Query         psy3063
Match_columns 110
No_of_seqs    108 out of 212
Neff          3.3 
Searched_HMMs 46136
Date          Sat Aug 17 00:44:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3063.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3063hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4102|consensus              100.0 8.5E-39 1.8E-43  234.4   7.4   94    8-104    12-106 (121)
  2 PF07491 PPI_Ypi1:  Protein pho 100.0 7.1E-33 1.5E-37  182.7   4.8   54   29-83      1-58  (60)
  3 COG2946 Putative phage replica  30.3      26 0.00056   30.7   1.1   37   39-76    200-240 (377)
  4 KOG0861|consensus               19.4      40 0.00088   27.2   0.2    9   58-66    189-197 (198)
  5 PF02486 Rep_trans:  Replicatio  19.2      60  0.0013   23.7   1.1   18   55-72     59-77  (182)
  6 KOG0801|consensus               18.3      61  0.0013   26.1   1.0   30   40-69    163-205 (205)
  7 cd04126 Rab20 Rab20 subfamily.  17.1      64  0.0014   24.7   0.9   17   47-63    204-220 (220)
  8 PF11575 FhuF_C:  FhuF 2Fe-2S C  15.6 1.2E+02  0.0026   16.3   1.4    9   61-69      2-10  (22)
  9 PF10587 EF-1_beta_acid:  Eukar  14.4      53  0.0011   19.0  -0.2   12   73-85      2-13  (28)
 10 PRK12496 hypothetical protein;  14.3      93   0.002   23.4   1.1   19   81-100   142-160 (164)

No 1  
>KOG4102|consensus
Probab=100.00  E-value=8.5e-39  Score=234.43  Aligned_cols=94  Identities=47%  Similarity=0.910  Sum_probs=78.6

Q ss_pred             CCCCceEEeCCCCCCcCCCCceEEEeecCCCCCCceeecCCccccccCCccccceeeeecCCCCCCCCCCCC-CCccccc
Q psy3063           8 PTSSTTVTISPEPETETDSLGQVVVKLKKPETKKVVKWTENTIDNEHMNKRKSKCCCIYKKPKANFDESSSD-SSDDECE   86 (110)
Q Consensus         8 p~sS~t~t~~~~p~~~~~~~~~l~Lrl~~~~~~~~V~W~edvVDNE~mgrkkSK~CCIyhKpr~~f~ESSse-~sddec~   86 (110)
                      +++++|+++..+++  ......|.|||+.+...++|+|.++|||||||||||||||||||||| +|||||++ ++|.+|+
T Consensus        12 ~~~T~T~~v~e~~a--~~~~~~lvlrL~~~~~~r~V~W~~~vVDNEhMgrkKSKcCCIy~kpr-~~~esSs~ed~d~~t~   88 (121)
T KOG4102|consen   12 SVGTTTVVVTEEPA--QLEAEQLVLRLRPPPPERRVRWTEGVVDNEHMGRKKSKCCCIYHKPR-AFDESSSDEDDDSETE   88 (121)
T ss_pred             ccceEEEEeecCcc--hhccccccccccCCCCCCceeeeccccccccccccccceeEEEeCcc-ccCccccCCcccccCc
Confidence            44444444444444  44458899999988889999999999999999999999999999999 99999986 5777899


Q ss_pred             CCCCchhhhhhcCCCCCC
Q psy3063          87 NCFGHVEAKKANRQTKPD  104 (110)
Q Consensus        87 ~c~gh~~~~~~~~~~~~~  104 (110)
                      ||+||+++++++++...+
T Consensus        89 hcrgh~~~~~~~~p~~~~  106 (121)
T KOG4102|consen   89 HCRGHTEKRKNAKPNGPE  106 (121)
T ss_pred             ccccccchhhccCCCCCC
Confidence            999999999888877763


No 2  
>PF07491 PPI_Ypi1:  Protein phosphatase inhibitor  ;  InterPro: IPR011107 These proteins include Ypi1, a novel Saccharomyces cerevisiae type 1 protein phosphatase inhibitor [] and ppp1r11/hcgv (O60927 from SWISSPROT), annotated as having protein phosphatase inhibitor activity [].
Probab=99.97  E-value=7.1e-33  Score=182.74  Aligned_cols=54  Identities=54%  Similarity=1.062  Sum_probs=48.5

Q ss_pred             eEEEeecC----CCCCCceeecCCccccccCCccccceeeeecCCCCCCCCCCCCCCcc
Q psy3063          29 QVVVKLKK----PETKKVVKWTENTIDNEHMNKRKSKCCCIYKKPKANFDESSSDSSDD   83 (110)
Q Consensus        29 ~l~Lrl~~----~~~~~~V~W~edvVDNE~mgrkkSK~CCIyhKpr~~f~ESSse~sdd   83 (110)
                      +|+||+..    ++..++|+|++||||||||||||||||||||||+ +||||||++++|
T Consensus         1 vLrLR~~~~~~~~~~~~~V~W~edvVDNE~mgkkkSK~CCIyhk~~-~~~esSs~s~s~   58 (60)
T PF07491_consen    1 VLRLRGAPTQPKPKSRRRVQWSEDVVDNEHMGKKKSKCCCIYHKPR-AFDESSSESSSD   58 (60)
T ss_pred             CeEecCCcCccccCCCCceeecCCceeccccccccCceeeeecCCC-CCCCCccccccc
Confidence            58888875    5678999999999999999999999999999999 999999985544


No 3  
>COG2946 Putative phage replication protein RstA [DNA replication, recombination, and repair]
Probab=30.31  E-value=26  Score=30.69  Aligned_cols=37  Identities=22%  Similarity=0.393  Sum_probs=26.7

Q ss_pred             CCCceeecCCccc-ccc--CC-ccccceeeeecCCCCCCCCC
Q psy3063          39 TKKVVKWTENTID-NEH--MN-KRKSKCCCIYKKPKANFDES   76 (110)
Q Consensus        39 ~~~~V~W~edvVD-NE~--mg-rkkSK~CCIyhKpr~~f~ES   76 (110)
                      .-+.+.|-.|-+- ++-  .| |+.++.||||.|-+ ..|+-
T Consensus       200 e~~gt~~~~d~g~gGkTfyvGsk~s~~y~riYeKgk-QLGd~  240 (377)
T COG2946         200 ECRGTAWLNDDGSGGKTFYVGSKKSSKYVRIYEKGK-QLGDK  240 (377)
T ss_pred             CCCCcccccCCCCCCeEEEecccCcceeEEehhhhh-hhcCC
Confidence            4567999988776 443  34 45567899999999 67753


No 4  
>KOG0861|consensus
Probab=19.41  E-value=40  Score=27.18  Aligned_cols=9  Identities=44%  Similarity=1.279  Sum_probs=6.9

Q ss_pred             cccceeeee
Q psy3063          58 RKSKCCCIY   66 (110)
Q Consensus        58 kkSK~CCIy   66 (110)
                      ||.+.||||
T Consensus       189 KK~NsCC~i  197 (198)
T KOG0861|consen  189 KKTNSCCII  197 (198)
T ss_pred             hhcCCceec
Confidence            677888876


No 5  
>PF02486 Rep_trans:  Replication initiation factor;  InterPro: IPR003491 Plasmid replication is initiated by the replication initiation factor (REP). This family represents a probable topoisomerase that makes a sequence-specific single-stranded nick in the plasmid DNA at the origin of replication. Human proteins also belong to this family, including myelin transcription factor 2 and cerebrin-50 [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006270 DNA-dependent DNA replication initiation
Probab=19.19  E-value=60  Score=23.68  Aligned_cols=18  Identities=44%  Similarity=0.556  Sum_probs=14.3

Q ss_pred             CCcccc-ceeeeecCCCCC
Q psy3063          55 MNKRKS-KCCCIYKKPKAN   72 (110)
Q Consensus        55 mgrkkS-K~CCIyhKpr~~   72 (110)
                      .|.|+| +.+|||.|..+.
T Consensus        59 ~Gsr~S~~~~RiYdK~~E~   77 (182)
T PF02486_consen   59 FGSRKSEKYLRIYDKKKEQ   77 (182)
T ss_pred             EecCCCceEEEEeccchhh
Confidence            566666 999999999943


No 6  
>KOG0801|consensus
Probab=18.25  E-value=61  Score=26.11  Aligned_cols=30  Identities=23%  Similarity=0.689  Sum_probs=17.4

Q ss_pred             CCceeecCCcccc---------ccCC--c--cccceeeeecCC
Q psy3063          40 KKVVKWTENTIDN---------EHMN--K--RKSKCCCIYKKP   69 (110)
Q Consensus        40 ~~~V~W~edvVDN---------E~mg--r--kkSK~CCIyhKp   69 (110)
                      ++++.+.+||+-.         |.|-  -  -.--|=|||||.
T Consensus       163 kPrlsYNdDVL~ddkGECvICLEdL~~GdtIARLPCLCIYHK~  205 (205)
T KOG0801|consen  163 KPRLSYNDDVLKDDKGECVICLEDLEAGDTIARLPCLCIYHKQ  205 (205)
T ss_pred             ccccccccchhcccCCcEEEEhhhccCCCceeccceEEEeecC
Confidence            3578888888642         1111  1  123467999984


No 7  
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=17.15  E-value=64  Score=24.75  Aligned_cols=17  Identities=35%  Similarity=0.786  Sum_probs=13.2

Q ss_pred             CCccccccCCcccccee
Q psy3063          47 ENTIDNEHMNKRKSKCC   63 (110)
Q Consensus        47 edvVDNE~mgrkkSK~C   63 (110)
                      .++|.--++-|+||+||
T Consensus       204 ~~~~~~~~~~~~~~~~~  220 (220)
T cd04126         204 QGTVNLPNPKRSKSKCC  220 (220)
T ss_pred             hccccCCCcccCCCCCC
Confidence            45666556999999998


No 8  
>PF11575 FhuF_C:  FhuF 2Fe-2S C-terminal domain;  InterPro: IPR024726 Ferric iron reductase (FhuF) is involved in the reduction of ferric iron in cytoplasmic ferrioxamine B []. This entry represents the C-terminal domain that contains 4 conserved cysteine residues found to be part of a 2Fe-2S cluster [].; GO: 0051537 2 iron, 2 sulfur cluster binding
Probab=15.55  E-value=1.2e+02  Score=16.25  Aligned_cols=9  Identities=33%  Similarity=1.283  Sum_probs=5.2

Q ss_pred             ceeeeecCC
Q psy3063          61 KCCCIYKKP   69 (110)
Q Consensus        61 K~CCIyhKp   69 (110)
                      +.||.|..-
T Consensus         2 ~~CCl~y~~   10 (22)
T PF11575_consen    2 RSCCLYYRL   10 (22)
T ss_pred             ccEeeeEEc
Confidence            357766543


No 9  
>PF10587 EF-1_beta_acid:  Eukaryotic elongation factor 1 beta central acidic region;  InterPro: IPR018940 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF1B (also known as EF-Ts or EF-1beta/gamma/delta) is a nucleotide exchange factor that is required to regenerate EF1A from its inactive form (EF1A-GDP) to its active form (EF1A-GTP). EF1A is then ready to interact with a new aminoacyl-tRNA to begin the cycle again. EF1B is more complex in eukaryotes than in bacteria, and can consist of three subunits: EF1B-alpha (or EF-1beta), EF1B-gamma (or EF-1gamma) and EF1B-beta (or EF-1delta) []. This region is found in the centre of the beta subunits of Elongation factor-1. More information about these proteins can be found at Protein of the Month: Elongation Factors [].
Probab=14.44  E-value=53  Score=19.04  Aligned_cols=12  Identities=25%  Similarity=0.637  Sum_probs=5.3

Q ss_pred             CCCCCCCCCcccc
Q psy3063          73 FDESSSDSSDDEC   85 (110)
Q Consensus        73 f~ESSse~sddec   85 (110)
                      ||. ++|++|.+.
T Consensus         2 FGS-ddEeed~ea   13 (28)
T PF10587_consen    2 FGS-DDEEEDEEA   13 (28)
T ss_pred             CCC-ccccccHHH
Confidence            663 333344443


No 10 
>PRK12496 hypothetical protein; Provisional
Probab=14.34  E-value=93  Score=23.38  Aligned_cols=19  Identities=37%  Similarity=0.723  Sum_probs=13.3

Q ss_pred             CcccccCCCCchhhhhhcCC
Q psy3063          81 SDDECENCFGHVEAKKANRQ  100 (110)
Q Consensus        81 sddec~~c~gh~~~~~~~~~  100 (110)
                      .++.|..| |+..+||+.+.
T Consensus       142 ~~~~C~~C-G~~~~r~~~~~  160 (164)
T PRK12496        142 PDDVCEIC-GSPVKRKMVKR  160 (164)
T ss_pred             CCCcCCCC-CChhhhcchhh
Confidence            44689999 77776666543


Done!