Query psy3063
Match_columns 110
No_of_seqs 108 out of 212
Neff 3.3
Searched_HMMs 46136
Date Sat Aug 17 00:44:24 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy3063.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3063hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG4102|consensus 100.0 8.5E-39 1.8E-43 234.4 7.4 94 8-104 12-106 (121)
2 PF07491 PPI_Ypi1: Protein pho 100.0 7.1E-33 1.5E-37 182.7 4.8 54 29-83 1-58 (60)
3 COG2946 Putative phage replica 30.3 26 0.00056 30.7 1.1 37 39-76 200-240 (377)
4 KOG0861|consensus 19.4 40 0.00088 27.2 0.2 9 58-66 189-197 (198)
5 PF02486 Rep_trans: Replicatio 19.2 60 0.0013 23.7 1.1 18 55-72 59-77 (182)
6 KOG0801|consensus 18.3 61 0.0013 26.1 1.0 30 40-69 163-205 (205)
7 cd04126 Rab20 Rab20 subfamily. 17.1 64 0.0014 24.7 0.9 17 47-63 204-220 (220)
8 PF11575 FhuF_C: FhuF 2Fe-2S C 15.6 1.2E+02 0.0026 16.3 1.4 9 61-69 2-10 (22)
9 PF10587 EF-1_beta_acid: Eukar 14.4 53 0.0011 19.0 -0.2 12 73-85 2-13 (28)
10 PRK12496 hypothetical protein; 14.3 93 0.002 23.4 1.1 19 81-100 142-160 (164)
No 1
>KOG4102|consensus
Probab=100.00 E-value=8.5e-39 Score=234.43 Aligned_cols=94 Identities=47% Similarity=0.910 Sum_probs=78.6
Q ss_pred CCCCceEEeCCCCCCcCCCCceEEEeecCCCCCCceeecCCccccccCCccccceeeeecCCCCCCCCCCCC-CCccccc
Q psy3063 8 PTSSTTVTISPEPETETDSLGQVVVKLKKPETKKVVKWTENTIDNEHMNKRKSKCCCIYKKPKANFDESSSD-SSDDECE 86 (110)
Q Consensus 8 p~sS~t~t~~~~p~~~~~~~~~l~Lrl~~~~~~~~V~W~edvVDNE~mgrkkSK~CCIyhKpr~~f~ESSse-~sddec~ 86 (110)
+++++|+++..+++ ......|.|||+.+...++|+|.++|||||||||||||||||||||| +|||||++ ++|.+|+
T Consensus 12 ~~~T~T~~v~e~~a--~~~~~~lvlrL~~~~~~r~V~W~~~vVDNEhMgrkKSKcCCIy~kpr-~~~esSs~ed~d~~t~ 88 (121)
T KOG4102|consen 12 SVGTTTVVVTEEPA--QLEAEQLVLRLRPPPPERRVRWTEGVVDNEHMGRKKSKCCCIYHKPR-AFDESSSDEDDDSETE 88 (121)
T ss_pred ccceEEEEeecCcc--hhccccccccccCCCCCCceeeeccccccccccccccceeEEEeCcc-ccCccccCCcccccCc
Confidence 44444444444444 44458899999988889999999999999999999999999999999 99999986 5777899
Q ss_pred CCCCchhhhhhcCCCCCC
Q psy3063 87 NCFGHVEAKKANRQTKPD 104 (110)
Q Consensus 87 ~c~gh~~~~~~~~~~~~~ 104 (110)
||+||+++++++++...+
T Consensus 89 hcrgh~~~~~~~~p~~~~ 106 (121)
T KOG4102|consen 89 HCRGHTEKRKNAKPNGPE 106 (121)
T ss_pred ccccccchhhccCCCCCC
Confidence 999999999888877763
No 2
>PF07491 PPI_Ypi1: Protein phosphatase inhibitor ; InterPro: IPR011107 These proteins include Ypi1, a novel Saccharomyces cerevisiae type 1 protein phosphatase inhibitor [] and ppp1r11/hcgv (O60927 from SWISSPROT), annotated as having protein phosphatase inhibitor activity [].
Probab=99.97 E-value=7.1e-33 Score=182.74 Aligned_cols=54 Identities=54% Similarity=1.062 Sum_probs=48.5
Q ss_pred eEEEeecC----CCCCCceeecCCccccccCCccccceeeeecCCCCCCCCCCCCCCcc
Q psy3063 29 QVVVKLKK----PETKKVVKWTENTIDNEHMNKRKSKCCCIYKKPKANFDESSSDSSDD 83 (110)
Q Consensus 29 ~l~Lrl~~----~~~~~~V~W~edvVDNE~mgrkkSK~CCIyhKpr~~f~ESSse~sdd 83 (110)
+|+||+.. ++..++|+|++||||||||||||||||||||||+ +||||||++++|
T Consensus 1 vLrLR~~~~~~~~~~~~~V~W~edvVDNE~mgkkkSK~CCIyhk~~-~~~esSs~s~s~ 58 (60)
T PF07491_consen 1 VLRLRGAPTQPKPKSRRRVQWSEDVVDNEHMGKKKSKCCCIYHKPR-AFDESSSESSSD 58 (60)
T ss_pred CeEecCCcCccccCCCCceeecCCceeccccccccCceeeeecCCC-CCCCCccccccc
Confidence 58888875 5678999999999999999999999999999999 999999985544
No 3
>COG2946 Putative phage replication protein RstA [DNA replication, recombination, and repair]
Probab=30.31 E-value=26 Score=30.69 Aligned_cols=37 Identities=22% Similarity=0.393 Sum_probs=26.7
Q ss_pred CCCceeecCCccc-ccc--CC-ccccceeeeecCCCCCCCCC
Q psy3063 39 TKKVVKWTENTID-NEH--MN-KRKSKCCCIYKKPKANFDES 76 (110)
Q Consensus 39 ~~~~V~W~edvVD-NE~--mg-rkkSK~CCIyhKpr~~f~ES 76 (110)
.-+.+.|-.|-+- ++- .| |+.++.||||.|-+ ..|+-
T Consensus 200 e~~gt~~~~d~g~gGkTfyvGsk~s~~y~riYeKgk-QLGd~ 240 (377)
T COG2946 200 ECRGTAWLNDDGSGGKTFYVGSKKSSKYVRIYEKGK-QLGDK 240 (377)
T ss_pred CCCCcccccCCCCCCeEEEecccCcceeEEehhhhh-hhcCC
Confidence 4567999988776 443 34 45567899999999 67753
No 4
>KOG0861|consensus
Probab=19.41 E-value=40 Score=27.18 Aligned_cols=9 Identities=44% Similarity=1.279 Sum_probs=6.9
Q ss_pred cccceeeee
Q psy3063 58 RKSKCCCIY 66 (110)
Q Consensus 58 kkSK~CCIy 66 (110)
||.+.||||
T Consensus 189 KK~NsCC~i 197 (198)
T KOG0861|consen 189 KKTNSCCII 197 (198)
T ss_pred hhcCCceec
Confidence 677888876
No 5
>PF02486 Rep_trans: Replication initiation factor; InterPro: IPR003491 Plasmid replication is initiated by the replication initiation factor (REP). This family represents a probable topoisomerase that makes a sequence-specific single-stranded nick in the plasmid DNA at the origin of replication. Human proteins also belong to this family, including myelin transcription factor 2 and cerebrin-50 [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006270 DNA-dependent DNA replication initiation
Probab=19.19 E-value=60 Score=23.68 Aligned_cols=18 Identities=44% Similarity=0.556 Sum_probs=14.3
Q ss_pred CCcccc-ceeeeecCCCCC
Q psy3063 55 MNKRKS-KCCCIYKKPKAN 72 (110)
Q Consensus 55 mgrkkS-K~CCIyhKpr~~ 72 (110)
.|.|+| +.+|||.|..+.
T Consensus 59 ~Gsr~S~~~~RiYdK~~E~ 77 (182)
T PF02486_consen 59 FGSRKSEKYLRIYDKKKEQ 77 (182)
T ss_pred EecCCCceEEEEeccchhh
Confidence 566666 999999999943
No 6
>KOG0801|consensus
Probab=18.25 E-value=61 Score=26.11 Aligned_cols=30 Identities=23% Similarity=0.689 Sum_probs=17.4
Q ss_pred CCceeecCCcccc---------ccCC--c--cccceeeeecCC
Q psy3063 40 KKVVKWTENTIDN---------EHMN--K--RKSKCCCIYKKP 69 (110)
Q Consensus 40 ~~~V~W~edvVDN---------E~mg--r--kkSK~CCIyhKp 69 (110)
++++.+.+||+-. |.|- - -.--|=|||||.
T Consensus 163 kPrlsYNdDVL~ddkGECvICLEdL~~GdtIARLPCLCIYHK~ 205 (205)
T KOG0801|consen 163 KPRLSYNDDVLKDDKGECVICLEDLEAGDTIARLPCLCIYHKQ 205 (205)
T ss_pred ccccccccchhcccCCcEEEEhhhccCCCceeccceEEEeecC
Confidence 3578888888642 1111 1 123467999984
No 7
>cd04126 Rab20 Rab20 subfamily. Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells. It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells. Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron. It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=17.15 E-value=64 Score=24.75 Aligned_cols=17 Identities=35% Similarity=0.786 Sum_probs=13.2
Q ss_pred CCccccccCCcccccee
Q psy3063 47 ENTIDNEHMNKRKSKCC 63 (110)
Q Consensus 47 edvVDNE~mgrkkSK~C 63 (110)
.++|.--++-|+||+||
T Consensus 204 ~~~~~~~~~~~~~~~~~ 220 (220)
T cd04126 204 QGTVNLPNPKRSKSKCC 220 (220)
T ss_pred hccccCCCcccCCCCCC
Confidence 45666556999999998
No 8
>PF11575 FhuF_C: FhuF 2Fe-2S C-terminal domain; InterPro: IPR024726 Ferric iron reductase (FhuF) is involved in the reduction of ferric iron in cytoplasmic ferrioxamine B []. This entry represents the C-terminal domain that contains 4 conserved cysteine residues found to be part of a 2Fe-2S cluster [].; GO: 0051537 2 iron, 2 sulfur cluster binding
Probab=15.55 E-value=1.2e+02 Score=16.25 Aligned_cols=9 Identities=33% Similarity=1.283 Sum_probs=5.2
Q ss_pred ceeeeecCC
Q psy3063 61 KCCCIYKKP 69 (110)
Q Consensus 61 K~CCIyhKp 69 (110)
+.||.|..-
T Consensus 2 ~~CCl~y~~ 10 (22)
T PF11575_consen 2 RSCCLYYRL 10 (22)
T ss_pred ccEeeeEEc
Confidence 357766543
No 9
>PF10587 EF-1_beta_acid: Eukaryotic elongation factor 1 beta central acidic region; InterPro: IPR018940 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF1B (also known as EF-Ts or EF-1beta/gamma/delta) is a nucleotide exchange factor that is required to regenerate EF1A from its inactive form (EF1A-GDP) to its active form (EF1A-GTP). EF1A is then ready to interact with a new aminoacyl-tRNA to begin the cycle again. EF1B is more complex in eukaryotes than in bacteria, and can consist of three subunits: EF1B-alpha (or EF-1beta), EF1B-gamma (or EF-1gamma) and EF1B-beta (or EF-1delta) []. This region is found in the centre of the beta subunits of Elongation factor-1. More information about these proteins can be found at Protein of the Month: Elongation Factors [].
Probab=14.44 E-value=53 Score=19.04 Aligned_cols=12 Identities=25% Similarity=0.637 Sum_probs=5.3
Q ss_pred CCCCCCCCCcccc
Q psy3063 73 FDESSSDSSDDEC 85 (110)
Q Consensus 73 f~ESSse~sddec 85 (110)
||. ++|++|.+.
T Consensus 2 FGS-ddEeed~ea 13 (28)
T PF10587_consen 2 FGS-DDEEEDEEA 13 (28)
T ss_pred CCC-ccccccHHH
Confidence 663 333344443
No 10
>PRK12496 hypothetical protein; Provisional
Probab=14.34 E-value=93 Score=23.38 Aligned_cols=19 Identities=37% Similarity=0.723 Sum_probs=13.3
Q ss_pred CcccccCCCCchhhhhhcCC
Q psy3063 81 SDDECENCFGHVEAKKANRQ 100 (110)
Q Consensus 81 sddec~~c~gh~~~~~~~~~ 100 (110)
.++.|..| |+..+||+.+.
T Consensus 142 ~~~~C~~C-G~~~~r~~~~~ 160 (164)
T PRK12496 142 PDDVCEIC-GSPVKRKMVKR 160 (164)
T ss_pred CCCcCCCC-CChhhhcchhh
Confidence 44689999 77776666543
Done!