecCCCccccccccceeeeccc--eeeecceeeeeccCCCceeeceEeeeeeee---EEee
Q psy3060          77 VTIRAGNDENYCGELRNCTAVMKNQ--VAKFNDLRFVGRSGREAEASPKDWVGTLIW---LIGI  135 (268)
Q Consensus        77 Vtv~AGNDEN~~AELRN~tAvMKNq--VArFNDLRFVGRSGRGKsFtlti~v~t~~~---~i~v  135 (268)
                      |+.+=+.|++  .-|+|..=.+++.  ||      .|||||+|||==+.+..+-|.+   .|.+
T Consensus       477 vsf~y~~~~~--~vL~~isL~I~~Ge~va------IvG~SGsGKSTL~KLL~gly~p~~G~I~~  532 (709)
T COG2274         477 VSFRYGPDDP--PVLEDLSLEIPPGEKVA------IVGRSGSGKSTLLKLLLGLYKPQQGRILL  532 (709)
T ss_pred             EEEEeCCCCc--chhhceeEEeCCCCEEE------EECCCCCCHHHHHHHHhcCCCCCCceEEE
Confidence            5566666655  4566666666666  55      6999999999777777766666   5655


No 11 
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=52.95  E-value=21  Score=31.81  Aligned_cols=53  Identities=21%  Similarity=0.211  Sum_probs=35.2

Q ss_pred             hhHHhhcCCCCccccCCCceEEeecCcccccCCCCCcceEEEEeee--cCCCe-EEEEeecCCCccc
Q psy3060          25 LDSLLAEHPGELTRTGCPHVVCTVLPTHWRSNKTLPVAFKVVALGD--VMDGT-IVTIRAGNDENYC   88 (268)
Q Consensus        25 l~~~l~eh~geLV~T~sP~~lCs~LP~HWRsNKtLP~aFkVvaLg~--VpDGT-~Vtv~AGNDEN~~   88 (268)
                      +.+.++...|.-+-.++|.+-+. ||          ...+|-+.++  .+.|+ .++|+--+..+.+
T Consensus        42 ~~~~l~~~~~~~l~~~~p~~~~~-l~----------~g~Rv~~~~~p~~~~~~~~i~IRk~~~~~~s   97 (308)
T TIGR02788        42 LARAIASFSKQSISEENPILSAT-LP----------GGERVQIVIPPACENDTVSITIRKPSLVDFS   97 (308)
T ss_pred             HHHHHHHHhCCcccCCCceEEEE-CC----------CCeEEEEECCCcccCCCceEEEECCCCCCCC
Confidence            34445566676677799988877 34          4457766653  45676 8889887766654


No 12 
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=52.93  E-value=5.2  Score=31.86  Aligned_cols=45  Identities=11%  Similarity=0.127  Sum_probs=26.4

Q ss_pred             eEEEEeecCCCccccccccceeee-----ccceeeec----ceeeeeccCCCcee
Q psy3060          75 TIVTIRAGNDENYCGELRNCTAVM-----KNQVAKFN----DLRFVGRSGREAEA  120 (268)
Q Consensus        75 T~Vtv~AGNDEN~~AELRN~tAvM-----KNqVArFN----DLRFVGRSGRGKsF  120 (268)
                      ..+.++|-++++ ..||++....+     ++.-+++.    .+.++|+||.|||=
T Consensus        77 ~vi~iSa~~~~g-i~~L~~~l~~~l~~~~~~~~~~~~~~~~~~~~~G~~~vGKst  130 (171)
T cd01856          77 KVLFVNAKSGKG-VKKLLKAAKKLLKDIEKLKAKGLLPRGIRAMVVGIPNVGKST  130 (171)
T ss_pred             eEEEEECCCccc-HHHHHHHHHHHHHHHhhhhhcccCCCCeEEEEECCCCCCHHH
Confidence            356778777665 45565543332     01111111    37899999999974


No 13 
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=49.83  E-value=6.8  Score=28.66  Aligned_cols=12  Identities=17%  Similarity=0.401  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      .-++|++|.|||
T Consensus         2 V~iiG~~~~GKS   13 (116)
T PF01926_consen    2 VAIIGRPNVGKS   13 (116)
T ss_dssp             EEEEESTTSSHH
T ss_pred             EEEECCCCCCHH
Confidence            348999999998


No 14 
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=48.03  E-value=6  Score=29.18  Aligned_cols=16  Identities=13%  Similarity=0.227  Sum_probs=0.0

Q ss_pred             eeeccCCCceeeceEe
Q psy3060         110 FVGRSGREAEASPKDW  125 (268)
Q Consensus       110 FVGRSGRGKsFtlti~  125 (268)
                      +||.+|.|||--|...
T Consensus         4 iiG~N~sGKS~il~ai   19 (303)
T PF13304_consen    4 IIGPNGSGKSNILEAI   19 (303)
T ss_dssp             ----------------
T ss_pred             cccccccccccccccc
Confidence            6899999999766543


No 15 
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=47.83  E-value=10  Score=31.48  Aligned_cols=16  Identities=13%  Similarity=0.163  Sum_probs=12.7

Q ss_pred             eeeeccCCCceeeceE
Q psy3060         109 RFVGRSGREAEASPKD  124 (268)
Q Consensus       109 RFVGRSGRGKsFtlti  124 (268)
                      -++|.+|.|||=-|..
T Consensus        32 ~i~G~NGsGKSTll~~   47 (213)
T cd03279          32 LICGPTGAGKSTILDA   47 (213)
T ss_pred             EEECCCCCCHHHHHHH
Confidence            3899999999965554


No 16 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=47.72  E-value=8.7  Score=27.82  Aligned_cols=17  Identities=24%  Similarity=0.395  Sum_probs=13.3

Q ss_pred             ceeeeeccCCCceeece
Q psy3060         107 DLRFVGRSGREAEASPK  123 (268)
Q Consensus       107 DLRFVGRSGRGKsFtlt  123 (268)
                      |+=++|.+|.|||--+.
T Consensus         1 ~i~l~G~~g~GKTtL~~   17 (170)
T cd01876           1 EIAFAGRSNVGKSSLIN   17 (170)
T ss_pred             CEEEEcCCCCCHHHHHH
Confidence            45689999999986544


No 17 
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=46.40  E-value=7.9  Score=28.69  Aligned_cols=12  Identities=25%  Similarity=0.443  Sum_probs=10.4

Q ss_pred             eeeeccCCCcee
Q psy3060         109 RFVGRSGREAEA  120 (268)
Q Consensus       109 RFVGRSGRGKsF  120 (268)
                      =++|++|.|||=
T Consensus         4 ~v~G~~~~GKTt   15 (164)
T smart00175        4 ILIGDSGVGKSS   15 (164)
T ss_pred             EEECCCCCCHHH
Confidence            479999999984


No 18 
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=45.81  E-value=8.5  Score=39.49  Aligned_cols=95  Identities=16%  Similarity=0.121  Sum_probs=52.6

Q ss_pred             hhHHhhcCCCCcccc--CCCceEEeecCcccccCCCCCcc--eEEEEeeecCCCeEEEEeecCCCcccc---ccccceee
Q psy3060          25 LDSLLAEHPGELTRT--GCPHVVCTVLPTHWRSNKTLPVA--FKVVALGDVMDGTIVTIRAGNDENYCG---ELRNCTAV   97 (268)
Q Consensus        25 l~~~l~eh~geLV~T--~sP~~lCs~LP~HWRsNKtLP~a--FkVvaLg~VpDGT~Vtv~AGNDEN~~A---ELRN~tAv   97 (268)
                      +..++++..-.+++-  ....-+++.||.+|+.|.-.+.-  .-+.++-  |   ...+..|...+.|.   +-..+.+.
T Consensus       396 v~~~l~~~g~~~~~e~~~~~~af~a~lPg~~~~~~r~~~itt~n~a~l~--p---~~~~~~G~~~~~~~~~~~~~~~l~~  470 (852)
T PRK13891        396 VEKAINRLGFAARIETINTMDAYLGSLPGHGVENVRRPLINTMNLADLL--P---TSSIWTGSATAPCPMYPPLSPALMH  470 (852)
T ss_pred             HHHHHHhCCcEEEEcccccHHHHHhcCCCCcccccccccccchhhHHhh--h---hccccCCccCCCCcccCCCCCceEE
Confidence            556666664444433  45677889999988765433220  0011111  1   22456676665432   22344444


Q ss_pred             ecccee---eec----c---eeeeeccCCCceeeceE
Q psy3060          98 MKNQVA---KFN----D---LRFVGRSGREAEASPKD  124 (268)
Q Consensus        98 MKNqVA---rFN----D---LRFVGRSGRGKsFtlti  124 (268)
                      +++.-.   +||    |   .-.+|.||.||||.+.-
T Consensus       471 ~~t~~~~p~~fN~h~~d~gh~~I~G~tGsGKS~l~~~  507 (852)
T PRK13891        471 CVTVGATPFRLNLHVRDLGHTFMFGPTGAGKSTHLGI  507 (852)
T ss_pred             EecCCCCceEEEeEeCCCCeEEEECCCCCCHHHHHHH
Confidence            444332   556    2   35789999999998753


No 19 
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=45.67  E-value=7  Score=29.31  Aligned_cols=10  Identities=20%  Similarity=0.255  Sum_probs=9.2

Q ss_pred             eeeccCCCce
Q psy3060         110 FVGRSGREAE  119 (268)
Q Consensus       110 FVGRSGRGKs  119 (268)
                      |+|++|.|||
T Consensus         1 iiG~~~~GKS   10 (176)
T cd01881           1 LVGLPNVGKS   10 (176)
T ss_pred             CCCCCCCcHH
Confidence            6899999998


No 20 
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=45.35  E-value=8.1  Score=36.49  Aligned_cols=10  Identities=40%  Similarity=0.591  Sum_probs=9.3

Q ss_pred             eeeccCCCce
Q psy3060         110 FVGRSGREAE  119 (268)
Q Consensus       110 FVGRSGRGKs  119 (268)
                      +||+||.|||
T Consensus       360 iVG~sGsGKS  369 (567)
T COG1132         360 IVGPSGSGKS  369 (567)
T ss_pred             EECCCCCCHH
Confidence            7999999996


No 21 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=44.80  E-value=8.3  Score=35.47  Aligned_cols=17  Identities=18%  Similarity=0.132  Sum_probs=13.4

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -+||.||+|||=-|.|.
T Consensus        33 silGpSGcGKSTLLrii   49 (248)
T COG1116          33 AILGPSGCGKSTLLRLI   49 (248)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999999666554


No 22 
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=44.49  E-value=8.8  Score=32.49  Aligned_cols=15  Identities=13%  Similarity=0.162  Sum_probs=11.9

Q ss_pred             eeeeccCCCceeece
Q psy3060         109 RFVGRSGREAEASPK  123 (268)
Q Consensus       109 RFVGRSGRGKsFtlt  123 (268)
                      =+||.||.|||=.|.
T Consensus        29 ~IvG~NGsGKStll~   43 (251)
T cd03273          29 AITGLNGSGKSNILD   43 (251)
T ss_pred             EEECCCCCCHHHHHH
Confidence            379999999985544


No 23 
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=44.17  E-value=14  Score=30.96  Aligned_cols=17  Identities=24%  Similarity=0.182  Sum_probs=12.8

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -.+|.||.|||=-|.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l   49 (253)
T TIGR02323        33 GIVGESGSGKSTLLGCL   49 (253)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            45899999999655544


No 24 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=43.98  E-value=15  Score=29.76  Aligned_cols=19  Identities=26%  Similarity=0.167  Sum_probs=13.6

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||==|.+..
T Consensus        30 ~~i~G~nGsGKSTLl~~l~   48 (214)
T cd03292          30 VFLVGPSGAGKSTLLKLIY   48 (214)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999995554443


No 25 
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=43.52  E-value=11  Score=28.32  Aligned_cols=17  Identities=12%  Similarity=0.272  Sum_probs=13.1

Q ss_pred             eecceeeeeccCCCcee
Q psy3060         104 KFNDLRFVGRSGREAEA  120 (268)
Q Consensus       104 rFNDLRFVGRSGRGKsF  120 (268)
                      +--.+=++|.+|.|||=
T Consensus         6 ~~~~v~v~G~~~~GKSs   22 (169)
T cd04114           6 FLFKIVLIGNAGVGKTC   22 (169)
T ss_pred             ceeEEEEECCCCCCHHH
Confidence            33457799999999983


No 26 
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=42.43  E-value=10  Score=30.36  Aligned_cols=18  Identities=17%  Similarity=0.189  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .=++|.||.|||=.+.+.
T Consensus        18 v~I~GpSGsGKSTLl~~l   35 (107)
T cd00820          18 VLITGDSGIGKTELALEL   35 (107)
T ss_pred             EEEEcCCCCCHHHHHHHh
Confidence            357899999999776664


No 27 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=42.02  E-value=10  Score=28.01  Aligned_cols=20  Identities=15%  Similarity=0.298  Sum_probs=14.5

Q ss_pred             ceeeec----ceeeeeccCCCcee
Q psy3060         101 QVAKFN----DLRFVGRSGREAEA  120 (268)
Q Consensus       101 qVArFN----DLRFVGRSGRGKsF  120 (268)
                      +...|+    ..=+.|.+|.|||=
T Consensus        15 ~~~~~~~~g~~tli~G~nGsGKST   38 (62)
T PF13555_consen   15 ETIDFDPRGDVTLITGPNGSGKST   38 (62)
T ss_pred             eEEeecCCCcEEEEECCCCCCHHH
Confidence            455564    25689999999983


No 28 
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=41.51  E-value=16  Score=34.25  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=10.9

Q ss_pred             eeeccCCCceeece
Q psy3060         110 FVGRSGREAEASPK  123 (268)
Q Consensus       110 FVGRSGRGKsFtlt  123 (268)
                      .+|+||.|||=-|.
T Consensus        35 iIG~SGaGKSTLLR   48 (258)
T COG3638          35 IIGPSGAGKSTLLR   48 (258)
T ss_pred             EECCCCCcHHHHHH
Confidence            47999999985443


No 29 
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=41.16  E-value=10  Score=33.42  Aligned_cols=15  Identities=13%  Similarity=0.377  Sum_probs=11.7

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +=++|++|.|||=.+
T Consensus        34 IllvG~tGvGKSSli   48 (249)
T cd01853          34 ILVLGKTGVGKSSTI   48 (249)
T ss_pred             EEEECCCCCcHHHHH
Confidence            447999999998443


No 30 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=40.95  E-value=12  Score=28.04  Aligned_cols=13  Identities=23%  Similarity=0.373  Sum_probs=11.4

Q ss_pred             ceeeeeccCCCce
Q psy3060         107 DLRFVGRSGREAE  119 (268)
Q Consensus       107 DLRFVGRSGRGKs  119 (268)
                      |+=+||++|.|||
T Consensus         2 ~v~ivG~~~~GKS   14 (170)
T cd01898           2 DVGLVGLPNAGKS   14 (170)
T ss_pred             CeEEECCCCCCHH
Confidence            5668999999997


No 31 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=40.75  E-value=11  Score=32.13  Aligned_cols=33  Identities=18%  Similarity=0.272  Sum_probs=20.4

Q ss_pred             ecCCCccccccccceeeeccceeeecceeeeeccCCCceee
Q psy3060          81 AGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEAS  121 (268)
Q Consensus        81 AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsFt  121 (268)
                      ..++.....|||..   +++++     .=|+|-||.|||=-
T Consensus        19 S~~~~~g~~~l~~~---l~~k~-----~vl~G~SGvGKSSL   51 (161)
T PF03193_consen   19 SAKTGEGIEELKEL---LKGKT-----SVLLGQSGVGKSSL   51 (161)
T ss_dssp             BTTTTTTHHHHHHH---HTTSE-----EEEECSTTSSHHHH
T ss_pred             eCCCCcCHHHHHHH---hcCCE-----EEEECCCCCCHHHH
Confidence            33355556666643   33333     34799999999843


No 32 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=40.55  E-value=12  Score=27.33  Aligned_cols=11  Identities=18%  Similarity=0.368  Sum_probs=9.5

Q ss_pred             eeeccCCCcee
Q psy3060         110 FVGRSGREAEA  120 (268)
Q Consensus       110 FVGRSGRGKsF  120 (268)
                      .+|.||.|||-
T Consensus         4 I~G~~gsGKST   14 (121)
T PF13207_consen    4 ISGPPGSGKST   14 (121)
T ss_dssp             EEESTTSSHHH
T ss_pred             EECCCCCCHHH
Confidence            57999999984


No 33 
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=40.26  E-value=12  Score=31.05  Aligned_cols=13  Identities=31%  Similarity=0.411  Sum_probs=10.7

Q ss_pred             eeeeccCCCceee
Q psy3060         109 RFVGRSGREAEAS  121 (268)
Q Consensus       109 RFVGRSGRGKsFt  121 (268)
                      =++|++|.|||=-
T Consensus        27 ~i~GpNGsGKStl   39 (243)
T cd03272          27 VVVGRNGSGKSNF   39 (243)
T ss_pred             EEECCCCCCHHHH
Confidence            3899999999843


No 34 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=38.98  E-value=12  Score=28.34  Aligned_cols=13  Identities=8%  Similarity=0.192  Sum_probs=11.1

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +=++|.+|.|||=
T Consensus        17 v~i~G~~g~GKSt   29 (173)
T cd04155          17 ILILGLDNAGKTT   29 (173)
T ss_pred             EEEEccCCCCHHH
Confidence            5589999999983


No 35 
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=38.96  E-value=12  Score=34.94  Aligned_cols=31  Identities=13%  Similarity=0.095  Sum_probs=18.1

Q ss_pred             ccccceeeeccceeeecceeeeeccCCCceeeceE
Q psy3060          90 ELRNCTAVMKNQVAKFNDLRFVGRSGREAEASPKD  124 (268)
Q Consensus        90 ELRN~tAvMKNqVArFNDLRFVGRSGRGKsFtlti  124 (268)
                      -|+|.+-.++.+    .=.=+||.||.|||=-+.+
T Consensus       350 vL~~isl~i~~G----~~vaIvG~SGsGKSTLl~l  380 (529)
T TIGR02868       350 VLDGVSLDLPPG----ERVAILGPSGSGKSTLLML  380 (529)
T ss_pred             eeecceEEEcCC----CEEEEECCCCCCHHHHHHH
Confidence            355554444332    1234799999999943333


No 36 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=38.93  E-value=12  Score=27.60  Aligned_cols=11  Identities=27%  Similarity=0.277  Sum_probs=9.8

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =++|++|.|||
T Consensus         4 ~~vG~~~vGKT   14 (168)
T cd04119           4 ISMGNSGVGKS   14 (168)
T ss_pred             EEECCCCCCHH
Confidence            48999999996


No 37 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=38.84  E-value=12  Score=29.32  Aligned_cols=17  Identities=24%  Similarity=0.167  Sum_probs=12.4

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|.||.|||=-+...
T Consensus         5 ~l~G~~GsGKsTl~~~L   21 (180)
T TIGR03263         5 VISGPSGVGKSTLVKAL   21 (180)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            37899999999644333


No 38 
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=37.79  E-value=13  Score=32.31  Aligned_cols=38  Identities=21%  Similarity=0.253  Sum_probs=23.8

Q ss_pred             EEEEeecCCCccccccccceeeeccceeeecceeeeeccCCCceeec
Q psy3060          76 IVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEASP  122 (268)
Q Consensus        76 ~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsFtl  122 (268)
                      .+.++|-+.++ -.||.+..+   ++     -.=|+|.||.|||=-|
T Consensus       100 v~~~SAktg~g-i~eLf~~l~---~~-----~~~~~G~sgvGKStLi  137 (245)
T TIGR00157       100 VLMTSSKNQDG-LKELIEALQ---NR-----ISVFAGQSGVGKSSLI  137 (245)
T ss_pred             EEEEecCCchh-HHHHHhhhc---CC-----EEEEECCCCCCHHHHH
Confidence            34567777665 455665433   22     2349999999998443


No 39 
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=37.44  E-value=13  Score=30.35  Aligned_cols=12  Identities=25%  Similarity=0.459  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|+||.|||
T Consensus         4 I~i~G~~g~GKS   15 (197)
T cd04104           4 IAVTGESGAGKS   15 (197)
T ss_pred             EEEECCCCCCHH
Confidence            347999999998


No 40 
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=37.20  E-value=13  Score=30.25  Aligned_cols=19  Identities=16%  Similarity=0.298  Sum_probs=14.2

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-|.+..
T Consensus        31 ~~i~G~nGsGKSTLl~~l~   49 (220)
T cd03263          31 FGLLGHNGAGKTTTLKMLT   49 (220)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4578999999996555543


No 41 
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=37.07  E-value=13  Score=26.52  Aligned_cols=12  Identities=25%  Similarity=0.493  Sum_probs=10.4

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-++|.+|.|||
T Consensus         3 i~~~G~~~~GKS   14 (159)
T cd00154           3 IVLIGDSGVGKT   14 (159)
T ss_pred             EEEECCCCCCHH
Confidence            347999999998


No 42 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=36.85  E-value=11  Score=31.10  Aligned_cols=17  Identities=18%  Similarity=0.300  Sum_probs=14.1

Q ss_pred             eeeccCCCceeeceEee
Q psy3060         110 FVGRSGREAEASPKDWV  126 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v  126 (268)
                      .+|.+|.|||+++...+
T Consensus        28 I~G~TGsGKS~~~~~ll   44 (229)
T PF01935_consen   28 IFGTTGSGKSNTVKVLL   44 (229)
T ss_pred             EECCCCCCHHHHHHHHH
Confidence            46999999999987654


No 43 
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=35.79  E-value=32  Score=26.51  Aligned_cols=14  Identities=14%  Similarity=0.261  Sum_probs=11.7

Q ss_pred             ceeeeeccCCCcee
Q psy3060         107 DLRFVGRSGREAEA  120 (268)
Q Consensus       107 DLRFVGRSGRGKsF  120 (268)
                      -.=|+|.||.|||=
T Consensus        85 ~~~~~G~~~vGKst   98 (141)
T cd01857          85 TIGLVGYPNVGKSS   98 (141)
T ss_pred             EEEEECCCCCCHHH
Confidence            35699999999985


No 44 
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=35.79  E-value=14  Score=29.98  Aligned_cols=19  Identities=21%  Similarity=0.371  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-|.+..
T Consensus        29 ~~i~G~nGsGKSTLl~~l~   47 (222)
T cd03224          29 VALLGRNGAGKTTLLKTIM   47 (222)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996555443


No 45 
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=35.77  E-value=13  Score=28.73  Aligned_cols=44  Identities=16%  Similarity=0.119  Sum_probs=28.4

Q ss_pred             EEEEeecCCCccccccccceeeeccceeeecceeeeeccCCCcee
Q psy3060          76 IVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEA  120 (268)
Q Consensus        76 ~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsF  120 (268)
                      .+.++|-+.++ ..||++....+-..-++.-..-++|.||.|||=
T Consensus        73 ~~~iSa~~~~g-i~~L~~~l~~~~~~~~~~~~~~~ig~~~~Gkss  116 (156)
T cd01859          73 VVYVSAKERLG-TKILRRTIKELAKIDGKEGKVGVVGYPNVGKSS  116 (156)
T ss_pred             EEEEEcccccc-HHHHHHHHHHHHhhcCCCcEEEEECCCCCCHHH
Confidence            46677766655 466776655433333344456899999999974


No 46 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=35.56  E-value=15  Score=29.81  Aligned_cols=19  Identities=16%  Similarity=0.142  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-|.+..
T Consensus        30 ~~l~G~nGsGKSTLl~~l~   48 (211)
T cd03225          30 VLIVGPNGSGKSTLLRLLN   48 (211)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4468999999997666554


No 47 
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=35.53  E-value=12  Score=27.48  Aligned_cols=10  Identities=20%  Similarity=0.328  Sum_probs=8.9

Q ss_pred             eeeccCCCce
Q psy3060         110 FVGRSGREAE  119 (268)
Q Consensus       110 FVGRSGRGKs  119 (268)
                      ++|++|.|||
T Consensus         1 l~G~~~~GKs   10 (158)
T cd01879           1 LVGNPNVGKT   10 (158)
T ss_pred             CCCCCCCCHH
Confidence            5899999997


No 48 
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=35.30  E-value=15  Score=29.48  Aligned_cols=19  Identities=16%  Similarity=0.190  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|+||.|||=-|.+..
T Consensus        21 ~~i~G~nGsGKSTLl~~i~   39 (190)
T TIGR01166        21 LALLGANGAGKSTLLLHLN   39 (190)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996665544


No 49 
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=35.23  E-value=15  Score=27.18  Aligned_cols=12  Identities=25%  Similarity=0.548  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|++|.|||
T Consensus         3 v~liG~~~vGKS   14 (142)
T TIGR02528         3 IMFIGSVGCGKT   14 (142)
T ss_pred             EEEECCCCCCHH
Confidence            347999999998


No 50 
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=35.06  E-value=15  Score=30.61  Aligned_cols=16  Identities=19%  Similarity=0.237  Sum_probs=12.5

Q ss_pred             eeeeccCCCceeeceE
Q psy3060         109 RFVGRSGREAEASPKD  124 (268)
Q Consensus       109 RFVGRSGRGKsFtlti  124 (268)
                      -++|+||.|||=-+..
T Consensus        26 ~i~G~nGsGKStll~a   41 (197)
T cd03278          26 AIVGPNGSGKSNIIDA   41 (197)
T ss_pred             EEECCCCCCHHHHHHH
Confidence            3899999999855543


No 51 
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=34.78  E-value=15  Score=29.86  Aligned_cols=18  Identities=22%  Similarity=0.270  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|+||.|||=-|.+..
T Consensus        29 ~l~G~nGsGKSTLl~~l~   46 (213)
T cd03235          29 AIVGPNGAGKSTLLKAIL   46 (213)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            468999999996665544


No 52 
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=34.73  E-value=16  Score=33.07  Aligned_cols=14  Identities=21%  Similarity=0.349  Sum_probs=11.5

Q ss_pred             eeeeccCCCceeec
Q psy3060         109 RFVGRSGREAEASP  122 (268)
Q Consensus       109 RFVGRSGRGKsFtl  122 (268)
                      =++|+||+|||--|
T Consensus        17 viIG~sGSGKT~li   30 (241)
T PF04665_consen   17 VIIGKSGSGKTTLI   30 (241)
T ss_pred             EEECCCCCCHHHHH
Confidence            37999999999644


No 53 
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=34.60  E-value=15  Score=29.77  Aligned_cols=19  Identities=11%  Similarity=0.151  Sum_probs=14.6

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|.||.|||=-|.+..
T Consensus        28 ~~i~G~nGsGKSTLl~~l~   46 (211)
T cd03264          28 YGLLGPNGAGKTTLMRILA   46 (211)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            5579999999997665543


No 54 
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=34.59  E-value=16  Score=30.82  Aligned_cols=12  Identities=25%  Similarity=0.326  Sum_probs=10.5

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=|.|.||.|||
T Consensus        17 vLi~G~sG~GKS   28 (149)
T cd01918          17 VLITGPSGIGKS   28 (149)
T ss_pred             EEEEcCCCCCHH
Confidence            348999999999


No 55 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=34.49  E-value=16  Score=27.39  Aligned_cols=12  Identities=8%  Similarity=0.163  Sum_probs=10.4

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-++|++|.|||
T Consensus         2 i~~vG~~~~GKs   13 (167)
T cd04160           2 VLILGLDNAGKT   13 (167)
T ss_pred             EEEEecCCCCHH
Confidence            458999999998


No 56 
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=34.48  E-value=16  Score=27.56  Aligned_cols=13  Identities=23%  Similarity=0.455  Sum_probs=10.9

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +=++|++|.|||-
T Consensus         6 i~vvG~~~~GKSs   18 (165)
T cd01868           6 IVLIGDSGVGKSN   18 (165)
T ss_pred             EEEECCCCCCHHH
Confidence            4589999999983


No 57 
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=34.36  E-value=16  Score=30.86  Aligned_cols=17  Identities=18%  Similarity=0.235  Sum_probs=13.4

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =|+|++|.|||=.|.+.
T Consensus        29 ~ivGpNGaGKSTll~~i   45 (212)
T cd03274          29 AIVGPNGSGKSNVIDSM   45 (212)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            38999999998666553


No 58 
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=34.34  E-value=15  Score=34.66  Aligned_cols=13  Identities=31%  Similarity=0.422  Sum_probs=10.7

Q ss_pred             eeeeccCCCceee
Q psy3060         109 RFVGRSGREAEAS  121 (268)
Q Consensus       109 RFVGRSGRGKsFt  121 (268)
                      =.||+||.|||==
T Consensus       380 aIvG~SGsGKSTL  392 (588)
T PRK11174        380 ALVGPSGAGKTSL  392 (588)
T ss_pred             EEECCCCCCHHHH
Confidence            4699999999943


No 59 
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=34.29  E-value=13  Score=25.33  Aligned_cols=11  Identities=36%  Similarity=0.498  Sum_probs=9.2

Q ss_pred             eeeccCCCcee
Q psy3060         110 FVGRSGREAEA  120 (268)
Q Consensus       110 FVGRSGRGKsF  120 (268)
                      ++|.+|.|||=
T Consensus         1 iiG~~~~GKSt   11 (157)
T cd00882           1 VVGDSGVGKTS   11 (157)
T ss_pred             CCCcCCCcHHH
Confidence            47999999984


No 60 
>PRK12288 GTPase RsgA; Reviewed
Probab=34.25  E-value=15  Score=34.06  Aligned_cols=40  Identities=20%  Similarity=0.322  Sum_probs=26.0

Q ss_pred             eEEEEeecCCCccccccccceeeeccceeeecceeeeeccCCCceeece
Q psy3060          75 TIVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEASPK  123 (268)
Q Consensus        75 T~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsFtlt  123 (268)
                      ..+.++|-+.++ ..||++...   +++     .=|+|.||.|||=-|.
T Consensus       184 ~v~~vSA~tg~G-ideL~~~L~---~ki-----~~~vG~sgVGKSTLiN  223 (347)
T PRK12288        184 RVLMVSSHTGEG-LEELEAALT---GRI-----SIFVGQSGVGKSSLIN  223 (347)
T ss_pred             eEEEEeCCCCcC-HHHHHHHHh---hCC-----EEEECCCCCCHHHHHH
Confidence            456677777776 456665442   333     3489999999995443


No 61 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=34.23  E-value=16  Score=26.50  Aligned_cols=12  Identities=17%  Similarity=0.315  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|.+|.|||
T Consensus         4 i~l~G~~~~GKs   15 (157)
T cd04164           4 VVIVGKPNVGKS   15 (157)
T ss_pred             EEEECCCCCCHH
Confidence            347899999998


No 62 
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=34.18  E-value=16  Score=30.30  Aligned_cols=18  Identities=22%  Similarity=0.259  Sum_probs=13.2

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=.+|.||.|||=-|.+.
T Consensus        29 ~~l~G~nGsGKSTLl~~l   46 (235)
T cd03261          29 LAIIGPSGSGKSTLLRLI   46 (235)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            346899999999555444


No 63 
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=33.94  E-value=16  Score=33.19  Aligned_cols=19  Identities=21%  Similarity=0.300  Sum_probs=14.2

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|+||.|||=-|.+..
T Consensus       111 v~IvG~~GsGKSTLl~~L~  129 (329)
T PRK14257        111 TAFIGPSGCGKSTFLRNLN  129 (329)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4579999999996555444


No 64 
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=33.81  E-value=16  Score=29.61  Aligned_cols=18  Identities=22%  Similarity=0.095  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =++|.||.|||=-+.+..
T Consensus        32 ~l~G~nGsGKSTLl~~i~   49 (214)
T TIGR02673        32 FLTGPSGAGKTTLLKLLY   49 (214)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996665543


No 65 
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=33.79  E-value=16  Score=30.52  Aligned_cols=12  Identities=17%  Similarity=0.529  Sum_probs=10.3

Q ss_pred             eeeccCCCceee
Q psy3060         110 FVGRSGREAEAS  121 (268)
Q Consensus       110 FVGRSGRGKsFt  121 (268)
                      ++|++|.|||=.
T Consensus         5 llG~tGsGKSs~   16 (212)
T PF04548_consen    5 LLGKTGSGKSSL   16 (212)
T ss_dssp             EECSTTSSHHHH
T ss_pred             EECCCCCCHHHH
Confidence            689999999943


No 66 
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=33.71  E-value=19  Score=26.41  Aligned_cols=14  Identities=7%  Similarity=0.138  Sum_probs=11.4

Q ss_pred             eeeeeccCCCceee
Q psy3060         108 LRFVGRSGREAEAS  121 (268)
Q Consensus       108 LRFVGRSGRGKsFt  121 (268)
                      +-++|.+|.|||=-
T Consensus         3 i~i~G~~~~GKStl   16 (162)
T cd04123           3 VVLLGEGRVGKTSL   16 (162)
T ss_pred             EEEECCCCCCHHHH
Confidence            45899999999853


No 67 
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=33.65  E-value=16  Score=35.51  Aligned_cols=17  Identities=24%  Similarity=0.272  Sum_probs=12.6

Q ss_pred             eeeeeccCCCceeeceE
Q psy3060         108 LRFVGRSGREAEASPKD  124 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti  124 (268)
                      +-.||+||.|||==+.+
T Consensus       482 vaIvG~sGsGKSTLlkl  498 (686)
T TIGR03797       482 VAIVGPSGSGKSTLLRL  498 (686)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            44799999999944433


No 68 
>PF05356 Phage_Coat_B:  Phage Coat protein B ;  InterPro: IPR008020 The major coat protein in the capsid of filamentous bacteriophage forms a helical assembly of about 7000 identical protomers, with each protomer comprised of 46 amino acids, after the cleavage of the signal peptide. Each protomer forms a slightly curved helix that combines to form a tubular structure that encapsulates the viral DNA [].; PDB: 1QL1_A 2XKM_A 4IFM_A 1QL2_A 1IFM_A 2KLV_A 1IFN_A 2IFN_A 3IFM_A 2KSJ_A ....
Probab=33.64  E-value=14  Score=29.76  Aligned_cols=15  Identities=33%  Similarity=0.406  Sum_probs=0.0

Q ss_pred             eeccceeeecceeee
Q psy3060          97 VMKNQVAKFNDLRFV  111 (268)
Q Consensus        97 vMKNqVArFNDLRFV  111 (268)
                      -||||+||||-.|=.
T Consensus         3 ~mkq~i~kf~~v~sf   17 (83)
T PF05356_consen    3 GMKQAIAKFRPVPSF   17 (83)
T ss_dssp             ---------------
T ss_pred             hHHHHHHhcCCcHHH
Confidence            599999999988643


No 69 
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=33.51  E-value=26  Score=29.78  Aligned_cols=32  Identities=16%  Similarity=0.167  Sum_probs=18.6

Q ss_pred             cccceeeeccceeeecc-e-eeeeccCCCceeece
Q psy3060          91 LRNCTAVMKNQVAKFND-L-RFVGRSGREAEASPK  123 (268)
Q Consensus        91 LRN~tAvMKNqVArFND-L-RFVGRSGRGKsFtlt  123 (268)
                      |+|.... ++..-.|++ + =|+|++|.|||=-|.
T Consensus         8 i~nfr~~-~~~~i~~~~g~n~i~G~NgsGKS~lle   41 (213)
T cd03277           8 LENFVTY-DETEFRPGPSLNMIIGPNGSGKSSIVC   41 (213)
T ss_pred             EeCCCCc-ceeEEecCCCeEEEECCCCCCHHHHHH
Confidence            4444443 333334554 2 589999999984443


No 70 
>PF10442 FIST_C:  FIST C domain;  InterPro: IPR019494  This entry represents a novel sensory domain, designated FIST C (short for F-box and intracellular signal transduction, C-terminal), which is present in signal transduction proteins from bacteria, archaea and eukaryotes. The chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids []. 
Probab=33.27  E-value=15  Score=28.02  Aligned_cols=34  Identities=21%  Similarity=0.311  Sum_probs=28.0

Q ss_pred             EEEeeecCCCeEEEEeecCCCccccccccceeee
Q psy3060          65 VVALGDVMDGTIVTIRAGNDENYCGELRNCTAVM   98 (268)
Q Consensus        65 VvaLg~VpDGT~Vtv~AGNDEN~~AELRN~tAvM   98 (268)
                      +.-.++|+.|+.|.++-+|-+...+.++.+...+
T Consensus        50 l~~~~~v~eG~~v~l~~~~~~~~~~~~~~~~~~~   83 (136)
T PF10442_consen   50 LTFAGDVPEGSEVQLMEGDPEDIIESAEEALEKA   83 (136)
T ss_pred             EEEeeecCCCCEEEEEcCCHHHHHHHHHHHHHhh
Confidence            3455899999999999999888888877776665


No 71 
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=32.95  E-value=17  Score=35.53  Aligned_cols=19  Identities=32%  Similarity=0.284  Sum_probs=13.6

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.||+||.|||=-+.+..
T Consensus       503 vaIvG~SGsGKSTLlklL~  521 (708)
T TIGR01193       503 TTIVGMSGSGKSTLAKLLV  521 (708)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4579999999994444433


No 72 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=32.92  E-value=17  Score=25.44  Aligned_cols=12  Identities=17%  Similarity=0.199  Sum_probs=10.1

Q ss_pred             eeeeccCCCcee
Q psy3060         109 RFVGRSGREAEA  120 (268)
Q Consensus       109 RFVGRSGRGKsF  120 (268)
                      -++|.+|.|||=
T Consensus         5 ~~~G~~~~GKst   16 (161)
T TIGR00231         5 VIVGDPNVGKST   16 (161)
T ss_pred             EEECCCCCCHHH
Confidence            479999999973


No 73 
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=32.90  E-value=17  Score=29.81  Aligned_cols=18  Identities=11%  Similarity=0.093  Sum_probs=13.6

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -++|+||.|||=-+.+..
T Consensus        32 ~i~G~nGsGKSTLl~~l~   49 (207)
T PRK13539         32 VLTGPNGSGKTTLLRLIA   49 (207)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996665543


No 74 
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=32.81  E-value=82  Score=29.04  Aligned_cols=92  Identities=12%  Similarity=0.125  Sum_probs=58.6

Q ss_pred             hhhhhHHhhcCCCCccccCCCceEEeecCcccccCCCCCcceEEEEe-eecCCCeEEEEeecCCCcccc-ccccc-----
Q psy3060          22 ERTLDSLLAEHPGELTRTGCPHVVCTVLPTHWRSNKTLPVAFKVVAL-GDVMDGTIVTIRAGNDENYCG-ELRNC-----   94 (268)
Q Consensus        22 er~l~~~l~eh~geLV~T~sP~~lCs~LP~HWRsNKtLP~aFkVvaL-g~VpDGT~Vtv~AGNDEN~~A-ELRN~-----   94 (268)
                      .+.+.+.|+...|.-+-..+|.+-|. ||.         ...+|-+. .++.+|..++|+--....+.- +|.+.     
T Consensus        66 ~~~~~~~lA~~~g~~~~~~~P~l~~~-lp~---------~G~Rv~~~~~p~~~g~~~~IRk~~~~~~tl~~l~~~g~~~~  135 (319)
T PRK13894         66 AQAIIETIAGYHGKEVTRSKPILEGE-LPL---------DGSRFAGQLPPVVPAPTFAIRKKAVAIFTLDQYVERGIMTA  135 (319)
T ss_pred             HHHHHHHHHHHcCCcccCCCceEEEE-cCC---------CCEEEEEEcCCcCCCcEEEEECCCCCCCCHHHHHhcCCCCH
Confidence            35777888999999999999966554 341         23455443 456678889999866544332 23211     


Q ss_pred             --eeeeccceeeecceeeeeccCCCceeece
Q psy3060          95 --TAVMKNQVAKFNDLRFVGRSGREAEASPK  123 (268)
Q Consensus        95 --tAvMKNqVArFNDLRFVGRSGRGKsFtlt  123 (268)
                        .+.++..+..=..+=++|..|.||+=.+.
T Consensus       136 ~~~~~L~~~v~~~~~ilI~G~tGSGKTTll~  166 (319)
T PRK13894        136 AQREAIIAAVRAHRNILVIGGTGSGKTTLVN  166 (319)
T ss_pred             HHHHHHHHHHHcCCeEEEECCCCCCHHHHHH
Confidence              12344444444557789999999995443


No 75 
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=32.77  E-value=17  Score=34.25  Aligned_cols=18  Identities=28%  Similarity=0.385  Sum_probs=13.5

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .=.||+||.|||==+.+.
T Consensus       372 ~aIvG~sGsGKSTLl~ll  389 (582)
T PRK11176        372 VALVGRSGSGKSTIANLL  389 (582)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457999999999655443


No 76 
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=32.71  E-value=17  Score=29.46  Aligned_cols=19  Identities=11%  Similarity=0.270  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-|.+..
T Consensus        29 ~~i~G~nGsGKSTLl~~l~   47 (210)
T cd03269          29 FGLLGPNGAGKTTTIRMIL   47 (210)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4468999999996665554


No 77 
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=32.50  E-value=18  Score=29.29  Aligned_cols=18  Identities=17%  Similarity=0.134  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (213)
T cd03262          30 VIIGPSGSGKSTLLRCIN   47 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996555443


No 78 
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=32.46  E-value=18  Score=29.73  Aligned_cols=18  Identities=17%  Similarity=0.244  Sum_probs=13.6

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-+.+..
T Consensus        30 ~i~G~nGsGKSTLl~~i~   47 (220)
T cd03265          30 GLLGPNGAGKTTTIKMLT   47 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996655543


No 79 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=32.45  E-value=18  Score=26.57  Aligned_cols=12  Identities=33%  Similarity=0.432  Sum_probs=10.2

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|.+|.|||
T Consensus         4 i~iiG~~~vGKT   15 (162)
T cd04138           4 LVVVGAGGVGKS   15 (162)
T ss_pred             EEEECCCCCCHH
Confidence            347999999997


No 80 
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=32.35  E-value=16  Score=37.40  Aligned_cols=20  Identities=25%  Similarity=0.358  Sum_probs=15.2

Q ss_pred             eeeeccCCCceeeceEeeee
Q psy3060         109 RFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~t  128 (268)
                      -.+||||+|||=-|.+..+.
T Consensus       368 AIlG~SGsGKSTllqLl~~~  387 (573)
T COG4987         368 AILGRSGSGKSTLLQLLAGA  387 (573)
T ss_pred             EEECCCCCCHHHHHHHHHhc
Confidence            46999999999776665543


No 81 
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=32.26  E-value=18  Score=29.51  Aligned_cols=19  Identities=26%  Similarity=0.232  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-|.+..
T Consensus        32 ~~i~G~nGsGKSTLl~~l~   50 (216)
T TIGR00960        32 VFLVGHSGAGKSTFLKLIL   50 (216)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999996665554


No 82 
>PLN03232 ABC transporter C family member; Provisional
Probab=32.19  E-value=17  Score=39.45  Aligned_cols=25  Identities=20%  Similarity=0.365  Sum_probs=16.0

Q ss_pred             cccceeeeccceeeecceeeeeccCCCce
Q psy3060          91 LRNCTAVMKNQVAKFNDLRFVGRSGREAE  119 (268)
Q Consensus        91 LRN~tAvMKNqVArFNDLRFVGRSGRGKs  119 (268)
                      |+|-+-.++-+    .=.=+|||||.|||
T Consensus      1252 L~~isl~I~~G----ekvaIVG~SGSGKS 1276 (1495)
T PLN03232       1252 LHGLSFFVSPS----EKVGVVGRTGAGKS 1276 (1495)
T ss_pred             cccceEEEcCC----CEEEEECCCCCCHH
Confidence            55554444332    22457999999999


No 83 
>PRK00098 GTPase RsgA; Reviewed
Probab=32.07  E-value=18  Score=32.27  Aligned_cols=39  Identities=21%  Similarity=0.288  Sum_probs=23.2

Q ss_pred             EEEEeecCCCccccccccceeeeccceeeecceeeeeccCCCceeece
Q psy3060          76 IVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEASPK  123 (268)
Q Consensus        76 ~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsFtlt  123 (268)
                      .+.++|-+.++ ..+|+...   ++.+     .=|+|+||.|||=-|.
T Consensus       144 v~~vSA~~g~g-i~~L~~~l---~gk~-----~~~~G~sgvGKStlin  182 (298)
T PRK00098        144 VLELSAKEGEG-LDELKPLL---AGKV-----TVLAGQSGVGKSTLLN  182 (298)
T ss_pred             EEEEeCCCCcc-HHHHHhhc---cCce-----EEEECCCCCCHHHHHH
Confidence            34566666555 34555432   2322     4589999999985443


No 84 
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=31.61  E-value=18  Score=29.37  Aligned_cols=19  Identities=11%  Similarity=0.207  Sum_probs=13.7

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        34 ~~i~G~nGsGKSTLl~~l~   52 (218)
T cd03266          34 TGLLGPNGAGKTTTLRMLA   52 (218)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4578999999995554443


No 85 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=31.60  E-value=20  Score=26.47  Aligned_cols=11  Identities=9%  Similarity=0.054  Sum_probs=9.7

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =++|++|.|||
T Consensus         4 ~i~G~~~~GKs   14 (164)
T cd04171           4 GTAGHIDHGKT   14 (164)
T ss_pred             EEEecCCCCHH
Confidence            47999999997


No 86 
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=31.46  E-value=18  Score=34.29  Aligned_cols=19  Identities=21%  Similarity=0.375  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.||+||.|||==+.+..+
T Consensus       371 aIvG~SGsGKSTLl~lL~g  389 (592)
T PRK10790        371 ALVGHTGSGKSTLASLLMG  389 (592)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            4689999999954444433


No 87 
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=31.35  E-value=19  Score=26.36  Aligned_cols=13  Identities=23%  Similarity=0.271  Sum_probs=10.6

Q ss_pred             eeeeccCCCceee
Q psy3060         109 RFVGRSGREAEAS  121 (268)
Q Consensus       109 RFVGRSGRGKsFt  121 (268)
                      =++|.+|.||+=-
T Consensus         3 ~i~G~~~~GKTsl   15 (160)
T cd00876           3 VVLGAGGVGKSAI   15 (160)
T ss_pred             EEECCCCCCHHHH
Confidence            3799999999853


No 88 
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=31.33  E-value=18  Score=26.42  Aligned_cols=16  Identities=13%  Similarity=0.198  Sum_probs=12.6

Q ss_pred             eeeccCCCceeeceEe
Q psy3060         110 FVGRSGREAEASPKDW  125 (268)
Q Consensus       110 FVGRSGRGKsFtlti~  125 (268)
                      +.|.+|.|||.-+...
T Consensus         4 i~G~~G~GKT~l~~~i   19 (165)
T cd01120           4 VFGPTGSGKTTLALQL   19 (165)
T ss_pred             EeCCCCCCHHHHHHHH
Confidence            5799999999865443


No 89 
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain. Dbr1 is an RNA lariat debranching enzyme that hydrolyzes 2'-5' phosphodiester bonds at the branch points of excised intron lariats.  This alignment model represents the N-terminal metallophosphatase domain of Dbr1.  This domain belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal s
Probab=31.16  E-value=83  Score=28.29  Aligned_cols=44  Identities=25%  Similarity=0.232  Sum_probs=30.6

Q ss_pred             EEeecCCCccc--------ccccc-ceeeeccceeeecceeeeeccCCCceee
Q psy3060          78 TIRAGNDENYC--------GELRN-CTAVMKNQVAKFNDLRFVGRSGREAEAS  121 (268)
Q Consensus        78 tv~AGNDEN~~--------AELRN-~tAvMKNqVArFNDLRFVGRSGRGKsFt  121 (268)
                      ..--||-|+..        .+++. ..-.|+-+|-+++.||+.|=||..|.+.
T Consensus        77 ~fi~GNHE~~~~l~~l~~gg~v~~Ni~~Lg~~~v~~~~GlrIaGLsG~~~~~~  129 (262)
T cd00844          77 IFIGGNHEASNYLWELPYGGWVAPNIYYLGYAGVVNFGGLRIAGLSGIYKSHD  129 (262)
T ss_pred             EEECCCCCCHHHHHhhcCCCeecCcEEEecCCCEEEECCeEEEEecccccccc
Confidence            44568888732        23333 3344566899999999999999988664


No 90 
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=31.03  E-value=19  Score=29.51  Aligned_cols=18  Identities=22%  Similarity=0.209  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|.||.|||=-|.+.
T Consensus        33 ~~i~G~nGsGKSTLl~~l   50 (220)
T cd03293          33 VALVGPSGCGKSTLLRII   50 (220)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457899999998655443


No 91 
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=30.90  E-value=19  Score=29.56  Aligned_cols=19  Identities=16%  Similarity=0.235  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-+.+..
T Consensus        39 ~~i~G~nGsGKSTLl~~i~   57 (228)
T PRK10584         39 IALIGESGSGKSTLLAILA   57 (228)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3468999999996555543


No 92 
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=30.42  E-value=20  Score=29.20  Aligned_cols=19  Identities=26%  Similarity=0.426  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-|.+..
T Consensus        34 ~~i~G~nGsGKSTLl~~l~   52 (228)
T cd03257          34 LGLVGESGSGKSTLARAIL   52 (228)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996655544


No 93 
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=30.39  E-value=20  Score=30.34  Aligned_cols=20  Identities=20%  Similarity=0.262  Sum_probs=14.8

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +=++|.||.|||=-|.+..+
T Consensus        33 ~~i~G~nGsGKSTLl~~laG   52 (258)
T PRK14241         33 TAFIGPSGCGKSTVLRTLNR   52 (258)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34689999999976655544


No 94 
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=30.31  E-value=19  Score=34.86  Aligned_cols=14  Identities=21%  Similarity=0.271  Sum_probs=11.1

Q ss_pred             eeeeccCCCceeec
Q psy3060         109 RFVGRSGREAEASP  122 (268)
Q Consensus       109 RFVGRSGRGKsFtl  122 (268)
                      =.+||||.|||==|
T Consensus        36 GIIG~SGAGKSTLi   49 (339)
T COG1135          36 GIIGYSGAGKSTLL   49 (339)
T ss_pred             EEEcCCCCcHHHHH
Confidence            36999999999544


No 95 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=30.24  E-value=23  Score=26.09  Aligned_cols=12  Identities=25%  Similarity=0.360  Sum_probs=10.5

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-++|.+|.|||
T Consensus         3 i~~~G~~~~GKT   14 (164)
T cd04139           3 VIVVGAGGVGKS   14 (164)
T ss_pred             EEEECCCCCCHH
Confidence            458999999998


No 96 
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=30.22  E-value=20  Score=26.69  Aligned_cols=14  Identities=21%  Similarity=0.256  Sum_probs=11.2

Q ss_pred             eeeeeccCCCceee
Q psy3060         108 LRFVGRSGREAEAS  121 (268)
Q Consensus       108 LRFVGRSGRGKsFt  121 (268)
                      +-++|++|.|||=-
T Consensus         4 i~v~G~~~~GKSsl   17 (163)
T cd01860           4 LVLLGDSSVGKSSL   17 (163)
T ss_pred             EEEECCCCCCHHHH
Confidence            45899999999843


No 97 
>PLN03130 ABC transporter C family member; Provisional
Probab=30.18  E-value=19  Score=39.66  Aligned_cols=13  Identities=31%  Similarity=0.618  Sum_probs=10.9

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +=+|||||.|||=
T Consensus      1268 VaIVGrSGSGKST 1280 (1622)
T PLN03130       1268 VGIVGRTGAGKSS 1280 (1622)
T ss_pred             EEEECCCCCCHHH
Confidence            4579999999983


No 98 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=30.17  E-value=23  Score=32.95  Aligned_cols=15  Identities=20%  Similarity=0.299  Sum_probs=12.1

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +-++|.||+|||=-|
T Consensus        31 v~iiGpSGSGKSTlL   45 (240)
T COG1126          31 VVIIGPSGSGKSTLL   45 (240)
T ss_pred             EEEECCCCCCHHHHH
Confidence            457999999999554


No 99 
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=30.05  E-value=20  Score=29.48  Aligned_cols=18  Identities=11%  Similarity=0.078  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (236)
T cd03219          30 GLIGPNGAGKTTLFNLIS   47 (236)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            468999999996655544


No 100
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.
Probab=29.97  E-value=20  Score=34.92  Aligned_cols=18  Identities=28%  Similarity=0.289  Sum_probs=13.1

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .-.||+||.|||=-+.+.
T Consensus       508 vaIvG~sGsGKSTLlklL  525 (710)
T TIGR03796       508 VALVGGSGSGKSTIAKLV  525 (710)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457999999999444443


No 101
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=29.88  E-value=21  Score=29.43  Aligned_cols=19  Identities=21%  Similarity=0.251  Sum_probs=14.2

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        29 ~~l~G~nGsGKSTLl~~l~   47 (230)
T TIGR03410        29 TCVLGRNGVGKTTLLKTLM   47 (230)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4468999999996665544


No 102
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=29.81  E-value=21  Score=26.59  Aligned_cols=12  Identities=17%  Similarity=0.213  Sum_probs=10.1

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|.+|.|||
T Consensus         3 v~~vG~~~~GKT   14 (162)
T cd04106           3 VIVVGNGNVGKS   14 (162)
T ss_pred             EEEECCCCCCHH
Confidence            347999999996


No 103
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=29.79  E-value=21  Score=30.18  Aligned_cols=14  Identities=21%  Similarity=0.252  Sum_probs=11.2

Q ss_pred             eeeeccCCCceeec
Q psy3060         109 RFVGRSGREAEASP  122 (268)
Q Consensus       109 RFVGRSGRGKsFtl  122 (268)
                      =.+|.||.|||=-+
T Consensus        25 ~l~G~sGsGKSTL~   38 (226)
T cd03270          25 VITGVSGSGKSSLA   38 (226)
T ss_pred             EEEcCCCCCHHHHH
Confidence            36899999999553


No 104
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=29.69  E-value=17  Score=35.77  Aligned_cols=18  Identities=22%  Similarity=0.270  Sum_probs=14.9

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .=.+|.||.||||.+.-.
T Consensus       433 ~~I~G~tGsGKS~~~~~l  450 (797)
T TIGR02746       433 IAVVGGSGAGKSFFMQEL  450 (797)
T ss_pred             eEEEcCCCCCHHHHHHHH
Confidence            568999999999998543


No 105
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=29.68  E-value=21  Score=26.55  Aligned_cols=12  Identities=17%  Similarity=0.321  Sum_probs=10.2

Q ss_pred             eeeeccCCCcee
Q psy3060         109 RFVGRSGREAEA  120 (268)
Q Consensus       109 RFVGRSGRGKsF  120 (268)
                      =++|++|.|||=
T Consensus         4 ~liG~~~~GKSs   15 (161)
T cd01861           4 VFLGDQSVGKTS   15 (161)
T ss_pred             EEECCCCCCHHH
Confidence            479999999983


No 106
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=29.64  E-value=29  Score=28.25  Aligned_cols=29  Identities=24%  Similarity=0.310  Sum_probs=17.0

Q ss_pred             cccceeee-ccceeeecc--eeeeeccCCCce
Q psy3060          91 LRNCTAVM-KNQVAKFND--LRFVGRSGREAE  119 (268)
Q Consensus        91 LRN~tAvM-KNqVArFND--LRFVGRSGRGKs  119 (268)
                      |.|..... ++..-.|+.  .-|+|.+|.|||
T Consensus         7 i~nFr~~~~~~~~~~~~~~~~~i~G~NGsGKS   38 (220)
T PF02463_consen    7 IENFRNFKGKNAELSFSPGLNVIVGPNGSGKS   38 (220)
T ss_dssp             EESBTTC-SCEEEEETTSSEEEEEESTTSSHH
T ss_pred             EcCceEEecCeEEEecCCCCEEEEcCCCCCHH
Confidence            34444443 344445555  567899999987


No 107
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=29.61  E-value=21  Score=28.69  Aligned_cols=19  Identities=16%  Similarity=0.034  Sum_probs=14.4

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.+|.||.|||=-|.+..+
T Consensus        28 ~i~G~nGsGKSTLl~~l~G   46 (206)
T TIGR03608        28 AIIGESGSGKSTLLNIIGL   46 (206)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            4689999999976665543


No 108
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=29.56  E-value=21  Score=29.96  Aligned_cols=17  Identities=24%  Similarity=0.366  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|+||.|||=-|.+.
T Consensus        33 ~i~G~nGsGKSTLl~~i   49 (250)
T PRK14245         33 AFIGPSGCGKSTFLRLF   49 (250)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999999666554


No 109
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=29.45  E-value=21  Score=28.88  Aligned_cols=17  Identities=18%  Similarity=0.259  Sum_probs=12.6

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|-||.|||=-+...
T Consensus         6 ~l~G~sGsGKsTl~~~l   22 (186)
T PRK10078          6 WLMGPSGSGKDSLLAAL   22 (186)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            37899999998544443


No 110
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=29.43  E-value=21  Score=29.01  Aligned_cols=17  Identities=24%  Similarity=0.190  Sum_probs=12.9

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-|.+.
T Consensus        34 ~l~G~nGsGKSTLl~~i   50 (218)
T cd03255          34 AIVGPSGSGKSTLLNIL   50 (218)
T ss_pred             EEEcCCCCCHHHHHHHH
Confidence            46899999999655544


No 111
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Probab=29.42  E-value=21  Score=33.52  Aligned_cols=15  Identities=27%  Similarity=0.317  Sum_probs=11.4

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      .=.+|+||.|||==+
T Consensus       369 i~IvG~sGsGKSTLl  383 (576)
T TIGR02204       369 VALVGPSGAGKSTLF  383 (576)
T ss_pred             EEEECCCCCCHHHHH
Confidence            346999999998433


No 112
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=29.37  E-value=21  Score=28.22  Aligned_cols=15  Identities=27%  Similarity=0.379  Sum_probs=11.8

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      .=++|++|.|||=-+
T Consensus         4 i~~iG~~~~GKstl~   18 (158)
T PRK15467          4 IAFVGAVGAGKTTLF   18 (158)
T ss_pred             EEEECCCCCCHHHHH
Confidence            458999999998443


No 113
>KOG3587|consensus
Probab=29.32  E-value=48  Score=27.03  Aligned_cols=21  Identities=10%  Similarity=-0.152  Sum_probs=19.2

Q ss_pred             CCceeeceEeeeeeeeEEeee
Q psy3060         116 REAEASPKDWVGTLIWLIGIK  136 (268)
Q Consensus       116 RGKsFtlti~v~t~~~~i~v~  136 (268)
                      +|+.|.|+|.+...+-.|.|.
T Consensus        86 ~g~~F~l~I~~~~~~~~I~VN  106 (143)
T KOG3587|consen   86 PGQPFDLTILVEEDKFQIFVN  106 (143)
T ss_pred             CCCeEEEEEEEccCeEEEEEC
Confidence            589999999999999999984


No 114
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=29.30  E-value=24  Score=32.82  Aligned_cols=18  Identities=28%  Similarity=0.350  Sum_probs=13.2

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      |=.||.||+|||=-..+.
T Consensus        36 lgivGeSGsGKSTL~r~l   53 (252)
T COG1124          36 LGIVGESGSGKSTLARLL   53 (252)
T ss_pred             EEEEcCCCCCHHHHHHHH
Confidence            456999999999544433


No 115
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=29.24  E-value=21  Score=29.81  Aligned_cols=17  Identities=18%  Similarity=0.176  Sum_probs=13.0

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|+||.|||=-+.+.
T Consensus        15 ~i~G~nGsGKSTLl~~l   31 (230)
T TIGR01184        15 SLIGHSGCGKSTLLNLI   31 (230)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999998655544


No 116
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=29.24  E-value=21  Score=29.40  Aligned_cols=17  Identities=18%  Similarity=0.186  Sum_probs=13.2

Q ss_pred             eeeeeccCCCceeeceE
Q psy3060         108 LRFVGRSGREAEASPKD  124 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti  124 (268)
                      +-++|.||.|||--+.+
T Consensus         6 i~l~G~sGsGKSTl~~~   22 (176)
T PRK09825          6 YILMGVSGSGKSLIGSK   22 (176)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            35799999999965543


No 117
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=29.23  E-value=21  Score=29.27  Aligned_cols=18  Identities=11%  Similarity=0.137  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|.||.|||=-|.+.
T Consensus        29 ~~l~G~nGsGKSTLl~~l   46 (232)
T cd03218          29 VGLLGPNGAGKTTTFYMI   46 (232)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457899999999655444


No 118
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=29.20  E-value=21  Score=29.38  Aligned_cols=18  Identities=22%  Similarity=0.320  Sum_probs=13.1

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|.||.|||=-+.+.
T Consensus        34 ~~l~G~nGsGKSTLl~~l   51 (233)
T cd03258          34 FGIIGRSGAGKSTLIRCI   51 (233)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            346899999999554443


No 119
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP). This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved.
Probab=29.12  E-value=21  Score=38.92  Aligned_cols=26  Identities=23%  Similarity=0.442  Sum_probs=16.9

Q ss_pred             ccccceeeeccceeeecceeeeeccCCCce
Q psy3060          90 ELRNCTAVMKNQVAKFNDLRFVGRSGREAE  119 (268)
Q Consensus        90 ELRN~tAvMKNqVArFNDLRFVGRSGRGKs  119 (268)
                      -|+|-+-.++.+    .=+=+|||||.|||
T Consensus      1301 vL~~is~~I~~G----ekiaIVGrTGsGKS 1326 (1522)
T TIGR00957      1301 VLRHINVTIHGG----EKVGIVGRTGAGKS 1326 (1522)
T ss_pred             cccceeEEEcCC----CEEEEECCCCCCHH
Confidence            355555444433    23558999999999


No 120
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=29.07  E-value=22  Score=28.96  Aligned_cols=19  Identities=21%  Similarity=0.202  Sum_probs=13.5

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-+.+..
T Consensus        29 ~~i~G~nGsGKSTLl~~l~   47 (213)
T cd03259          29 LALLGPSGCGKTTLLRLIA   47 (213)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999995555443


No 121
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=29.07  E-value=21  Score=30.00  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=|||++|.||+
T Consensus         4 imliG~~g~GKT   15 (143)
T PF10662_consen    4 IMLIGPSGSGKT   15 (143)
T ss_pred             EEEECCCCCCHH
Confidence            348999999997


No 122
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=29.00  E-value=21  Score=36.30  Aligned_cols=31  Identities=19%  Similarity=0.057  Sum_probs=20.0

Q ss_pred             ecceeeeeccCCCceeeceEeee---eeeeEEee
Q psy3060         105 FNDLRFVGRSGREAEASPKDWVG---TLIWLIGI  135 (268)
Q Consensus       105 FNDLRFVGRSGRGKsFtlti~v~---t~~~~i~v  135 (268)
                      ++-.=+||+||.|||=-+..-.+   -+.-.|++
T Consensus       347 g~~talvG~SGaGKSTLl~lL~G~~~~~~G~I~v  380 (559)
T COG4988         347 GQLTALVGASGAGKSTLLNLLLGFLAPTQGEIRV  380 (559)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCcCCCCCceEEE
Confidence            33445899999999966554432   24555665


No 123
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=28.97  E-value=22  Score=29.05  Aligned_cols=19  Identities=16%  Similarity=0.209  Sum_probs=13.9

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|+||.|||=-|.+..
T Consensus        29 ~~i~G~nGsGKSTLl~~l~   47 (201)
T cd03231          29 LQVTGPNGSGKTTLLRILA   47 (201)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996655443


No 124
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=28.61  E-value=22  Score=33.70  Aligned_cols=18  Identities=17%  Similarity=0.196  Sum_probs=13.3

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .-+||+||.|||=-+.+-
T Consensus       352 ~aivG~sGsGKSTL~~ll  369 (547)
T PRK10522        352 LFLIGGNGSGKSTLAMLL  369 (547)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457999999999544443


No 125
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=28.59  E-value=30  Score=28.33  Aligned_cols=18  Identities=17%  Similarity=0.174  Sum_probs=13.1

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        33 ~i~G~nGsGKSTLl~~l~   50 (229)
T cd03254          33 AIVGPTGAGKTTLINLLM   50 (229)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            358999999996555443


No 126
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=28.56  E-value=23  Score=28.31  Aligned_cols=19  Identities=21%  Similarity=0.279  Sum_probs=15.0

Q ss_pred             eeeccCCCceeeceEeeee
Q psy3060         110 FVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v~t  128 (268)
                      ++|.||.|||=-|.+..+-
T Consensus        31 l~G~nGsGKSTLl~~i~G~   49 (163)
T cd03216          31 LLGENGAGKSTLMKILSGL   49 (163)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            6899999999777766543


No 127
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=28.52  E-value=23  Score=26.91  Aligned_cols=12  Identities=17%  Similarity=0.310  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|++|.|||
T Consensus         6 v~vvG~~~~GKT   17 (165)
T cd01864           6 IILIGDSNVGKT   17 (165)
T ss_pred             EEEECCCCCCHH
Confidence            347999999998


No 128
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=28.47  E-value=22  Score=30.04  Aligned_cols=18  Identities=28%  Similarity=0.277  Sum_probs=13.6

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=++|+||.|||=-+.+.
T Consensus        32 ~~l~G~nGsGKSTLl~~l   49 (254)
T PRK10418         32 LALVGGSGSGKSLTCAAA   49 (254)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            347899999999655554


No 129
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=28.41  E-value=23  Score=29.26  Aligned_cols=21  Identities=19%  Similarity=0.298  Sum_probs=14.9

Q ss_pred             eeeeeccCCCceeeceEeeee
Q psy3060         108 LRFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~t  128 (268)
                      +=++|.||.|||=-+.+..+.
T Consensus        36 ~~l~G~nGsGKSTLlk~l~G~   56 (226)
T cd03234          36 MAILGSSGSGKTTLLDAISGR   56 (226)
T ss_pred             EEEECCCCCCHHHHHHHHhCc
Confidence            457999999998555554433


No 130
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=28.24  E-value=23  Score=29.76  Aligned_cols=19  Identities=16%  Similarity=0.169  Sum_probs=14.1

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.+|+||.|||=-|.+..+
T Consensus        34 ~i~G~nGsGKSTLl~~l~G   52 (251)
T PRK14249         34 AIIGPSGCGKSTLLRALNR   52 (251)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            3689999999966655543


No 131
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR). The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.
Probab=28.20  E-value=22  Score=38.70  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=10.6

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-+|||||.|||
T Consensus      1248 vaIvGrSGsGKS 1259 (1490)
T TIGR01271      1248 VGLLGRTGSGKS 1259 (1490)
T ss_pred             EEEECCCCCCHH
Confidence            457999999998


No 132
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=28.20  E-value=28  Score=28.63  Aligned_cols=14  Identities=14%  Similarity=0.283  Sum_probs=11.9

Q ss_pred             eeccCCCceeeceE
Q psy3060         111 VGRSGREAEASPKD  124 (268)
Q Consensus       111 VGRSGRGKsFtlti  124 (268)
                      .|-+|.||+||+.-
T Consensus        30 yG~tGsGKT~Tm~G   43 (186)
T cd01363          30 YGQTGSGKTYTMEG   43 (186)
T ss_pred             ECCCCCcceEecCC
Confidence            68999999998753


No 133
>PRK05541 adenylylsulfate kinase; Provisional
Probab=28.19  E-value=23  Score=28.03  Aligned_cols=14  Identities=14%  Similarity=0.278  Sum_probs=11.4

Q ss_pred             eeeeeccCCCceee
Q psy3060         108 LRFVGRSGREAEAS  121 (268)
Q Consensus       108 LRFVGRSGRGKsFt  121 (268)
                      +-|+|-||.|||--
T Consensus        10 I~i~G~~GsGKst~   23 (176)
T PRK05541         10 IWITGLAGSGKTTI   23 (176)
T ss_pred             EEEEcCCCCCHHHH
Confidence            45899999999743


No 134
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=28.17  E-value=23  Score=30.67  Aligned_cols=18  Identities=11%  Similarity=0.250  Sum_probs=14.2

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =++|+||.|||=-+.+..
T Consensus        34 ~i~G~NGsGKSTLl~~l~   51 (277)
T PRK13652         34 AVIGPNGAGKSTLFRHFN   51 (277)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            368999999997666654


No 135
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=28.13  E-value=23  Score=27.57  Aligned_cols=13  Identities=15%  Similarity=0.345  Sum_probs=10.9

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +=++|.+|.|||=
T Consensus        22 i~ilG~~~~GKSt   34 (190)
T cd00879          22 ILFLGLDNAGKTT   34 (190)
T ss_pred             EEEECCCCCCHHH
Confidence            4589999999984


No 136
>PRK04213 GTP-binding protein; Provisional
Probab=28.11  E-value=23  Score=28.05  Aligned_cols=13  Identities=38%  Similarity=0.583  Sum_probs=11.3

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +-++|++|.|||=
T Consensus        12 i~i~G~~~~GKSs   24 (201)
T PRK04213         12 IVFVGRSNVGKST   24 (201)
T ss_pred             EEEECCCCCCHHH
Confidence            5689999999984


No 137
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=28.11  E-value=23  Score=27.30  Aligned_cols=12  Identities=17%  Similarity=0.257  Sum_probs=10.4

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=+||.+|.||+
T Consensus         5 i~vvG~~~vGKT   16 (170)
T cd04115           5 IIVIGDSNVGKT   16 (170)
T ss_pred             EEEECCCCCCHH
Confidence            458999999997


No 138
>KOG0214|consensus
Probab=28.02  E-value=41  Score=36.96  Aligned_cols=65  Identities=22%  Similarity=0.202  Sum_probs=44.4

Q ss_pred             hhhhhhHHHHHhhhhhcccccccCccccccCcccccc--cccccceeeeeEeeeccCCccccCCCCC
Q psy3060         152 QITASISELLRMYEKTLRLGHLILLVPIVPNHLSKID--IFTGGSLCGLVLLTHFSSGARWDSASAP  216 (268)
Q Consensus       152 ~~s~~lsel~r~~~~~mr~~~psnP~Piv~~~ls~~d--~f~~~~~c~lv~~~~~~~~~~~~~~~~~  216 (268)
                      -|..-||.|.|...+-.|-|-.-+||-.+|+|.--.=  ==.-|.+||||-=--.-+-..|.|.++|
T Consensus       444 t~~sTLsHlRR~n~Pigr~GKlAkpRqlHnthwGmvCPaeTPEGqacGLVKNLSLmayIsvGS~~sP  510 (1141)
T KOG0214|consen  444 NPLSTLSHLRRTNSPIGRTGKLAKPRQLHNSHWGMVCPAETPEGQACGLVKNLSLMAYISVGSLESP  510 (1141)
T ss_pred             cHHHHHHHHhhcCCccccccccCCccccCcccceeeccccCCCcceeeccccceEEEEEecCCCccH
Confidence            4677789999999999999988899999999964321  1123899999832211222245565554


No 139
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=28.01  E-value=34  Score=27.70  Aligned_cols=19  Identities=16%  Similarity=0.235  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-+.+..
T Consensus        34 ~~i~G~nG~GKSTLl~~i~   52 (204)
T cd03250          34 VAIVGPVGSGKSSLLSALL   52 (204)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3458999999997666543


No 140
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=27.91  E-value=21  Score=26.01  Aligned_cols=10  Identities=30%  Similarity=0.451  Sum_probs=9.1

Q ss_pred             eeeccCCCce
Q psy3060         110 FVGRSGREAE  119 (268)
Q Consensus       110 FVGRSGRGKs  119 (268)
                      ++|.+|.|||
T Consensus         2 l~G~~~~GKs   11 (157)
T cd01894           2 IVGRPNVGKS   11 (157)
T ss_pred             ccCCCCCCHH
Confidence            6899999997


No 141
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=27.70  E-value=24  Score=29.02  Aligned_cols=21  Identities=14%  Similarity=0.069  Sum_probs=15.2

Q ss_pred             eeeeeccCCCceeeceEeeee
Q psy3060         108 LRFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~t  128 (268)
                      +-.+|.||.|||=-+.+..+-
T Consensus        29 ~~i~G~nGsGKSTLl~~i~G~   49 (227)
T cd03260          29 TALIGPSGCGKSTLLRLLNRL   49 (227)
T ss_pred             EEEECCCCCCHHHHHHHHHhh
Confidence            346899999999766655443


No 142
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=27.70  E-value=43  Score=32.79  Aligned_cols=18  Identities=22%  Similarity=0.350  Sum_probs=13.5

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.||.||.|||=.|.+..
T Consensus        46 ~lvG~nGsGKSTLl~~l~   63 (623)
T PRK10261         46 AIVGESGSGKSVTALALM   63 (623)
T ss_pred             EEECCCCChHHHHHHHHH
Confidence            358999999996665543


No 143
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=27.67  E-value=23  Score=30.03  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=13.2

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-+.+..
T Consensus        43 ~i~G~nGsGKSTLl~~l~   60 (260)
T PRK10744         43 AFIGPSGCGKSTLLRTFN   60 (260)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            368999999996555443


No 144
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=27.66  E-value=24  Score=28.79  Aligned_cols=17  Identities=24%  Similarity=0.196  Sum_probs=12.9

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-|.+.
T Consensus        35 ~i~G~nGsGKSTLl~~i   51 (221)
T TIGR02211        35 AIVGSSGSGKSTLLHLL   51 (221)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999999655544


No 145
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=27.48  E-value=24  Score=28.59  Aligned_cols=18  Identities=17%  Similarity=0.198  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (213)
T cd03301          30 VLLGPSGCGKTTTLRMIA   47 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999986555443


No 146
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=27.44  E-value=24  Score=28.30  Aligned_cols=18  Identities=22%  Similarity=0.368  Sum_probs=13.7

Q ss_pred             eeeccCCCceeeceEeee
Q psy3060         110 FVGRSGREAEASPKDWVG  127 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v~  127 (268)
                      .+|.||.|||=-+.+..+
T Consensus        30 l~G~nGsGKStLl~~i~G   47 (180)
T cd03214          30 ILGPNGAGKSTLLKTLAG   47 (180)
T ss_pred             EECCCCCCHHHHHHHHhC
Confidence            589999999966655543


No 147
>PRK00300 gmk guanylate kinase; Provisional
Probab=27.44  E-value=25  Score=28.26  Aligned_cols=12  Identities=25%  Similarity=0.410  Sum_probs=10.5

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|-||.|||
T Consensus         8 i~i~G~sGsGKs   19 (205)
T PRK00300          8 IVLSGPSGAGKS   19 (205)
T ss_pred             EEEECCCCCCHH
Confidence            457999999999


No 148
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=27.43  E-value=24  Score=27.05  Aligned_cols=14  Identities=21%  Similarity=0.311  Sum_probs=11.1

Q ss_pred             eeeeeccCCCceee
Q psy3060         108 LRFVGRSGREAEAS  121 (268)
Q Consensus       108 LRFVGRSGRGKsFt  121 (268)
                      +=++|.+|.|||=-
T Consensus         4 i~liG~~~~GKTsl   17 (168)
T cd04177           4 IVVLGAGGVGKSAL   17 (168)
T ss_pred             EEEECCCCCCHHHH
Confidence            34799999999843


No 149
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=27.36  E-value=24  Score=32.95  Aligned_cols=20  Identities=25%  Similarity=0.338  Sum_probs=14.5

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      .-+||.||.|||=-+.+-.+
T Consensus       351 ~~ivG~sGsGKSTL~~ll~g  370 (529)
T TIGR02857       351 VALVGPSGAGKSTLLNLLLG  370 (529)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            45799999999965554443


No 150
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=27.35  E-value=24  Score=28.60  Aligned_cols=19  Identities=16%  Similarity=0.295  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        29 ~~i~G~nGsGKSTLl~~l~   47 (205)
T cd03226          29 IALTGKNGAGKTTLAKILA   47 (205)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996665543


No 151
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=27.33  E-value=25  Score=27.33  Aligned_cols=15  Identities=27%  Similarity=0.488  Sum_probs=12.0

Q ss_pred             ceeeeeccCCCceee
Q psy3060         107 DLRFVGRSGREAEAS  121 (268)
Q Consensus       107 DLRFVGRSGRGKsFt  121 (268)
                      ++=++|.+|.|||=-
T Consensus        26 ~v~ivG~~~~GKSsl   40 (196)
T PRK00454         26 EIAFAGRSNVGKSSL   40 (196)
T ss_pred             EEEEEcCCCCCHHHH
Confidence            366899999999743


No 152
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=27.31  E-value=24  Score=30.23  Aligned_cols=19  Identities=16%  Similarity=0.128  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|.||.|||=-|.+..
T Consensus        30 ~~i~G~nGsGKSTLl~~l~   48 (271)
T PRK13638         30 TGLVGANGCGKSTLFMNLS   48 (271)
T ss_pred             EEEECCCCCCHHHHHHHHc
Confidence            4478999999996555443


No 153
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=27.23  E-value=22  Score=25.56  Aligned_cols=18  Identities=11%  Similarity=0.202  Sum_probs=14.5

Q ss_pred             eeeccCCCceeeceEeee
Q psy3060         110 FVGRSGREAEASPKDWVG  127 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v~  127 (268)
                      +.|.+|.||++.+.....
T Consensus         3 l~G~~G~GKT~l~~~la~   20 (132)
T PF00004_consen    3 LHGPPGTGKTTLARALAQ   20 (132)
T ss_dssp             EESSTTSSHHHHHHHHHH
T ss_pred             EECcCCCCeeHHHHHHHh
Confidence            689999999998776543


No 154
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=27.19  E-value=25  Score=28.99  Aligned_cols=20  Identities=20%  Similarity=0.320  Sum_probs=14.5

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +=.+|.||.|||=-|.+..+
T Consensus        29 ~~i~G~nGsGKSTLl~~l~G   48 (243)
T TIGR01978        29 HAIMGPNGSGKSTLSKTIAG   48 (243)
T ss_pred             EEEECCCCCCHHHHHHHHhC
Confidence            34689999999965555444


No 155
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=27.09  E-value=25  Score=29.57  Aligned_cols=19  Identities=26%  Similarity=0.146  Sum_probs=13.7

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-|.+..
T Consensus        32 ~~i~G~nGsGKSTLl~~l~   50 (241)
T PRK14250         32 YTIVGPSGAGKSTLIKLIN   50 (241)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996555443


No 156
>cd08365 APC10-like1 APC10-like DOC1 domains of E3 ubiquitin ligases that mediate substrate ubiquitination. This model represens the APC10-like DOC1 domain of multi-domain proteins present in E3 ubiquitin ligases. E3 ubiquitin ligases mediate substrate ubiquitination (or ubiquitylation), a component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. APC10/DOC1 domains such as those present in HECT (Homologous to the E6-AP Carboxyl Terminus) and Cullin-RING (Really Interesting New Gene) E3 ubiquitin ligase proteins, HECTD3, and CUL7, respectively, are also included here. CUL7 is a member of the Cullin-RING ligase family and functions as a molecular scaffold assembling a SCF-ROC1-like E3 ubiquitin ligase complex consisting of Skp1, CUL7, Fbx29 F-box protein, and ROC1 (RING-box protein 1) and promotes ubiquitination. CUL7 is a multi-domain protein with a C-terminal cullin domain that binds ROC1 and a centrally positioned APC10/DOC1 domain. HECTD3 contains a C-te
Probab=27.08  E-value=1.7e+02  Score=24.62  Aligned_cols=21  Identities=24%  Similarity=0.373  Sum_probs=17.3

Q ss_pred             eEEEEeecCCCccccccccce
Q psy3060          75 TIVTIRAGNDENYCGELRNCT   95 (268)
Q Consensus        75 T~Vtv~AGNDEN~~AELRN~t   95 (268)
                      +.|.|+||++.+--.|++.-.
T Consensus        67 ~~I~V~~G~~~~dL~e~~~v~   87 (131)
T cd08365          67 QRVVVAGGRSASNLQELRDVN   87 (131)
T ss_pred             cEEEEEecCCHHHheeEEEEE
Confidence            689999999999888876543


No 157
>PTZ00243 ABC transporter; Provisional
Probab=27.06  E-value=24  Score=38.79  Aligned_cols=13  Identities=31%  Similarity=0.616  Sum_probs=10.9

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +=+|||||.|||=
T Consensus      1339 VaIVGrTGSGKST 1351 (1560)
T PTZ00243       1339 VGIVGRTGSGKST 1351 (1560)
T ss_pred             EEEECCCCCCHHH
Confidence            4579999999984


No 158
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=27.01  E-value=25  Score=28.98  Aligned_cols=13  Identities=23%  Similarity=0.335  Sum_probs=10.7

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +-++|.||.|||-
T Consensus         9 i~I~G~sGsGKST   21 (207)
T TIGR00235         9 IGIGGGSGSGKTT   21 (207)
T ss_pred             EEEECCCCCCHHH
Confidence            3478999999994


No 159
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=27.01  E-value=25  Score=29.37  Aligned_cols=18  Identities=22%  Similarity=0.348  Sum_probs=13.6

Q ss_pred             eeeccCCCceeeceEeee
Q psy3060         110 FVGRSGREAEASPKDWVG  127 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v~  127 (268)
                      ++|.||.|||=-+.+..+
T Consensus        38 i~G~nGsGKSTLl~~i~G   55 (252)
T CHL00131         38 IMGPNGSGKSTLSKVIAG   55 (252)
T ss_pred             EECCCCCCHHHHHHHHcC
Confidence            689999999966655443


No 160
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=27.00  E-value=25  Score=28.08  Aligned_cols=19  Identities=21%  Similarity=0.316  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|++|.|||=-|.+..
T Consensus        31 ~~i~G~nGsGKStLl~~l~   49 (178)
T cd03247          31 IALLGRSGSGKSTLLQLLT   49 (178)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999996555443


No 161
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=26.90  E-value=25  Score=29.58  Aligned_cols=18  Identities=17%  Similarity=0.241  Sum_probs=13.8

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|+||.|||=-+.+..
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (253)
T PRK14261         36 ALIGPSGCGKSTLLRCFN   53 (253)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996665554


No 162
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=26.88  E-value=25  Score=29.43  Aligned_cols=18  Identities=17%  Similarity=0.165  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .-.+|+||.|||=-+.+.
T Consensus        33 ~~i~G~nGsGKSTLl~~l   50 (251)
T PRK14251         33 TALIGPSGCGKSTFLRCL   50 (251)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            347899999999655444


No 163
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=26.86  E-value=1.5e+02  Score=26.53  Aligned_cols=74  Identities=4%  Similarity=-0.124  Sum_probs=44.9

Q ss_pred             eecceeeeeccCCCceeeceEeeeeeeeEEeeecCcccchhhhhhhhhhhhhhhHHHHHhhhhhcccccccCccccccCc
Q psy3060         104 KFNDLRFVGRSGREAEASPKDWVGTLIWLIGIKNKHQQYEIEISFLINQITASISELLRMYEKTLRLGHLILLVPIVPNH  183 (268)
Q Consensus       104 rFNDLRFVGRSGRGKsFtlti~v~t~~~~i~v~~~hrq~~~~~~~~~~~~s~~lsel~r~~~~~mr~~~psnP~Piv~~~  183 (268)
                      ||.=+|-.|..|+|+.|-+.++  --..+||+.+......  +. ....|.. -+++++..+..-|+.+|.-++|..+..
T Consensus        32 ~y~~~~~l~~~~f~~v~l~~~~--~~~~iiKvf~~~~~~~--~~-~~~~f~~-g~~~e~Ea~~l~rL~~~GI~~~~d~~~  105 (232)
T PRK10359         32 NIKTIKVFRNIDDTKVSLIDTD--YGKYILKVFAPKVKRT--ER-FLKSFVK-GDYYENLIVQTDRVRSEGLASLNDFYL  105 (232)
T ss_pred             ceEEEEEecCCCceEEEEEecC--CCcEEEEEechhcCch--HH-HHHhhhh-hHHHHHHHHHHHHHHHCCCCcceEeee
Confidence            6777888999999999964443  3368888876443211  11 1111111 345666666667777777777665533


No 164
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=26.83  E-value=25  Score=29.31  Aligned_cols=18  Identities=6%  Similarity=0.073  Sum_probs=13.5

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-|.+..
T Consensus        17 ~l~G~NGsGKSTLlk~i~   34 (213)
T PRK15177         17 GILAAPGSGKTTLTRLLC   34 (213)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999986655543


No 165
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=26.82  E-value=25  Score=29.30  Aligned_cols=19  Identities=16%  Similarity=0.198  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        31 ~~i~G~nGsGKSTLl~~l~   49 (239)
T cd03296          31 VALLGPSGSGKTTLLRLIA   49 (239)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4478999999996655543


No 166
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=26.77  E-value=27  Score=26.07  Aligned_cols=11  Identities=9%  Similarity=0.217  Sum_probs=9.7

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =++|++|.|||
T Consensus         4 ~iiG~~~~GKt   14 (168)
T cd01887           4 TVMGHVDHGKT   14 (168)
T ss_pred             EEEecCCCCHH
Confidence            47999999997


No 167
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=26.73  E-value=25  Score=28.67  Aligned_cols=18  Identities=11%  Similarity=0.130  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|++|.|||=-+.+..
T Consensus        31 ~l~G~nGsGKSTLl~~l~   48 (204)
T PRK13538         31 QIEGPNGAGKTSLLRILA   48 (204)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996665543


No 168
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=26.71  E-value=25  Score=29.50  Aligned_cols=17  Identities=18%  Similarity=0.290  Sum_probs=12.5

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|+||.|||=-+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l   48 (246)
T PRK14269         32 ALIGASGCGKSTFLRCF   48 (246)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999999544443


No 169
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=26.70  E-value=25  Score=29.06  Aligned_cols=17  Identities=18%  Similarity=0.204  Sum_probs=12.9

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-|.+.
T Consensus        32 ~l~G~nGsGKSTLl~~l   48 (243)
T TIGR02315        32 AIIGPSGAGKSTLLRCI   48 (243)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999999655544


No 170
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=26.66  E-value=24  Score=31.78  Aligned_cols=16  Identities=25%  Similarity=0.210  Sum_probs=12.4

Q ss_pred             eeeccCCCceeeceEe
Q psy3060         110 FVGRSGREAEASPKDW  125 (268)
Q Consensus       110 FVGRSGRGKsFtlti~  125 (268)
                      .+|.||+|||==|.|.
T Consensus        36 I~GpSGSGKSTLLnii   51 (226)
T COG1136          36 IVGPSGSGKSTLLNLL   51 (226)
T ss_pred             EECCCCCCHHHHHHHH
Confidence            4799999999666553


No 171
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=26.65  E-value=24  Score=26.56  Aligned_cols=15  Identities=20%  Similarity=0.310  Sum_probs=12.2

Q ss_pred             eeeccCCCceeeceE
Q psy3060         110 FVGRSGREAEASPKD  124 (268)
Q Consensus       110 FVGRSGRGKsFtlti  124 (268)
                      +.|.+|.|||.-...
T Consensus         3 i~G~~G~GKS~l~~~   17 (107)
T PF00910_consen    3 IYGPPGIGKSTLAKE   17 (107)
T ss_pred             EECCCCCCHHHHHHH
Confidence            679999999986554


No 172
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=26.59  E-value=25  Score=33.45  Aligned_cols=21  Identities=14%  Similarity=0.118  Sum_probs=14.9

Q ss_pred             eeeeeccCCCceeeceEeeee
Q psy3060         108 LRFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~t  128 (268)
                      .=.||+||.|||==+.+-.+-
T Consensus       364 v~IvG~sGsGKSTLl~lL~gl  384 (588)
T PRK13657        364 VAIVGPTGAGKSTLINLLQRV  384 (588)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            457999999999555544433


No 173
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=26.49  E-value=25  Score=31.12  Aligned_cols=15  Identities=20%  Similarity=0.423  Sum_probs=11.9

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +-++|+||.|||=-|
T Consensus        33 ~~IvG~nGsGKSTLl   47 (275)
T cd03289          33 VGLLGRTGSGKSTLL   47 (275)
T ss_pred             EEEECCCCCCHHHHH
Confidence            457999999998544


No 174
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=26.47  E-value=23  Score=24.80  Aligned_cols=14  Identities=14%  Similarity=0.268  Sum_probs=10.8

Q ss_pred             eeeccCCCceeece
Q psy3060         110 FVGRSGREAEASPK  123 (268)
Q Consensus       110 FVGRSGRGKsFtlt  123 (268)
                      ++|.+|.|||--+.
T Consensus         1 i~G~~gsGKstl~~   14 (163)
T cd00880           1 LFGRTNAGKSSLLN   14 (163)
T ss_pred             CcCCCCCCHHHHHH
Confidence            47999999975544


No 175
>PRK12289 GTPase RsgA; Reviewed
Probab=26.47  E-value=26  Score=32.78  Aligned_cols=38  Identities=16%  Similarity=0.083  Sum_probs=24.8

Q ss_pred             EEEEeecCCCccccccccceeeeccceeeecceeeeeccCCCceeec
Q psy3060          76 IVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEASP  122 (268)
Q Consensus        76 ~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsFtl  122 (268)
                      .+.++|-+.++. .||++...   +.+     .=|+|.||.|||=-|
T Consensus       152 v~~iSA~tg~GI-~eL~~~L~---~ki-----~v~iG~SgVGKSSLI  189 (352)
T PRK12289        152 PLFISVETGIGL-EALLEQLR---NKI-----TVVAGPSGVGKSSLI  189 (352)
T ss_pred             EEEEEcCCCCCH-HHHhhhhc---cce-----EEEEeCCCCCHHHHH
Confidence            456677777663 56665443   222     569999999998433


No 176
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=26.43  E-value=25  Score=31.59  Aligned_cols=19  Identities=26%  Similarity=0.268  Sum_probs=14.2

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=+||.||.|||=-+.+..
T Consensus        36 ~~ivG~sGsGKSTLl~~i~   54 (330)
T PRK15093         36 RGLVGESGSGKSLIAKAIC   54 (330)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4579999999996555443


No 177
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=26.42  E-value=26  Score=23.85  Aligned_cols=17  Identities=18%  Similarity=0.274  Sum_probs=13.6

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|-+|.||+-.+...
T Consensus         6 ~l~G~~G~GKTtl~~~l   22 (148)
T smart00382        6 LIVGPPGSGKTTLARAL   22 (148)
T ss_pred             EEECCCCCcHHHHHHHH
Confidence            47899999999877544


No 178
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=26.42  E-value=25  Score=31.12  Aligned_cols=40  Identities=23%  Similarity=0.288  Sum_probs=24.1

Q ss_pred             EEEeecCCCccccccccceeeeccceeeecceeeeeccCCCceeeceEe
Q psy3060          77 VTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAEASPKDW  125 (268)
Q Consensus        77 Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKsFtlti~  125 (268)
                      +.++|-+.++. .+|+...+   +     .-.=|+|.||.|||=.+...
T Consensus       142 ~~vSA~~g~gi-~~L~~~L~---~-----k~~~~~G~sg~GKSTlin~l  181 (287)
T cd01854         142 LAVSAKTGEGL-DELREYLK---G-----KTSVLVGQSGVGKSTLINAL  181 (287)
T ss_pred             EEEECCCCccH-HHHHhhhc---c-----ceEEEECCCCCCHHHHHHHH
Confidence            45566655542 44544322   2     23569999999998655543


No 179
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=26.32  E-value=27  Score=25.11  Aligned_cols=12  Identities=25%  Similarity=0.410  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-++|.+|.|||
T Consensus         6 i~~~G~~g~GKt   17 (168)
T cd04163           6 VAIVGRPNVGKS   17 (168)
T ss_pred             EEEECCCCCCHH
Confidence            458999999996


No 180
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=26.26  E-value=26  Score=29.58  Aligned_cols=19  Identities=16%  Similarity=0.232  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|+||.|||=-|.+..
T Consensus        31 ~~l~G~nGsGKSTLl~~l~   49 (255)
T PRK11231         31 TALIGPNGCGKSTLLKCFA   49 (255)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999996555443


No 181
>COG0218 Predicted GTPase [General function prediction only]
Probab=26.24  E-value=26  Score=31.45  Aligned_cols=13  Identities=31%  Similarity=0.547  Sum_probs=11.3

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      .=|+|||-.|||=
T Consensus        27 IaF~GRSNVGKSS   39 (200)
T COG0218          27 IAFAGRSNVGKSS   39 (200)
T ss_pred             EEEEccCcccHHH
Confidence            4699999999984


No 182
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=26.19  E-value=26  Score=28.66  Aligned_cols=19  Identities=21%  Similarity=0.412  Sum_probs=13.9

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.+|.||.|||=-+.+..+
T Consensus        30 ~i~G~nGsGKStLl~~l~G   48 (200)
T cd03217          30 ALMGPNGSGKSTLAKTIMG   48 (200)
T ss_pred             EEECCCCCCHHHHHHHHhC
Confidence            4689999999965555444


No 183
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=26.13  E-value=26  Score=30.05  Aligned_cols=17  Identities=24%  Similarity=0.389  Sum_probs=12.7

Q ss_pred             eeeeeccCCCceeeceE
Q psy3060         108 LRFVGRSGREAEASPKD  124 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti  124 (268)
                      +-++|+||.|||=-|.+
T Consensus        42 ~~i~G~NGsGKSTLl~~   58 (267)
T PRK15112         42 LAIIGENGSGKSTLAKM   58 (267)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            45789999999954443


No 184
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=26.12  E-value=27  Score=28.90  Aligned_cols=18  Identities=22%  Similarity=0.152  Sum_probs=13.5

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-+.+..
T Consensus        33 ~l~G~nGsGKSTLl~~i~   50 (238)
T cd03249          33 ALVGSSGCGKSTVVSLLE   50 (238)
T ss_pred             EEEeCCCCCHHHHHHHHh
Confidence            358999999996665543


No 185
>PRK03846 adenylylsulfate kinase; Provisional
Probab=26.08  E-value=26  Score=28.70  Aligned_cols=14  Identities=36%  Similarity=0.456  Sum_probs=11.4

Q ss_pred             ceeeeeccCCCcee
Q psy3060         107 DLRFVGRSGREAEA  120 (268)
Q Consensus       107 DLRFVGRSGRGKsF  120 (268)
                      =+=++|.||.|||=
T Consensus        26 ~i~i~G~~GsGKST   39 (198)
T PRK03846         26 VLWFTGLSGSGKST   39 (198)
T ss_pred             EEEEECCCCCCHHH
Confidence            35689999999973


No 186
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=26.05  E-value=26  Score=29.90  Aligned_cols=18  Identities=17%  Similarity=0.187  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -++|.||.|||=-+.+..
T Consensus        41 ~i~G~nGsGKSTLl~~l~   58 (265)
T PRK10575         41 GLIGHNGSGKSTLLKMLG   58 (265)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            468999999986555443


No 187
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=26.01  E-value=26  Score=29.20  Aligned_cols=18  Identities=17%  Similarity=0.263  Sum_probs=13.2

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|.||.|||=-|.+.
T Consensus        34 ~~i~G~nGsGKSTLl~~l   51 (252)
T PRK14239         34 TALIGPSGSGKSTLLRSI   51 (252)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            446899999998555444


No 188
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=25.92  E-value=27  Score=29.08  Aligned_cols=17  Identities=12%  Similarity=0.098  Sum_probs=12.6

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-+.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l   47 (236)
T TIGR03864        31 ALLGPNGAGKSTLFSLL   47 (236)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999998655443


No 189
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=25.92  E-value=27  Score=26.88  Aligned_cols=12  Identities=17%  Similarity=0.365  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=+||++|.|||
T Consensus         7 i~vvG~~~vGKS   18 (168)
T cd01866           7 YIIIGDTGVGKS   18 (168)
T ss_pred             EEEECCCCCCHH
Confidence            447999999997


No 190
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.91  E-value=27  Score=27.87  Aligned_cols=19  Identities=16%  Similarity=0.167  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-+.+..
T Consensus        29 ~~i~G~nGsGKStLl~~l~   47 (173)
T cd03230          29 YGLLGPNGAGKTTLIKIIL   47 (173)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4578999999996555543


No 191
>PRK10908 cell division protein FtsE; Provisional
Probab=25.86  E-value=27  Score=28.70  Aligned_cols=17  Identities=24%  Similarity=0.135  Sum_probs=12.7

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l   48 (222)
T PRK10908         32 FLTGHSGAGKSTLLKLI   48 (222)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999998555443


No 192
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=25.85  E-value=27  Score=28.65  Aligned_cols=19  Identities=21%  Similarity=0.233  Sum_probs=13.9

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        37 ~~l~G~nGsGKSTLl~~i~   55 (224)
T TIGR02324        37 VALSGPSGAGKSTLLKSLY   55 (224)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999986555543


No 193
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.83  E-value=27  Score=29.08  Aligned_cols=17  Identities=18%  Similarity=0.227  Sum_probs=12.2

Q ss_pred             eeeeeccCCCceeeceE
Q psy3060         108 LRFVGRSGREAEASPKD  124 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti  124 (268)
                      .-++|+||.|||=-+.+
T Consensus        29 ~~i~G~nGsGKSTLl~~   45 (232)
T cd03300          29 FTLLGPSGCGKTTLLRL   45 (232)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            34689999999944433


No 194
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=25.76  E-value=27  Score=28.30  Aligned_cols=18  Identities=11%  Similarity=0.049  Sum_probs=13.8

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.+|.|||=-+.+..
T Consensus        30 ~l~G~nGsGKSTLl~~l~   47 (195)
T PRK13541         30 YIKGANGCGKSSLLRMIA   47 (195)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            368999999997665554


No 195
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.61  E-value=27  Score=28.74  Aligned_cols=19  Identities=16%  Similarity=0.212  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-+.+..
T Consensus        30 ~~i~G~nGsGKSTLl~~l~   48 (241)
T cd03256          30 VALIGPSGAGKSTLLRCLN   48 (241)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996655543


No 196
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.56  E-value=28  Score=27.09  Aligned_cols=17  Identities=18%  Similarity=0.268  Sum_probs=12.8

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -++|.+|.|||=-+.+.
T Consensus        29 ~i~G~nGsGKStll~~l   45 (157)
T cd00267          29 ALVGPNGSGKSTLLRAI   45 (157)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            47899999999555444


No 197
>PF06709 DUF1196:  Protein of unknown function (DUF1196);  InterPro: IPR009585 This family consists of several hypothetical bacterial proteins of around 51 residues in length which seem to be specific to Vibrio cholerae. The function of this family is unknown.
Probab=25.55  E-value=18  Score=26.92  Aligned_cols=11  Identities=64%  Similarity=0.890  Sum_probs=9.3

Q ss_pred             eeeeecccccc
Q psy3060         232 GYHIHKTKLLK  242 (268)
Q Consensus       232 ~~~~~~~~~~~  242 (268)
                      .|||||||.|.
T Consensus        36 ~~Hi~k~Kmlh   46 (51)
T PF06709_consen   36 QTHIHKTKMLH   46 (51)
T ss_pred             HhHHhHhheee
Confidence            58999999875


No 198
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=25.48  E-value=27  Score=29.62  Aligned_cols=19  Identities=21%  Similarity=0.160  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|.||.|||=-|.+..
T Consensus        36 ~~l~G~nGsGKSTLlk~l~   54 (259)
T PRK14260         36 TAIIGPSGCGKSTFIKTLN   54 (259)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4578999999995554443


No 199
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=25.48  E-value=26  Score=26.02  Aligned_cols=14  Identities=21%  Similarity=0.370  Sum_probs=11.3

Q ss_pred             eeeccCCCceeece
Q psy3060         110 FVGRSGREAEASPK  123 (268)
Q Consensus       110 FVGRSGRGKsFtlt  123 (268)
                      ++|-+|.|||.-..
T Consensus         4 ~~G~pgsGKSt~a~   17 (143)
T PF13671_consen    4 LCGPPGSGKSTLAK   17 (143)
T ss_dssp             EEESTTSSHHHHHH
T ss_pred             EECCCCCCHHHHHH
Confidence            68999999997543


No 200
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=25.43  E-value=27  Score=28.93  Aligned_cols=18  Identities=17%  Similarity=0.152  Sum_probs=13.3

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=.+|+||.|||=-|.+.
T Consensus        28 ~~l~G~nGsGKSTLl~~l   45 (232)
T PRK10771         28 VAILGPSGAGKSTLLNLI   45 (232)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            347899999999555443


No 201
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=25.41  E-value=27  Score=34.04  Aligned_cols=15  Identities=20%  Similarity=0.366  Sum_probs=11.9

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      .-.||+||.|||==+
T Consensus       494 iaIvG~sGsGKSTLl  508 (694)
T TIGR03375       494 VAIIGRIGSGKSTLL  508 (694)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567999999999433


No 202
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=25.40  E-value=28  Score=29.49  Aligned_cols=18  Identities=22%  Similarity=0.237  Sum_probs=13.2

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-|.+..
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (258)
T PRK11701         36 GIVGESGSGKTTLLNALS   53 (258)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            358999999996555443


No 203
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=25.39  E-value=27  Score=29.76  Aligned_cols=19  Identities=16%  Similarity=0.163  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|.||.|||=-|.+..
T Consensus        50 ~~i~G~nGsGKSTLl~~l~   68 (268)
T PRK14248         50 TALIGPSGCGKSTFLRSIN   68 (268)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4579999999996655543


No 204
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=25.39  E-value=28  Score=29.21  Aligned_cols=18  Identities=17%  Similarity=0.148  Sum_probs=13.6

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-|.+..
T Consensus        36 ~i~G~nGsGKSTLl~~l~   53 (253)
T PRK14242         36 ALIGPSGCGKSTFLRCLN   53 (253)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            468999999996655544


No 205
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.34  E-value=28  Score=27.90  Aligned_cols=18  Identities=17%  Similarity=0.196  Sum_probs=13.2

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-+.+..
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (178)
T cd03229          30 ALLGPSGSGKSTLLRCIA   47 (178)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            368999999996554443


No 206
>PRK05480 uridine/cytidine kinase; Provisional
Probab=25.31  E-value=28  Score=28.43  Aligned_cols=14  Identities=21%  Similarity=0.368  Sum_probs=11.0

Q ss_pred             eeeeeccCCCceee
Q psy3060         108 LRFVGRSGREAEAS  121 (268)
Q Consensus       108 LRFVGRSGRGKsFt  121 (268)
                      +-.+|.||.|||.-
T Consensus         9 I~I~G~sGsGKTTl   22 (209)
T PRK05480          9 IGIAGGSGSGKTTV   22 (209)
T ss_pred             EEEECCCCCCHHHH
Confidence            34689999999943


No 207
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=25.28  E-value=24  Score=33.93  Aligned_cols=18  Identities=28%  Similarity=0.340  Sum_probs=14.8

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-|+|.||+||+=+|...
T Consensus        30 ~vliGpSGsGKTTtLkMI   47 (309)
T COG1125          30 LVLIGPSGSGKTTTLKMI   47 (309)
T ss_pred             EEEECCCCCcHHHHHHHH
Confidence            457999999999888654


No 208
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=25.24  E-value=28  Score=28.98  Aligned_cols=17  Identities=18%  Similarity=0.208  Sum_probs=12.6

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -++|.||.|||=-+.+.
T Consensus        32 ~i~G~nGsGKSTLl~~l   48 (242)
T PRK11124         32 VLLGPSGAGKSSLLRVL   48 (242)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46799999999555443


No 209
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=25.18  E-value=32  Score=27.97  Aligned_cols=18  Identities=22%  Similarity=0.132  Sum_probs=13.5

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|+||.|||=-|.+.
T Consensus        27 ~~l~G~nGsGKSTLl~~l   44 (211)
T cd03298          27 TAIVGPSGSGKSTLLNLI   44 (211)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457899999998655544


No 210
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=25.11  E-value=28  Score=25.87  Aligned_cols=15  Identities=33%  Similarity=0.346  Sum_probs=12.0

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +=++|.+|.|||--+
T Consensus         5 i~i~G~~~~GKtsl~   19 (164)
T cd04145           5 LVVVGGGGVGKSALT   19 (164)
T ss_pred             EEEECCCCCcHHHHH
Confidence            447999999998643


No 211
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=25.07  E-value=28  Score=29.09  Aligned_cols=19  Identities=16%  Similarity=0.174  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        32 ~~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14240         32 TALIGPSGCGKSTFLRTLN   50 (250)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996665554


No 212
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=25.04  E-value=29  Score=26.28  Aligned_cols=12  Identities=33%  Similarity=0.529  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|.+|.|||
T Consensus         5 i~i~G~~~vGKS   16 (166)
T cd01869           5 LLLIGDSGVGKS   16 (166)
T ss_pred             EEEECCCCCCHH
Confidence            458999999997


No 213
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=25.03  E-value=29  Score=26.63  Aligned_cols=13  Identities=23%  Similarity=0.314  Sum_probs=10.9

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      +=++|.+|.|||=
T Consensus         7 i~ivG~~~vGKTs   19 (180)
T cd04127           7 FLALGDSGVGKTS   19 (180)
T ss_pred             EEEECCCCCCHHH
Confidence            4589999999974


No 214
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=25.02  E-value=28  Score=30.21  Aligned_cols=18  Identities=11%  Similarity=0.069  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|+||.|||=-|.+.
T Consensus        40 ~~l~G~nGsGKSTLl~~l   57 (289)
T PRK13645         40 TCVIGTTGSGKSTMIQLT   57 (289)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            346899999999655544


No 215
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=25.01  E-value=30  Score=26.52  Aligned_cols=13  Identities=15%  Similarity=0.217  Sum_probs=10.5

Q ss_pred             eeeccCCCceeec
Q psy3060         110 FVGRSGREAEASP  122 (268)
Q Consensus       110 FVGRSGRGKsFtl  122 (268)
                      |+|.+|.|||--|
T Consensus        24 i~G~Ng~GKStil   36 (202)
T PF13476_consen   24 IYGPNGSGKSTIL   36 (202)
T ss_dssp             EEESTTSSHHHHH
T ss_pred             EECCCCCCHHHHH
Confidence            6799999998544


No 216
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=24.91  E-value=29  Score=29.11  Aligned_cols=18  Identities=17%  Similarity=0.217  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-++|+||.|||=-+.+.
T Consensus        29 ~~l~G~nGsGKSTLl~~i   46 (237)
T TIGR00968        29 VALLGPSGSGKSTLLRII   46 (237)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            447899999999655444


No 217
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=24.89  E-value=32  Score=28.15  Aligned_cols=20  Identities=20%  Similarity=0.215  Sum_probs=15.3

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +-++|.||.|||=-|.+..+
T Consensus        30 ~~i~G~nGsGKSTLl~~i~G   49 (218)
T cd03290          30 TMIVGQVGCGKSSLLLAILG   49 (218)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            45789999999976666543


No 218
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=24.85  E-value=28  Score=30.04  Aligned_cols=19  Identities=11%  Similarity=0.195  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|+||.|||=-+.+..
T Consensus        31 ~~l~G~nGsGKSTLl~~i~   49 (275)
T PRK13639         31 VALLGPNGAGKSTLFLHFN   49 (275)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999997666554


No 219
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=24.82  E-value=30  Score=25.81  Aligned_cols=13  Identities=8%  Similarity=0.100  Sum_probs=10.8

Q ss_pred             eeeeccCCCceee
Q psy3060         109 RFVGRSGREAEAS  121 (268)
Q Consensus       109 RFVGRSGRGKsFt  121 (268)
                      =++|.+|.|||=-
T Consensus         3 ~i~G~~~~GKTsl   15 (160)
T cd04156           3 LLLGLDSAGKSTL   15 (160)
T ss_pred             EEEcCCCCCHHHH
Confidence            4799999999854


No 220
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=24.79  E-value=29  Score=29.04  Aligned_cols=17  Identities=18%  Similarity=0.130  Sum_probs=13.2

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -.+|.||.|||=-|.+.
T Consensus        25 ~l~G~nG~GKSTLl~~i   41 (176)
T cd03238          25 VVTGVSGSGKSTLVNEG   41 (176)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999999666544


No 221
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=24.73  E-value=29  Score=27.90  Aligned_cols=18  Identities=11%  Similarity=0.147  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-|.+..
T Consensus        30 ~i~G~nGsGKSTLl~~l~   47 (182)
T cd03215          30 GIAGLVGNGQTELAEALF   47 (182)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996655544


No 222
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=24.73  E-value=29  Score=28.82  Aligned_cols=18  Identities=22%  Similarity=0.124  Sum_probs=13.4

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        39 ~l~G~nGsGKSTLl~~l~   56 (233)
T PRK11629         39 AIVGSSGSGKSTLLHLLG   56 (233)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996555443


No 223
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=24.71  E-value=29  Score=29.67  Aligned_cols=18  Identities=11%  Similarity=0.200  Sum_probs=13.4

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -++|.||.|||=-|.+..
T Consensus        37 ~i~G~nGsGKSTLl~~i~   54 (265)
T PRK10253         37 AIIGPNGCGKSTLLRTLS   54 (265)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            468999999996555443


No 224
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=24.70  E-value=29  Score=28.87  Aligned_cols=19  Identities=16%  Similarity=0.176  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        32 ~~l~G~nGsGKSTLl~~l~   50 (241)
T PRK10895         32 VGLLGPNGAGKTTTFYMVV   50 (241)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996555543


No 225
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=24.59  E-value=29  Score=29.14  Aligned_cols=18  Identities=17%  Similarity=0.267  Sum_probs=13.1

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-++|.||.|||=-+.+.
T Consensus        29 ~~i~G~nGsGKSTLl~~l   46 (252)
T TIGR03005        29 VALIGPSGSGKSTILRIL   46 (252)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            346899999999655443


No 226
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=24.58  E-value=28  Score=27.40  Aligned_cols=14  Identities=14%  Similarity=0.214  Sum_probs=11.3

Q ss_pred             eeeeccCCCceeec
Q psy3060         109 RFVGRSGREAEASP  122 (268)
Q Consensus       109 RFVGRSGRGKsFtl  122 (268)
                      =+.|.+|.|||+-+
T Consensus        36 ~i~g~~g~GKT~~~   49 (193)
T PF13481_consen   36 LIAGPPGSGKTTLA   49 (193)
T ss_dssp             EEEECSTSSHHHHH
T ss_pred             EEEeCCCCCHHHHH
Confidence            47899999999643


No 227
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=24.55  E-value=29  Score=29.32  Aligned_cols=18  Identities=17%  Similarity=0.167  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -++|.||.|||=-+.+..
T Consensus        35 ~l~G~nGsGKSTLl~~i~   52 (257)
T PRK10619         35 SIIGSSGSGKSTFLRCIN   52 (257)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999986555443


No 228
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=24.54  E-value=33  Score=26.76  Aligned_cols=48  Identities=13%  Similarity=0.082  Sum_probs=27.1

Q ss_pred             EEEEeecCCCccccccccceeee---------ccc-eeeecceeeeeccCCCceeeceE
Q psy3060          76 IVTIRAGNDENYCGELRNCTAVM---------KNQ-VAKFNDLRFVGRSGREAEASPKD  124 (268)
Q Consensus        76 ~Vtv~AGNDEN~~AELRN~tAvM---------KNq-VArFNDLRFVGRSGRGKsFtlti  124 (268)
                      .+.++|-++++ ..+|++.....         ++. ..+=-.+-++|++|.|||--+..
T Consensus        62 ii~vSa~~~~g-i~~L~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~GKstlin~  119 (155)
T cd01849          62 PFKISATNGQG-IEKKESAFTKQTNSNLKSYAKDGKLKKSITVGVIGYPNVGKSSVINA  119 (155)
T ss_pred             EEEEeccCCcC-hhhHHHHHHHHhHHHHHHHHhccccccCcEEEEEccCCCCHHHHHHH
Confidence            56677777665 45565533110         000 01112366999999999975543


No 229
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=24.53  E-value=26  Score=31.74  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=15.7

Q ss_pred             eeeeeccCCCceeeceEeeee
Q psy3060         108 LRFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~t  128 (268)
                      +=+||.||.|||=-+.+..+-
T Consensus        45 ~~ivG~sGsGKSTL~~~l~Gl   65 (330)
T PRK09473         45 LGIVGESGSGKSQTAFALMGL   65 (330)
T ss_pred             EEEECCCCchHHHHHHHHHcC
Confidence            457999999999766655443


No 230
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=24.50  E-value=30  Score=31.82  Aligned_cols=39  Identities=21%  Similarity=0.285  Sum_probs=24.3

Q ss_pred             EEEEeecCCCccccccccceeeeccceeeecceeeeeccCCCce
Q psy3060          76 IVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLRFVGRSGREAE  119 (268)
Q Consensus        76 ~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLRFVGRSGRGKs  119 (268)
                      .+.++|-+.+| ..||.+......+.    .++=|||++|.|||
T Consensus       130 i~~vSAk~g~g-v~eL~~~l~~~~~~----~~v~~vG~~nvGKS  168 (360)
T TIGR03597       130 IILVSAKKGNG-IDELLDKIKKARNK----KDVYVVGVTNVGKS  168 (360)
T ss_pred             EEEecCCCCCC-HHHHHHHHHHHhCC----CeEEEECCCCCCHH
Confidence            45667777666 34444433222221    47889999999996


No 231
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=24.44  E-value=29  Score=29.06  Aligned_cols=19  Identities=16%  Similarity=0.240  Sum_probs=13.9

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.+|.||.|||=-+.+..+
T Consensus        34 ~l~G~nGsGKSTLl~~l~G   52 (253)
T PRK14267         34 ALMGPSGCGKSTLLRTFNR   52 (253)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            3689999999966555443


No 232
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=24.38  E-value=30  Score=29.14  Aligned_cols=20  Identities=15%  Similarity=0.149  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +-.+|.||.|||=-|.+..+
T Consensus        36 ~~i~G~nGsGKSTLl~~l~G   55 (254)
T PRK14273         36 TALIGPSGCGKSTFLRTLNR   55 (254)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34689999999976555443


No 233
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=24.35  E-value=29  Score=30.09  Aligned_cols=20  Identities=15%  Similarity=0.197  Sum_probs=15.3

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +-++|.||.|||=-+.+..+
T Consensus        34 ~~i~G~nGsGKSTLl~~l~G   53 (274)
T PRK13647         34 TALLGPNGAGKSTLLLHLNG   53 (274)
T ss_pred             EEEECCCCCcHHHHHHHHhc
Confidence            45789999999977766543


No 234
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=24.35  E-value=24  Score=25.73  Aligned_cols=18  Identities=17%  Similarity=0.158  Sum_probs=13.0

Q ss_pred             eeeccCCCceeeceEeee
Q psy3060         110 FVGRSGREAEASPKDWVG  127 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v~  127 (268)
                      +.|-+|.||+..+.=...
T Consensus         9 i~G~~G~GKT~~~~~~~~   26 (131)
T PF13401_consen    9 ISGPPGSGKTTLIKRLAR   26 (131)
T ss_dssp             EEE-TTSSHHHHHHHHHH
T ss_pred             EEcCCCCCHHHHHHHHHH
Confidence            679999999987765443


No 235
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=24.26  E-value=30  Score=28.27  Aligned_cols=17  Identities=18%  Similarity=0.153  Sum_probs=12.6

Q ss_pred             eeeeeccCCCceeeceE
Q psy3060         108 LRFVGRSGREAEASPKD  124 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti  124 (268)
                      +=.+|.||.|||=-|.+
T Consensus        26 ~~i~G~nGsGKSTLl~~   42 (214)
T cd03297          26 TGIFGASGAGKSTLLRC   42 (214)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            45789999999854443


No 236
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=24.25  E-value=35  Score=30.50  Aligned_cols=12  Identities=17%  Similarity=0.293  Sum_probs=11.0

Q ss_pred             eeccCCCceeec
Q psy3060         111 VGRSGREAEASP  122 (268)
Q Consensus       111 VGRSGRGKsFtl  122 (268)
                      .|-+|.||+||+
T Consensus        80 yG~tgSGKT~Tm   91 (341)
T cd01372          80 YGQTGSGKTYTM   91 (341)
T ss_pred             ecCCCCCCcEEe
Confidence            689999999997


No 237
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=24.24  E-value=30  Score=28.00  Aligned_cols=17  Identities=12%  Similarity=0.110  Sum_probs=12.8

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|.||.|||=-+.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l   46 (198)
T TIGR01189        30 QVTGPNGIGKTTLLRIL   46 (198)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999998555443


No 238
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=24.23  E-value=30  Score=30.19  Aligned_cols=19  Identities=16%  Similarity=0.254  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|.||.|||=-+.+..
T Consensus        36 ~~i~G~nGsGKSTLl~~L~   54 (286)
T PRK13646         36 YAIVGQTGSGKSTLIQNIN   54 (286)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4578999999997665543


No 239
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=24.22  E-value=76  Score=29.33  Aligned_cols=90  Identities=13%  Similarity=0.224  Sum_probs=52.7

Q ss_pred             hhhHHhhcCCCCccccCCCceEEeecCcccccCCCCCcceEEEEee-e-cCCCe-EEEEeecCCCccc-ccccc------
Q psy3060          24 TLDSLLAEHPGELTRTGCPHVVCTVLPTHWRSNKTLPVAFKVVALG-D-VMDGT-IVTIRAGNDENYC-GELRN------   93 (268)
Q Consensus        24 ~l~~~l~eh~geLV~T~sP~~lCs~LP~HWRsNKtLP~aFkVvaLg-~-VpDGT-~Vtv~AGNDEN~~-AELRN------   93 (268)
                      .+.+.++...|.-+...+|.+-|. ||.          ..+|-+.. + +++|+ .++|+--...+++ .+|..      
T Consensus        58 ~l~~~ia~~~~~~i~~~~P~l~~~-Lp~----------G~Rv~~~~~p~~~~~~~~~~IRk~~~~~~sl~~l~~~g~~~~  126 (332)
T PRK13900         58 ALGRLVAQATEQKISEEKPLLSAT-LPN----------GYRIQIVFPPACEIGQIVYSIRKPSGMQLTLDDYEKMGAFDE  126 (332)
T ss_pred             HHHHHHHHHcCCcccCCCceEEEE-cCC----------CeEEEEEcCCcccCCCceEEEECCCCCCCCHHHHHhcCCCCc
Confidence            456777788888888899966665 554          33443332 2 34555 5788876654332 22210      


Q ss_pred             ----------------------ceeeeccceeeecceeeeeccCCCceeeceE
Q psy3060          94 ----------------------CTAVMKNQVAKFNDLRFVGRSGREAEASPKD  124 (268)
Q Consensus        94 ----------------------~tAvMKNqVArFNDLRFVGRSGRGKsFtlti  124 (268)
                                            ..+.++..|..--.+=++|..|.||+=.|.-
T Consensus       127 ~~~~~~~~~~~~~l~~~~~~~~~~~~L~~~v~~~~nili~G~tgSGKTTll~a  179 (332)
T PRK13900        127 TATESLVDEDDVILNELLAEKKIKEFLEHAVISKKNIIISGGTSTGKTTFTNA  179 (332)
T ss_pred             ccccccccchhhhhhhhhhhHHHHHHHHHHHHcCCcEEEECCCCCCHHHHHHH
Confidence                                  0122333333344577999999999976643


No 240
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=24.19  E-value=30  Score=29.76  Aligned_cols=17  Identities=18%  Similarity=0.268  Sum_probs=12.5

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|+||.|||=-|.+.
T Consensus        39 ~l~G~nGsGKSTLl~~l   55 (271)
T PRK13632         39 AILGHNGSGKSTISKIL   55 (271)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999999554443


No 241
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=24.07  E-value=30  Score=28.74  Aligned_cols=18  Identities=17%  Similarity=0.134  Sum_probs=13.4

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        31 ~l~G~nGsGKSTLl~~l~   48 (240)
T PRK09493         31 VIIGPSGSGKSTLLRCIN   48 (240)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            368999999996655544


No 242
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=23.98  E-value=31  Score=27.17  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=15.0

Q ss_pred             eeeeccCCCceeeceEeeee
Q psy3060         109 RFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~t  128 (268)
                      -.+|+||.|||=-+.+..+.
T Consensus        30 ~i~G~nGsGKStLl~~l~G~   49 (144)
T cd03221          30 GLVGRNGAGKSTLLKLIAGE   49 (144)
T ss_pred             EEECCCCCCHHHHHHHHcCC
Confidence            47899999999666655443


No 243
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=23.94  E-value=31  Score=27.86  Aligned_cols=14  Identities=21%  Similarity=0.361  Sum_probs=11.0

Q ss_pred             eeeccCCCceeece
Q psy3060         110 FVGRSGREAEASPK  123 (268)
Q Consensus       110 FVGRSGRGKsFtlt  123 (268)
                      .+|.||.|||-...
T Consensus         4 i~G~~GsGKSTl~~   17 (198)
T cd02023           4 IAGGSGSGKTTVAE   17 (198)
T ss_pred             EECCCCCCHHHHHH
Confidence            57999999995443


No 244
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=23.93  E-value=31  Score=28.66  Aligned_cols=19  Identities=11%  Similarity=0.069  Sum_probs=14.2

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-|.+..
T Consensus        31 ~~l~G~nGsGKSTLl~~l~   49 (242)
T TIGR03411        31 RVIIGPNGAGKTTMMDVIT   49 (242)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999996665544


No 245
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=23.86  E-value=30  Score=30.25  Aligned_cols=19  Identities=26%  Similarity=0.448  Sum_probs=14.4

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =++|+||.|||=-|.+..+
T Consensus        31 ~l~G~nGsGKSTLl~~laG   49 (272)
T PRK13547         31 ALLGRNGAGKSTLLKALAG   49 (272)
T ss_pred             EEECCCCCCHHHHHHHHhC
Confidence            4789999999966665544


No 246
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=23.85  E-value=32  Score=26.76  Aligned_cols=17  Identities=18%  Similarity=0.182  Sum_probs=12.9

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|-+|.|||--....
T Consensus         7 ~i~G~~GsGKsTl~~~l   23 (188)
T TIGR01360         7 FIVGGPGSGKGTQCEKI   23 (188)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            47899999999765433


No 247
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=23.75  E-value=32  Score=23.91  Aligned_cols=20  Identities=15%  Similarity=0.262  Sum_probs=15.2

Q ss_pred             ceeeeeccCCCceeeceEee
Q psy3060         107 DLRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       107 DLRFVGRSGRGKsFtlti~v  126 (268)
                      -+-++|-+|.||+..+....
T Consensus        21 ~v~i~G~~G~GKT~l~~~i~   40 (151)
T cd00009          21 NLLLYGPPGTGKTTLARAIA   40 (151)
T ss_pred             eEEEECCCCCCHHHHHHHHH
Confidence            46789999999997554443


No 248
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=23.74  E-value=50  Score=27.64  Aligned_cols=16  Identities=19%  Similarity=0.273  Sum_probs=12.3

Q ss_pred             eeeeccCCCceeeceE
Q psy3060         109 RFVGRSGREAEASPKD  124 (268)
Q Consensus       109 RFVGRSGRGKsFtlti  124 (268)
                      -++|.||.||+=-|.+
T Consensus        26 ~i~G~NGsGKTTLl~a   41 (204)
T cd03240          26 LIVGQNGAGKTTIIEA   41 (204)
T ss_pred             EEECCCCCCHHHHHHH
Confidence            4689999999855554


No 249
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=23.68  E-value=31  Score=25.81  Aligned_cols=15  Identities=20%  Similarity=0.237  Sum_probs=11.7

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +=++|++|.|||--+
T Consensus         3 i~viG~~~~GKSsl~   17 (172)
T cd01862           3 VIILGDSGVGKTSLM   17 (172)
T ss_pred             EEEECCCCCCHHHHH
Confidence            347999999998643


No 250
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=23.67  E-value=27  Score=28.24  Aligned_cols=13  Identities=31%  Similarity=0.401  Sum_probs=10.9

Q ss_pred             eeccCCCceeece
Q psy3060         111 VGRSGREAEASPK  123 (268)
Q Consensus       111 VGRSGRGKsFtlt  123 (268)
                      +|-||.|||--+.
T Consensus         1 ~G~sGsGKSTla~   13 (163)
T PRK11545          1 MGVSGSGKSAVAS   13 (163)
T ss_pred             CCCCCCcHHHHHH
Confidence            5899999997665


No 251
>PRK13159 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=23.66  E-value=1e+02  Score=26.85  Aligned_cols=33  Identities=33%  Similarity=0.516  Sum_probs=27.3

Q ss_pred             CCCCcceE----EEEeeecCCCeE--EEEeecCCCcccc
Q psy3060          57 KTLPVAFK----VVALGDVMDGTI--VTIRAGNDENYCG   89 (268)
Q Consensus        57 KtLP~aFk----VvaLg~VpDGT~--Vtv~AGNDEN~~A   89 (268)
                      --||..||    ||+-|...||+-  -+|.|.-||||..
T Consensus        91 GilPDlFrEGqgVVaeG~~~~g~F~A~~vLAKHde~YmP  129 (155)
T PRK13159         91 GILPDLFRDNQSVIANGRMQGGRFVANEVLAKHDETYMP  129 (155)
T ss_pred             cCCCccccCCCeEEEEEEEcCCEEEEeEEEecCCCcCCC
Confidence            36888885    999998888984  4899999999973


No 252
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=23.62  E-value=31  Score=28.42  Aligned_cols=18  Identities=11%  Similarity=0.071  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -++|.||.|||=-+.+..
T Consensus        41 ~i~G~nGsGKSTLl~~i~   58 (214)
T PRK13543         41 LVQGDNGAGKTTLLRVLA   58 (214)
T ss_pred             EEEcCCCCCHHHHHHHHh
Confidence            368999999996554443


No 253
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=23.55  E-value=32  Score=25.73  Aligned_cols=12  Identities=17%  Similarity=0.230  Sum_probs=10.2

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-++|.+|.|||
T Consensus         3 i~i~G~~~~GKS   14 (171)
T cd00157           3 IVVVGDGAVGKT   14 (171)
T ss_pred             EEEECCCCCCHH
Confidence            358999999997


No 254
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=23.53  E-value=31  Score=28.80  Aligned_cols=18  Identities=17%  Similarity=0.291  Sum_probs=13.6

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -++|+||.|||=-+.+..
T Consensus        52 ~i~G~nGsGKSTLl~~l~   69 (224)
T cd03220          52 GLIGRNGAGKSTLLRLLA   69 (224)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996555544


No 255
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=23.47  E-value=32  Score=28.59  Aligned_cols=21  Identities=14%  Similarity=0.262  Sum_probs=15.7

Q ss_pred             eeeeeccCCCceeeceEeeee
Q psy3060         108 LRFVGRSGREAEASPKDWVGT  128 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~t  128 (268)
                      +-++|.||.|||=-+.+..+-
T Consensus        30 ~~i~G~nGsGKSTLl~~l~Gl   50 (248)
T PRK09580         30 HAIMGPNGSGKSTLSATLAGR   50 (248)
T ss_pred             EEEECCCCCCHHHHHHHHcCC
Confidence            467999999999666655543


No 256
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=23.46  E-value=30  Score=31.25  Aligned_cols=20  Identities=30%  Similarity=0.443  Sum_probs=15.3

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +-+||.||.|||=.+.+..+
T Consensus        36 ~~lvG~sGsGKSTL~~~l~G   55 (326)
T PRK11022         36 VGIVGESGSGKSVSSLAIMG   55 (326)
T ss_pred             EEEECCCCChHHHHHHHHHc
Confidence            45799999999977665544


No 257
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=23.44  E-value=32  Score=29.40  Aligned_cols=19  Identities=11%  Similarity=0.221  Sum_probs=13.9

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|.||.|||=-|.+..
T Consensus        31 ~~i~G~nGsGKSTLl~~i~   49 (258)
T PRK13548         31 VAILGPNGAGKSTLLRALS   49 (258)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999996555443


No 258
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=23.33  E-value=32  Score=29.41  Aligned_cols=19  Identities=21%  Similarity=0.354  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-|.+..
T Consensus        40 ~~i~G~nGsGKSTLl~~l~   58 (265)
T TIGR02769        40 VGLLGRSGCGKSTLARLLL   58 (265)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996655443


No 259
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=23.32  E-value=19  Score=34.05  Aligned_cols=18  Identities=17%  Similarity=0.169  Sum_probs=15.2

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=++|-||+|||=+|.+.
T Consensus        32 ~vllGPSGcGKSTlLr~I   49 (338)
T COG3839          32 VVLLGPSGCGKSTLLRMI   49 (338)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457899999999888765


No 260
>PLN03073 ABC transporter F family; Provisional
Probab=23.32  E-value=32  Score=34.99  Aligned_cols=19  Identities=21%  Similarity=0.225  Sum_probs=15.1

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =+||+||.|||=-|.+..+
T Consensus       207 gLvG~NGsGKSTLLr~l~g  225 (718)
T PLN03073        207 GLVGRNGTGKTTFLRYMAM  225 (718)
T ss_pred             EEECCCCCCHHHHHHHHcC
Confidence            3699999999977777643


No 261
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain. The small subunit of the archeal DNA polymerase II contains a C-terminal metallophosphatase domain.  This domain is thought to be functionally active because the active site residues required for phosphoesterase activity in other members of this superfamily are intact.  The archeal replicative DNA polymerases are thought to possess intrinsic phosphatase activity that hydrolyzes the pyrophosphate released during nucleotide polymerization.  This domain belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiestera
Probab=23.29  E-value=1.1e+02  Score=25.99  Aligned_cols=20  Identities=25%  Similarity=0.282  Sum_probs=16.6

Q ss_pred             eecCCCeEEEEeecCCCccc
Q psy3060          69 GDVMDGTIVTIRAGNDENYC   88 (268)
Q Consensus        69 g~VpDGT~Vtv~AGNDEN~~   88 (268)
                      .+...++.|.+.+||-+.+.
T Consensus        76 ~~L~~~~~v~~ipGNHD~~~   95 (243)
T cd07386          76 SDVPSHIKIIIIPGNHDAVR   95 (243)
T ss_pred             HhcccCCeEEEeCCCCCccc
Confidence            56778899999999988753


No 262
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=23.16  E-value=32  Score=28.75  Aligned_cols=19  Identities=16%  Similarity=0.158  Sum_probs=14.2

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      -.+|.||.|||=-|.+..+
T Consensus        33 ~i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14262         33 AIIGPSGCGKTTLLRSINR   51 (250)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            3689999999976655543


No 263
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.
Probab=23.16  E-value=32  Score=32.78  Aligned_cols=18  Identities=11%  Similarity=0.102  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =++|+||+|||=-|.+.-
T Consensus        35 ~liG~NGsGKSTLl~~i~   52 (552)
T TIGR03719        35 GVLGLNGAGKSTLLRIMA   52 (552)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996655543


No 264
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=23.13  E-value=32  Score=28.75  Aligned_cols=20  Identities=15%  Similarity=0.192  Sum_probs=14.5

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +=.+|.||.|||=-|.+..+
T Consensus        32 ~~i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14247         32 TALMGPSGSGKSTLLRVFNR   51 (250)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34689999999966655543


No 265
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=23.12  E-value=33  Score=27.02  Aligned_cols=14  Identities=29%  Similarity=0.572  Sum_probs=11.3

Q ss_pred             ceeeeeccCCCcee
Q psy3060         107 DLRFVGRSGREAEA  120 (268)
Q Consensus       107 DLRFVGRSGRGKsF  120 (268)
                      .+=++|++|.|||=
T Consensus        20 ~i~ivG~~~~GKSt   33 (179)
T TIGR03598        20 EIAFAGRSNVGKSS   33 (179)
T ss_pred             EEEEEcCCCCCHHH
Confidence            34679999999983


No 266
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=23.08  E-value=32  Score=28.85  Aligned_cols=19  Identities=16%  Similarity=0.118  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-+.+..
T Consensus        33 ~~i~G~nGsGKSTLl~~l~   51 (251)
T PRK14270         33 TALIGPSGCGKSTFLRCLN   51 (251)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3478999999986555444


No 267
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes.
Probab=23.07  E-value=30  Score=32.34  Aligned_cols=15  Identities=33%  Similarity=0.397  Sum_probs=11.4

Q ss_pred             eeeccCCCceeeceE
Q psy3060         110 FVGRSGREAEASPKD  124 (268)
Q Consensus       110 FVGRSGRGKsFtlti  124 (268)
                      .+|+||.|||==+.+
T Consensus       363 IvG~sGsGKSTLl~l  377 (571)
T TIGR02203       363 LVGRSGSGKSTLVNL  377 (571)
T ss_pred             EECCCCCCHHHHHHH
Confidence            699999999943333


No 268
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=23.02  E-value=25  Score=28.50  Aligned_cols=18  Identities=17%  Similarity=0.261  Sum_probs=12.7

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=..|.+|.|||..|.-.
T Consensus        41 ~li~G~tgsGKS~~l~~l   58 (205)
T PF01580_consen   41 LLIAGATGSGKSTLLRTL   58 (205)
T ss_dssp             EEEE--TTSSHHHHHHHH
T ss_pred             EEEEcCCCCCccHHHHHH
Confidence            457899999999988744


No 269
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=23.01  E-value=40  Score=25.17  Aligned_cols=12  Identities=17%  Similarity=0.362  Sum_probs=10.3

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|.+|.|||
T Consensus         2 i~iiG~~~~GKs   13 (158)
T cd00878           2 ILILGLDGAGKT   13 (158)
T ss_pred             EEEEcCCCCCHH
Confidence            457999999997


No 270
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=22.91  E-value=33  Score=28.74  Aligned_cols=19  Identities=16%  Similarity=0.190  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||==|.+..
T Consensus        34 ~~l~G~nGsGKSTLl~~l~   52 (252)
T PRK14255         34 TALIGPSGCGKSTYLRTLN   52 (252)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4578999999996555443


No 271
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=22.87  E-value=33  Score=28.70  Aligned_cols=18  Identities=11%  Similarity=0.167  Sum_probs=13.4

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-+.+..
T Consensus        35 ~l~G~nGsGKSTLl~~l~   52 (255)
T PRK11300         35 SLIGPNGAGKTTVFNCLT   52 (255)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            368999999996555443


No 272
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=22.86  E-value=38  Score=30.50  Aligned_cols=13  Identities=15%  Similarity=0.299  Sum_probs=11.2

Q ss_pred             eeccCCCceeece
Q psy3060         111 VGRSGREAEASPK  123 (268)
Q Consensus       111 VGRSGRGKsFtlt  123 (268)
                      .|-+|.||+||+.
T Consensus        88 yG~tgSGKTyTm~  100 (333)
T cd01371          88 YGQTGTGKTFTME  100 (333)
T ss_pred             cCCCCCCCcEeec
Confidence            4889999999974


No 273
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=22.85  E-value=33  Score=27.89  Aligned_cols=17  Identities=18%  Similarity=0.120  Sum_probs=13.5

Q ss_pred             eeeccCCCceeeceEee
Q psy3060         110 FVGRSGREAEASPKDWV  126 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v  126 (268)
                      ++|.||.|||=-+.+..
T Consensus        32 l~G~nGsGKSTLl~~i~   48 (200)
T PRK13540         32 LKGSNGAGKTTLLKLIA   48 (200)
T ss_pred             EECCCCCCHHHHHHHHh
Confidence            68999999997666554


No 274
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=22.74  E-value=34  Score=29.08  Aligned_cols=10  Identities=20%  Similarity=0.537  Sum_probs=9.3

Q ss_pred             eeeccCCCce
Q psy3060         110 FVGRSGREAE  119 (268)
Q Consensus       110 FVGRSGRGKs  119 (268)
                      ++|.+|.|||
T Consensus        27 i~G~NGsGKS   36 (247)
T cd03275          27 IIGPNGSGKS   36 (247)
T ss_pred             EECCCCCCHH
Confidence            7899999997


No 275
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=22.72  E-value=33  Score=28.57  Aligned_cols=18  Identities=17%  Similarity=0.228  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=.+|.||.|||=-+.+.
T Consensus        32 ~~i~G~nGsGKSTLl~~l   49 (250)
T PRK11264         32 VAIIGPSGSGKTTLLRCI   49 (250)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            346899999999655544


No 276
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=22.70  E-value=30  Score=28.94  Aligned_cols=19  Identities=21%  Similarity=0.293  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-+.+..
T Consensus        28 ~~l~G~nGsGKSTLl~~l~   46 (177)
T cd03222          28 IGIVGPNGTGKTTAVKILA   46 (177)
T ss_pred             EEEECCCCChHHHHHHHHH
Confidence            3478999999997666554


No 277
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=22.68  E-value=33  Score=29.44  Aligned_cols=18  Identities=17%  Similarity=0.051  Sum_probs=13.2

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (269)
T PRK11831         37 AIMGPSGIGKTTLLRLIG   54 (269)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996555443


No 278
>PTZ00132 GTP-binding nuclear protein Ran; Provisional
Probab=22.66  E-value=33  Score=27.82  Aligned_cols=15  Identities=27%  Similarity=0.290  Sum_probs=12.2

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +=++|.+|.|||=-+
T Consensus        12 v~liG~~g~GKTtLi   26 (215)
T PTZ00132         12 LILVGDGGVGKTTFV   26 (215)
T ss_pred             EEEECCCCCCHHHHH
Confidence            568999999998544


No 279
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein.
Probab=22.63  E-value=33  Score=33.98  Aligned_cols=16  Identities=25%  Similarity=0.405  Sum_probs=11.9

Q ss_pred             eeeeeccCCCceeece
Q psy3060         108 LRFVGRSGREAEASPK  123 (268)
Q Consensus       108 LRFVGRSGRGKsFtlt  123 (268)
                      .=.||+||.|||=-+.
T Consensus       510 vaIvG~SGsGKSTLl~  525 (711)
T TIGR00958       510 VALVGPSGSGKSTVAA  525 (711)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3469999999994443


No 280
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=22.63  E-value=40  Score=30.22  Aligned_cols=13  Identities=15%  Similarity=0.199  Sum_probs=11.4

Q ss_pred             eeccCCCceeece
Q psy3060         111 VGRSGREAEASPK  123 (268)
Q Consensus       111 VGRSGRGKsFtlt  123 (268)
                      .|-+|.||+||+-
T Consensus        87 yG~tgSGKTyTm~   99 (319)
T cd01376          87 YGSTGAGKTHTML   99 (319)
T ss_pred             ECCCCCCCcEEEe
Confidence            4999999999984


No 281
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=22.54  E-value=27  Score=34.08  Aligned_cols=17  Identities=12%  Similarity=0.049  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceE
Q psy3060         108 LRFVGRSGREAEASPKD  124 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti  124 (268)
                      .=.+|.||.||||.+..
T Consensus       437 ~~I~G~tGsGKS~~~~~  453 (785)
T TIGR00929       437 TLIFGPTGSGKTTLLNF  453 (785)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            45789999999998854


No 282
>PRK07261 topology modulation protein; Provisional
Probab=22.51  E-value=35  Score=27.80  Aligned_cols=11  Identities=27%  Similarity=0.483  Sum_probs=9.6

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =.+|-||.|||
T Consensus         4 ~i~G~~GsGKS   14 (171)
T PRK07261          4 AIIGYSGSGKS   14 (171)
T ss_pred             EEEcCCCCCHH
Confidence            36899999998


No 283
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=22.46  E-value=4.5e+02  Score=21.75  Aligned_cols=76  Identities=14%  Similarity=0.121  Sum_probs=53.7

Q ss_pred             cCCCCcc-ccCCCceEEeecCcccccCCCCCcceEEEEeeecCCCeEEEEeecCCCccccccccceeeeccceeeeccee
Q psy3060          31 EHPGELT-RTGCPHVVCTVLPTHWRSNKTLPVAFKVVALGDVMDGTIVTIRAGNDENYCGELRNCTAVMKNQVAKFNDLR  109 (268)
Q Consensus        31 eh~geLV-~T~sP~~lCs~LP~HWRsNKtLP~aFkVvaLg~VpDGT~Vtv~AGNDEN~~AELRN~tAvMKNqVArFNDLR  109 (268)
                      +-.+.|| ..++=.+.|..      |..++...|+|=-+...|+|..|...-.|.+++..       ..|   .||    
T Consensus         4 ~~~~~lv~p~~sv~LsC~~------sg~~~s~e~~~~wvRq~pg~lE~c~~~~~~g~~~~-------~~~---~r~----   63 (115)
T cd05721           4 QQSPVLASSNGAASLVCEY------TYNGFSKEFRASLLKGADSAVEVCAVTGNMSNQLQ-------TSL---DGF----   63 (115)
T ss_pred             ecCCeEEcCCCCEEEEEEe------cCCccccEEEEEEEEeCCCCcEEEEEEeCCCcccc-------ccC---CCe----
Confidence            3344444 45566899987      56677778999989999999888888888877221       112   122    


Q ss_pred             eeeccCCCceeeceEee
Q psy3060         110 FVGRSGREAEASPKDWV  126 (268)
Q Consensus       110 FVGRSGRGKsFtlti~v  126 (268)
                      ...|.-...+++|+|+=
T Consensus        64 tcs~~~s~ntv~L~l~~   80 (115)
T cd05721          64 NCDGTLGNEQVNFTLQN   80 (115)
T ss_pred             EEeEeCCCCEEEEEEcC
Confidence            46777788889999984


No 284
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=22.45  E-value=35  Score=26.07  Aligned_cols=12  Identities=25%  Similarity=0.376  Sum_probs=10.1

Q ss_pred             eeeccCCCceee
Q psy3060         110 FVGRSGREAEAS  121 (268)
Q Consensus       110 FVGRSGRGKsFt  121 (268)
                      +.|-+|.|||-.
T Consensus         4 l~G~~GsGKST~   15 (150)
T cd02021           4 VMGVSGSGKSTV   15 (150)
T ss_pred             EEcCCCCCHHHH
Confidence            689999999854


No 285
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=22.37  E-value=34  Score=28.07  Aligned_cols=19  Identities=21%  Similarity=0.136  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|.||.|||=-+.+.-
T Consensus        43 ~~i~G~nGsGKSTLl~~l~   61 (226)
T cd03248          43 TALVGPSGSGKSTVVALLE   61 (226)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999997666554


No 286
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=22.33  E-value=34  Score=29.37  Aligned_cols=18  Identities=17%  Similarity=0.272  Sum_probs=13.6

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        37 ~l~G~nGsGKSTLl~~i~   54 (280)
T PRK13649         37 AFIGHTGSGKSTIMQLLN   54 (280)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996655543


No 287
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=22.33  E-value=34  Score=29.69  Aligned_cols=19  Identities=26%  Similarity=0.281  Sum_probs=13.9

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.+|.||.|||=-|.+..
T Consensus        41 ~~I~G~NGsGKSTLlk~l~   59 (257)
T PRK11247         41 VAVVGRSGCGKSTLLRLLA   59 (257)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996555543


No 288
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=22.33  E-value=34  Score=29.13  Aligned_cols=17  Identities=18%  Similarity=0.284  Sum_probs=12.8

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =++|+||.|||=-|.+.
T Consensus        46 ~i~G~nGsGKSTLl~~l   62 (265)
T PRK14252         46 ALIGPSGCGKSTFLRCF   62 (265)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999999655444


No 289
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=22.31  E-value=34  Score=28.64  Aligned_cols=20  Identities=15%  Similarity=0.169  Sum_probs=14.7

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +-.+|.||.|||=-|.+..+
T Consensus        30 ~~i~G~nGsGKSTLl~~l~G   49 (247)
T TIGR00972        30 TALIGPSGCGKSTLLRSLNR   49 (247)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34689999999976665543


No 290
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=22.31  E-value=55  Score=27.36  Aligned_cols=14  Identities=29%  Similarity=0.304  Sum_probs=11.5

Q ss_pred             eeeeccCCCceeec
Q psy3060         109 RFVGRSGREAEASP  122 (268)
Q Consensus       109 RFVGRSGRGKsFtl  122 (268)
                      -|+|++|.|||--|
T Consensus        25 ~i~G~NGsGKStll   38 (198)
T cd03276          25 FIVGNNGSGKSAIL   38 (198)
T ss_pred             EEECCCCCcHHHHH
Confidence            48999999998544


No 291
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=22.16  E-value=35  Score=25.45  Aligned_cols=12  Identities=25%  Similarity=0.448  Sum_probs=10.0

Q ss_pred             eeeeccCCCcee
Q psy3060         109 RFVGRSGREAEA  120 (268)
Q Consensus       109 RFVGRSGRGKsF  120 (268)
                      =++|.+|.|||=
T Consensus         4 ~v~G~~~~GKSs   15 (161)
T cd01863           4 LLIGDSGVGKSS   15 (161)
T ss_pred             EEECCCCCCHHH
Confidence            378999999973


No 292
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=22.09  E-value=35  Score=29.59  Aligned_cols=19  Identities=26%  Similarity=0.386  Sum_probs=13.8

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|.||.|||=-|.+..
T Consensus        39 ~~l~G~nGsGKSTLl~~l~   57 (280)
T PRK13633         39 LVILGRNGSGKSTIAKHMN   57 (280)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3478999999996555443


No 293
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=22.09  E-value=35  Score=28.96  Aligned_cols=20  Identities=20%  Similarity=0.376  Sum_probs=14.4

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +=++|.||.|||=-+.+..+
T Consensus        33 ~~i~G~nGsGKSTLl~~i~G   52 (262)
T PRK09984         33 VALLGPSGSGKSTLLRHLSG   52 (262)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            34689999999965555443


No 294
>PF07887 Calmodulin_bind:  Calmodulin binding protein-like;  InterPro: IPR012416 The members of this family are putative or actual calmodulin binding proteins expressed by various plant species. Some members (for example, Q8H6T7 from SWISSPROT), are known to be involved in the induction of plant defence responses []. However, their precise function in this regard is as yet unknown. 
Probab=22.08  E-value=93  Score=29.57  Aligned_cols=33  Identities=27%  Similarity=0.328  Sum_probs=26.5

Q ss_pred             eeeeccceeeecceeeeeccC--CCceeeceEeee
Q psy3060          95 TAVMKNQVAKFNDLRFVGRSG--REAEASPKDWVG  127 (268)
Q Consensus        95 tAvMKNqVArFNDLRFVGRSG--RGKsFtlti~v~  127 (268)
                      .-.|+|.+|-..|+.|-.=|-  |++.|.|-..|.
T Consensus        91 ~v~L~~G~a~l~di~FtdnSs~~rsrKFRLgarv~  125 (299)
T PF07887_consen   91 QVTLKNGVATLGDISFTDNSSWIRSRKFRLGARVV  125 (299)
T ss_pred             EEEecCCEEEccccEEecCcccccCCcEEEEEEEc
Confidence            557999999999999998772  334499998884


No 295
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=22.06  E-value=35  Score=29.74  Aligned_cols=18  Identities=11%  Similarity=0.189  Sum_probs=13.4

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-++|+||.|||=-+.+.
T Consensus        35 ~~i~G~nGaGKSTLl~~i   52 (283)
T PRK13636         35 TAILGGNGAGKSTLFQNL   52 (283)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            346899999999655544


No 296
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=21.99  E-value=34  Score=29.91  Aligned_cols=18  Identities=11%  Similarity=0.244  Sum_probs=13.7

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =++|.||.|||=-+.+..
T Consensus        37 ~i~G~nGaGKSTLl~~l~   54 (287)
T PRK13637         37 GLIGHTGSGKSTLIQHLN   54 (287)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            468999999997665543


No 297
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=21.98  E-value=35  Score=28.33  Aligned_cols=18  Identities=22%  Similarity=0.062  Sum_probs=13.5

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      -.+|.||.|||=-|.+..
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (225)
T PRK10247         37 LITGPSGCGKSTLLKIVA   54 (225)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996665543


No 298
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=21.94  E-value=35  Score=26.06  Aligned_cols=15  Identities=13%  Similarity=0.162  Sum_probs=11.7

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +=+||.+|.|||--+
T Consensus         4 v~~vG~~~vGKTsli   18 (165)
T cd04140           4 VVVFGAGGVGKSSLV   18 (165)
T ss_pred             EEEECCCCCCHHHHH
Confidence            348999999998544


No 299
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=21.93  E-value=42  Score=30.34  Aligned_cols=19  Identities=21%  Similarity=0.385  Sum_probs=14.0

Q ss_pred             ecceeee-eccCCCceeece
Q psy3060         105 FNDLRFV-GRSGREAEASPK  123 (268)
Q Consensus       105 FNDLRFV-GRSGRGKsFtlt  123 (268)
                      ||-.=|. |-+|.||+|||.
T Consensus        81 ~n~~i~ayG~tgSGKTyTl~  100 (352)
T cd01364          81 YNCTIFAYGQTGTGKTYTME  100 (352)
T ss_pred             CeEEEEECCCCCCCCcEEec
Confidence            4444443 899999999984


No 300
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=21.90  E-value=26  Score=26.74  Aligned_cols=19  Identities=21%  Similarity=0.347  Sum_probs=12.5

Q ss_pred             cceeeeeccCCCceeeceE
Q psy3060         106 NDLRFVGRSGREAEASPKD  124 (268)
Q Consensus       106 NDLRFVGRSGRGKsFtlti  124 (268)
                      +=+=++|-+|.|||.-|.-
T Consensus        25 ~~~ll~G~~G~GKT~ll~~   43 (185)
T PF13191_consen   25 RNLLLTGESGSGKTSLLRA   43 (185)
T ss_dssp             --EEE-B-TTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4466789999999988764


No 301
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=21.88  E-value=37  Score=24.89  Aligned_cols=14  Identities=14%  Similarity=0.235  Sum_probs=11.0

Q ss_pred             eeeeccCCCceeec
Q psy3060         109 RFVGRSGREAEASP  122 (268)
Q Consensus       109 RFVGRSGRGKsFtl  122 (268)
                      =++|.+|.|||=-+
T Consensus         6 ~i~G~~~~GKstli   19 (174)
T cd01895           6 AIIGRPNVGKSSLV   19 (174)
T ss_pred             EEEcCCCCCHHHHH
Confidence            47899999998433


No 302
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=21.84  E-value=35  Score=29.23  Aligned_cols=17  Identities=18%  Similarity=0.044  Sum_probs=12.8

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-|.+.
T Consensus        31 ~i~G~nGsGKSTLl~~l   47 (255)
T PRK11248         31 VVLGPSGCGKTTLLNLI   47 (255)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999999655544


No 303
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=21.84  E-value=36  Score=28.51  Aligned_cols=17  Identities=12%  Similarity=0.169  Sum_probs=13.3

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -++|+||.|||=-+.+.
T Consensus        29 ~i~G~nG~GKStLl~~l   45 (235)
T cd03299          29 VILGPTGSGKSVLLETI   45 (235)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            47899999998666554


No 304
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=21.78  E-value=33  Score=34.69  Aligned_cols=19  Identities=26%  Similarity=0.340  Sum_probs=14.7

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      |=.||.||+|||-+.-...
T Consensus        38 lgIvGESGsGKSt~a~~i~   56 (539)
T COG1123          38 LGIVGESGSGKSTLALALM   56 (539)
T ss_pred             EEEEcCCCCCHHHHHHHHh
Confidence            4579999999997765544


No 305
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.73  E-value=36  Score=28.62  Aligned_cols=18  Identities=17%  Similarity=0.228  Sum_probs=13.1

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-.+|.||.|||==|.+.
T Consensus        33 ~~i~G~nGsGKSTLl~~l   50 (252)
T PRK14256         33 TAIIGPSGCGKSTVLRSI   50 (252)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            447899999998544444


No 306
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=21.65  E-value=36  Score=29.93  Aligned_cols=19  Identities=11%  Similarity=0.288  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|.||.|||=.|.+..
T Consensus        33 ~~l~G~NGaGKSTLl~~l~   51 (303)
T TIGR01288        33 FGLLGPNGAGKSTIARMLL   51 (303)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996665543


No 307
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=21.61  E-value=38  Score=25.13  Aligned_cols=13  Identities=15%  Similarity=0.102  Sum_probs=10.6

Q ss_pred             eeeeccCCCceee
Q psy3060         109 RFVGRSGREAEAS  121 (268)
Q Consensus       109 RFVGRSGRGKsFt  121 (268)
                      =++|.+|.|||=-
T Consensus         3 ~~vG~~~~GKTsl   15 (162)
T cd04157           3 LVVGLDNSGKTTI   15 (162)
T ss_pred             EEECCCCCCHHHH
Confidence            4799999999743


No 308
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=21.61  E-value=36  Score=27.09  Aligned_cols=13  Identities=15%  Similarity=0.317  Sum_probs=11.0

Q ss_pred             eeeeeccCCCcee
Q psy3060         108 LRFVGRSGREAEA  120 (268)
Q Consensus       108 LRFVGRSGRGKsF  120 (268)
                      .-++|++|.|||=
T Consensus        44 I~iiG~~g~GKSt   56 (204)
T cd01878          44 VALVGYTNAGKST   56 (204)
T ss_pred             EEEECCCCCCHHH
Confidence            4688999999983


No 309
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.59  E-value=36  Score=28.56  Aligned_cols=16  Identities=25%  Similarity=0.418  Sum_probs=12.3

Q ss_pred             eeeccCCCceeeceEe
Q psy3060         110 FVGRSGREAEASPKDW  125 (268)
Q Consensus       110 FVGRSGRGKsFtlti~  125 (268)
                      .+|.||.|||=-+.+.
T Consensus        36 I~G~nGsGKSTLl~~i   51 (251)
T PRK14244         36 FIGPSGCGKSTFLRCF   51 (251)
T ss_pred             EECCCCCCHHHHHHHH
Confidence            6899999999655543


No 310
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.50  E-value=36  Score=28.85  Aligned_cols=19  Identities=16%  Similarity=0.118  Sum_probs=14.2

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.+|.||.|||=-|.+..+
T Consensus        42 ~i~G~nGsGKSTLl~~i~G   60 (258)
T PRK14268         42 ALIGPSGCGKSTFIRCLNR   60 (258)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            3689999999966655543


No 311
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=21.49  E-value=37  Score=27.96  Aligned_cols=21  Identities=19%  Similarity=0.242  Sum_probs=15.8

Q ss_pred             eeeeccCCCceeeceEeeeee
Q psy3060         109 RFVGRSGREAEASPKDWVGTL  129 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~t~  129 (268)
                      =.+|.||.|||=-|.+..+.+
T Consensus        37 ~i~G~nGsGKSTLl~~l~G~~   57 (202)
T cd03233          37 LVLGRPGSGCSTLLKALANRT   57 (202)
T ss_pred             EEECCCCCCHHHHHHHhcccC
Confidence            468999999997776665543


No 312
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=21.48  E-value=36  Score=28.33  Aligned_cols=17  Identities=12%  Similarity=0.216  Sum_probs=12.7

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -.+|.||.|||=-+.+.
T Consensus        10 ~l~G~nGsGKSTLl~~l   26 (223)
T TIGR03771        10 GLLGPNGAGKTTLLRAI   26 (223)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999999555444


No 313
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=21.47  E-value=38  Score=26.19  Aligned_cols=12  Identities=8%  Similarity=0.191  Sum_probs=10.5

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=++|.+|.|||
T Consensus        17 v~ivG~~~~GKT   28 (173)
T cd04154          17 ILILGLDNAGKT   28 (173)
T ss_pred             EEEECCCCCCHH
Confidence            458999999998


No 314
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=21.43  E-value=37  Score=27.17  Aligned_cols=19  Identities=21%  Similarity=0.232  Sum_probs=14.3

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-++|.||.|||=-+.+.-
T Consensus        30 ~~i~G~nGsGKSTLl~~l~   48 (166)
T cd03223          30 LLITGPSGTGKSSLFRALA   48 (166)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4578999999996665543


No 315
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=21.35  E-value=36  Score=30.93  Aligned_cols=19  Identities=26%  Similarity=0.368  Sum_probs=14.7

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=++|.||.|||=-+.+..
T Consensus        50 ~~lvG~sGsGKSTLlk~i~   68 (331)
T PRK15079         50 LGVVGESGCGKSTFARAII   68 (331)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4478999999997766554


No 316
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=21.21  E-value=37  Score=29.41  Aligned_cols=19  Identities=21%  Similarity=0.364  Sum_probs=14.6

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-|.+..
T Consensus        49 ~~IiG~nGsGKSTLl~~l~   67 (274)
T PRK14265         49 IAFIGPSGCGKSTLLRCFN   67 (274)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            4579999999996665544


No 317
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=21.18  E-value=38  Score=28.32  Aligned_cols=18  Identities=22%  Similarity=0.224  Sum_probs=13.2

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        31 ~i~G~nGsGKSTLl~~l~   48 (242)
T cd03295          31 VLIGPSGSGKTTTMKMIN   48 (242)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            358999999996555443


No 318
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=21.05  E-value=38  Score=27.62  Aligned_cols=18  Identities=22%  Similarity=0.285  Sum_probs=13.1

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-+.+..
T Consensus        34 ~i~G~nGsGKSTLl~~l~   51 (221)
T cd03244          34 GIVGRTGSGKSSLLLALF   51 (221)
T ss_pred             EEECCCCCCHHHHHHHHH
Confidence            357999999996555443


No 319
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=21.03  E-value=37  Score=30.76  Aligned_cols=19  Identities=26%  Similarity=0.288  Sum_probs=13.9

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +=.||.||.|||=-+.+..
T Consensus        44 ~~IvG~sGsGKSTLl~~l~   62 (327)
T PRK11308         44 LAVVGESGCGKSTLARLLT   62 (327)
T ss_pred             EEEECCCCCcHHHHHHHHH
Confidence            3468999999996665543


No 320
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=20.96  E-value=38  Score=29.15  Aligned_cols=19  Identities=16%  Similarity=0.263  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceEee
Q psy3060         108 LRFVGRSGREAEASPKDWV  126 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v  126 (268)
                      +-.+|+||.|||=-+.+..
T Consensus        33 ~~I~G~NGsGKSTLl~~i~   51 (251)
T PRK09544         33 LTLLGPNGAGKSTLVRVVL   51 (251)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            3468999999996665544


No 321
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=20.94  E-value=38  Score=27.85  Aligned_cols=18  Identities=17%  Similarity=-0.001  Sum_probs=13.0

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-+.+..
T Consensus        35 ~I~G~nGsGKStLl~~l~   52 (220)
T TIGR02982        35 ILTGPSGSGKTTLLTLIG   52 (220)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999995554443


No 322
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=20.94  E-value=39  Score=30.22  Aligned_cols=13  Identities=23%  Similarity=0.225  Sum_probs=10.2

Q ss_pred             eeeccCCCceeec
Q psy3060         110 FVGRSGREAEASP  122 (268)
Q Consensus       110 FVGRSGRGKsFtl  122 (268)
                      +.|.||+|||==+
T Consensus        26 vtGvSGsGKStL~   38 (261)
T cd03271          26 VTGVSGSGKSSLI   38 (261)
T ss_pred             EECCCCCchHHHH
Confidence            4699999998433


No 323
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=20.89  E-value=38  Score=26.61  Aligned_cols=11  Identities=18%  Similarity=0.308  Sum_probs=9.5

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =|+|.+|.|||
T Consensus         4 ~v~G~~~vGKS   14 (188)
T cd04125           4 VIIGDYGVGKS   14 (188)
T ss_pred             EEECCCCCCHH
Confidence            48999999994


No 324
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=20.88  E-value=38  Score=28.25  Aligned_cols=19  Identities=16%  Similarity=0.149  Sum_probs=14.4

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      =.+|.||.|||=-|.+..+
T Consensus        34 ~i~G~nGsGKSTLl~~i~G   52 (252)
T PRK14272         34 ALIGPSGCGKTTFLRAINR   52 (252)
T ss_pred             EEECCCCCCHHHHHHHHhc
Confidence            4789999999966655544


No 325
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=20.77  E-value=37  Score=32.03  Aligned_cols=20  Identities=25%  Similarity=0.380  Sum_probs=14.0

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +=.+|+||.|||=-|.+..+
T Consensus        38 ~~iiG~nGsGKSTLl~~i~G   57 (529)
T PRK15134         38 LALVGESGSGKSVTALSILR   57 (529)
T ss_pred             EEEECCCCCcHHHHHHHHhc
Confidence            34689999999865444443


No 326
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=20.74  E-value=39  Score=26.49  Aligned_cols=11  Identities=9%  Similarity=0.244  Sum_probs=10.0

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =++|.+|.|||
T Consensus         4 ~vvG~~~vGKS   14 (193)
T cd04118           4 VMLGKESVGKT   14 (193)
T ss_pred             EEECCCCCCHH
Confidence            47999999998


No 327
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=20.73  E-value=46  Score=25.03  Aligned_cols=12  Identities=17%  Similarity=0.160  Sum_probs=10.0

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +-++|++|.|||
T Consensus         3 i~~~G~~~~GKs   14 (168)
T cd01897           3 LVIAGYPNVGKS   14 (168)
T ss_pred             EEEEcCCCCCHH
Confidence            347899999997


No 328
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=20.72  E-value=45  Score=29.74  Aligned_cols=22  Identities=14%  Similarity=0.264  Sum_probs=14.7

Q ss_pred             eeeecceee-eeccCCCceeece
Q psy3060         102 VAKFNDLRF-VGRSGREAEASPK  123 (268)
Q Consensus       102 VArFNDLRF-VGRSGRGKsFtlt  123 (268)
                      ++=||=.=| .|-+|.||+||+.
T Consensus        70 l~G~n~~i~ayG~tgSGKT~T~~   92 (321)
T cd01374          70 LEGYNGTIFAYGQTSSGKTFTMS   92 (321)
T ss_pred             HCCCceeEEeecCCCCCCceecc
Confidence            334443333 3889999999985


No 329
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=20.70  E-value=39  Score=27.78  Aligned_cols=17  Identities=18%  Similarity=0.178  Sum_probs=12.8

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      =.+|.||.|||=-|.+.
T Consensus        30 ~i~G~nGsGKSTLl~~l   46 (223)
T TIGR03740        30 GLLGPNGAGKSTLLKMI   46 (223)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999999655544


No 330
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Probab=20.68  E-value=38  Score=31.24  Aligned_cols=18  Identities=17%  Similarity=0.154  Sum_probs=13.6

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +-++|.||.|||=-|.+.
T Consensus        34 ~gIiG~sGaGKSTLlr~I   51 (343)
T TIGR02314        34 YGVIGASGAGKSTLIRCV   51 (343)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457999999998655443


No 331
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=20.68  E-value=39  Score=29.10  Aligned_cols=17  Identities=24%  Similarity=0.249  Sum_probs=12.5

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -.+|.||.|||=-|.+.
T Consensus        37 ~l~G~nGsGKSTLl~~l   53 (272)
T PRK15056         37 ALVGVNGSGKSTLFKAL   53 (272)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            36899999999554443


No 332
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=20.66  E-value=39  Score=29.38  Aligned_cols=18  Identities=11%  Similarity=0.219  Sum_probs=13.8

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-+.+..
T Consensus        37 ~i~G~nGsGKSTLl~~l~   54 (279)
T PRK13650         37 SIIGHNGSGKSTTVRLID   54 (279)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999997665543


No 333
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=20.61  E-value=39  Score=29.00  Aligned_cols=20  Identities=15%  Similarity=0.205  Sum_probs=14.1

Q ss_pred             eeeeeccCCCceeeceEeee
Q psy3060         108 LRFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~v~  127 (268)
                      +=.+|.||.|||=-|.+..+
T Consensus        49 ~~I~G~nGsGKSTLl~~l~G   68 (267)
T PRK14237         49 TALIGPSGSGKSTYLRSLNR   68 (267)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            34689999999965554443


No 334
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]
Probab=20.59  E-value=38  Score=33.64  Aligned_cols=18  Identities=28%  Similarity=0.309  Sum_probs=15.0

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.|||+|+|||=-|.|.-
T Consensus        33 GLvG~NGaGKSTLLkila   50 (530)
T COG0488          33 GLVGRNGAGKSTLLKILA   50 (530)
T ss_pred             EEECCCCCCHHHHHHHHc
Confidence            469999999998777765


No 335
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=20.57  E-value=40  Score=24.99  Aligned_cols=12  Identities=25%  Similarity=0.354  Sum_probs=10.2

Q ss_pred             eeeeccCCCcee
Q psy3060         109 RFVGRSGREAEA  120 (268)
Q Consensus       109 RFVGRSGRGKsF  120 (268)
                      =++|.+|.||+=
T Consensus         5 ~i~G~~~vGKTs   16 (163)
T cd04136           5 VVLGSGGVGKSA   16 (163)
T ss_pred             EEECCCCCCHHH
Confidence            479999999983


No 336
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=20.45  E-value=39  Score=28.96  Aligned_cols=19  Identities=21%  Similarity=0.211  Sum_probs=14.2

Q ss_pred             eeeeccCCCceeeceEeee
Q psy3060         109 RFVGRSGREAEASPKDWVG  127 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v~  127 (268)
                      -.+|.||.|||=-|.+..+
T Consensus        49 ~i~G~nGsGKSTLl~~l~G   67 (267)
T PRK14235         49 AFIGPSGCGKSTFLRCLNR   67 (267)
T ss_pred             EEECCCCCCHHHHHHHHHh
Confidence            4689999999966655543


No 337
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=20.43  E-value=41  Score=25.40  Aligned_cols=11  Identities=9%  Similarity=0.123  Sum_probs=9.6

Q ss_pred             eeeeccCCCce
Q psy3060         109 RFVGRSGREAE  119 (268)
Q Consensus       109 RFVGRSGRGKs  119 (268)
                      =++|.+|.|||
T Consensus         3 ~lvG~~~~GKT   13 (158)
T cd04151           3 LILGLDNAGKT   13 (158)
T ss_pred             EEECCCCCCHH
Confidence            47999999995


No 338
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=20.40  E-value=48  Score=30.13  Aligned_cols=13  Identities=15%  Similarity=0.243  Sum_probs=11.4

Q ss_pred             eeccCCCceeece
Q psy3060         111 VGRSGREAEASPK  123 (268)
Q Consensus       111 VGRSGRGKsFtlt  123 (268)
                      .|-+|.||+|||.
T Consensus        95 yGqtGSGKT~Tm~  107 (356)
T cd01365          95 YGQTGSGKSYTMM  107 (356)
T ss_pred             ecCCCCCCeEEec
Confidence            4889999999984


No 339
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=20.36  E-value=40  Score=27.31  Aligned_cols=16  Identities=25%  Similarity=0.364  Sum_probs=12.2

Q ss_pred             eeeccCCCceeeceEe
Q psy3060         110 FVGRSGREAEASPKDW  125 (268)
Q Consensus       110 FVGRSGRGKsFtlti~  125 (268)
                      .+|.||.|||=-|.+.
T Consensus        31 i~G~nGsGKSTLl~~l   46 (208)
T cd03268          31 FLGPNGAGKTTTMKII   46 (208)
T ss_pred             EECCCCCCHHHHHHHH
Confidence            5799999999655444


No 340
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=20.35  E-value=40  Score=29.11  Aligned_cols=18  Identities=17%  Similarity=0.115  Sum_probs=13.8

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =++|.||.|||=-|.+..
T Consensus        29 ~i~G~NGsGKSTLlk~L~   46 (246)
T cd03237          29 GILGPNGIGKTTFIKMLA   46 (246)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996666543


No 341
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=20.28  E-value=40  Score=29.06  Aligned_cols=18  Identities=17%  Similarity=0.250  Sum_probs=13.5

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        43 ~l~G~nGsGKSTLl~~l~   60 (269)
T PRK14259         43 ALIGPSGCGKSTVLRSLN   60 (269)
T ss_pred             EEECCCCCCHHHHHHHHh
Confidence            468999999996555543


No 342
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=20.26  E-value=40  Score=28.18  Aligned_cols=17  Identities=18%  Similarity=0.257  Sum_probs=12.6

Q ss_pred             eeeeccCCCceeeceEe
Q psy3060         109 RFVGRSGREAEASPKDW  125 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~  125 (268)
                      -.+|+||.|||=-+.+.
T Consensus        33 ~i~G~nGsGKSTLl~~l   49 (250)
T PRK14266         33 ALIGPSGCGKSTFIRTL   49 (250)
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            46899999998555443


No 343
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=20.20  E-value=41  Score=26.54  Aligned_cols=14  Identities=29%  Similarity=0.373  Sum_probs=11.2

Q ss_pred             eeeccCCCceeece
Q psy3060         110 FVGRSGREAEASPK  123 (268)
Q Consensus       110 FVGRSGRGKsFtlt  123 (268)
                      ++|-||.|||=.+.
T Consensus         6 i~G~sGsGKttl~~   19 (179)
T TIGR02322         6 VVGPSGAGKDTLLD   19 (179)
T ss_pred             EECCCCCCHHHHHH
Confidence            68999999985553


No 344
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=20.11  E-value=47  Score=24.86  Aligned_cols=15  Identities=20%  Similarity=0.071  Sum_probs=12.0

Q ss_pred             eeeeeccCCCceeec
Q psy3060         108 LRFVGRSGREAEASP  122 (268)
Q Consensus       108 LRFVGRSGRGKsFtl  122 (268)
                      +-++|.+|.|||--+
T Consensus         3 i~vvG~~~~GKtsl~   17 (164)
T cd04101           3 CAVVGDPAVGKTAFV   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            458999999998544


No 345
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=20.10  E-value=40  Score=32.23  Aligned_cols=18  Identities=17%  Similarity=0.134  Sum_probs=13.0

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      .=+||.||.|||=-+.+.
T Consensus       344 ~~ivG~sGsGKSTLl~ll  361 (569)
T PRK10789        344 LGICGPTGSGKSTLLSLI  361 (569)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            347999999999544433


No 346
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=20.04  E-value=39  Score=29.58  Aligned_cols=18  Identities=11%  Similarity=0.274  Sum_probs=12.9

Q ss_pred             eeeeeccCCCceeeceEe
Q psy3060         108 LRFVGRSGREAEASPKDW  125 (268)
Q Consensus       108 LRFVGRSGRGKsFtlti~  125 (268)
                      +=++|.||.|||=-+.+.
T Consensus        35 v~i~G~nGsGKSTLl~~l   52 (288)
T PRK13643         35 TALIGHTGSGKSTLLQHL   52 (288)
T ss_pred             EEEECCCCChHHHHHHHH
Confidence            345899999999555443


No 347
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=20.03  E-value=41  Score=27.54  Aligned_cols=16  Identities=19%  Similarity=0.287  Sum_probs=11.7

Q ss_pred             eeeeeccCCCceeece
Q psy3060         108 LRFVGRSGREAEASPK  123 (268)
Q Consensus       108 LRFVGRSGRGKsFtlt  123 (268)
                      +-.+|.||.|||==+.
T Consensus        27 ~~i~G~nGsGKSTLl~   42 (213)
T TIGR01277        27 VAIMGPSGAGKSTLLN   42 (213)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3468999999984443


No 348
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=20.03  E-value=41  Score=29.80  Aligned_cols=12  Identities=33%  Similarity=0.479  Sum_probs=10.0

Q ss_pred             eeeeeccCCCce
Q psy3060         108 LRFVGRSGREAE  119 (268)
Q Consensus       108 LRFVGRSGRGKs  119 (268)
                      +=.||+||.|||
T Consensus         7 I~vvG~sg~GKS   18 (276)
T cd01850           7 IMVVGESGLGKS   18 (276)
T ss_pred             EEEEcCCCCCHH
Confidence            447899999996


No 349
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=20.02  E-value=40  Score=30.58  Aligned_cols=18  Identities=17%  Similarity=0.128  Sum_probs=13.5

Q ss_pred             eeeeccCCCceeeceEee
Q psy3060         109 RFVGRSGREAEASPKDWV  126 (268)
Q Consensus       109 RFVGRSGRGKsFtlti~v  126 (268)
                      =.+|.||.|||=-|.+..
T Consensus        35 ~iiG~nGsGKSTLlk~L~   52 (343)
T PRK11153         35 GVIGASGAGKSTLIRCIN   52 (343)
T ss_pred             EEECCCCCcHHHHHHHHh
Confidence            468999999996655443


Done!