Query         psy3064
Match_columns 61
No_of_seqs    34 out of 36
Neff          2.1 
Searched_HMMs 46136
Date          Sat Aug 17 00:45:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3064.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3064hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2113|consensus               98.3 1.7E-07 3.8E-12   72.9   0.3   31   30-61     18-48  (394)
  2 PF00013 KH_1:  KH domain syndr  62.2     3.9 8.5E-05   22.0   0.7   21   39-60      1-21  (60)
  3 PF02880 PGM_PMM_III:  Phosphog  62.0     7.6 0.00016   23.6   2.1   22   39-60     22-43  (113)
  4 COG3646 Uncharacterized phage-  37.0      20 0.00044   25.3   1.2   15   43-57     13-27  (167)
  5 cd02394 vigilin_like_KH K homo  26.4      33 0.00071   18.4   0.7   21   39-60      1-21  (62)
  6 PF13871 Helicase_C_4:  Helicas  24.9      11 0.00023   28.0  -1.8   12   48-59     14-25  (278)
  7 PF04359 DUF493:  Protein of un  24.1      96  0.0021   18.2   2.5   26   30-55     48-73  (85)
  8 cd05799 PGM2 This CD includes   23.6      68  0.0015   24.0   2.1   25   36-60    305-329 (487)
  9 KOG3272|consensus               22.2      34 0.00074   25.4   0.3   10   52-61     75-84  (207)
 10 TIGR00719 sda_beta L-serine de  20.1      64  0.0014   22.0   1.3   12   45-56     17-30  (208)

No 1  
>KOG2113|consensus
Probab=98.28  E-value=1.7e-07  Score=72.91  Aligned_cols=31  Identities=61%  Similarity=0.846  Sum_probs=27.6

Q ss_pred             hhcccceeceeeeeeCCchHHHHHHhhcCcCC
Q psy3064          30 LRNKKSANMTECVPVPSSEHVAEIVGRQGFGM   61 (61)
Q Consensus        30 ~~~~ks~n~te~VpVPSsehvaEivgrqGCK~   61 (61)
                      .+..+-+||||+|+|| +|||+||||||||||
T Consensus        18 ~~~~~p~nvt~sv~vp-s~~v~~ivg~qg~ki   48 (394)
T KOG2113|consen   18 YRTSIGQNVTESVEVP-SEHVAEIVGRQGCKI   48 (394)
T ss_pred             cCCCCCCccceeeecC-cccceeecccCcccc
Confidence            4455559999999999 999999999999997


No 2  
>PF00013 KH_1:  KH domain syndrome, contains KH motifs.;  InterPro: IPR018111 The K homology (KH) domain was first identified in the human heterogeneous nuclear ribonucleoprotein (hnRNP) K. It is a domain of around 70 amino acids that is present in a wide variety of quite diverse nucleic acid-binding proteins []. It has been shown to bind RNA [, ]. Like many other RNA-binding motifs, KH motifs are found in one or multiple copies (14 copies in chicken vigilin) and, at least for hnRNP K (three copies) and FMR-1 (two copies), each motif is necessary for in vitro RNA binding activity, suggesting that they may function cooperatively or, in the case of single KH motif proteins (for example, Mer1p), independently []. According to structural [, , ] analysis the KH domain can be separated in two groups. The first group or type-1 contain a beta-alpha-alpha-beta-beta-alpha structure, whereas in the type-2 the two last beta-sheet are located in the N-terminal part of the domain (alpha-beta-beta-alpha-alpha-beta). Sequence similarity between these two folds are limited to a short region (VIGXXGXXI) in the RNA binding motif. This motif is located between helice 1 and 2 in type-1 and between helice 2 and 3 in type-2. Proteins known to contain a type-1 KH domain include bacterial polyribonucleotide nucleotidyltransferases (2.7.7.8 from EC); vertebrate fragile X mental retardation protein 1 (FMR1); eukaryotic heterogeneous nuclear ribonucleoprotein K (hnRNP K), one of at least 20 major proteins that are part of hnRNP particles in mammalian cells; mammalian poly(rC) binding proteins; Artemia salina glycine-rich protein GRP33; yeast PAB1-binding protein 2 (PBP2); vertebrate vigilin; and human high-density lipoprotein binding protein (HDL-binding protein). More information about these proteins can be found at Protein of the Month: RNA Exosomes [].; GO: 0003723 RNA binding; PDB: 1TUA_A 2Z0S_A 1WE8_A 4AM3_B 4AIM_A 4AID_A 2HH3_A 2JVZ_A 1J4W_A 2HH2_A ....
Probab=62.18  E-value=3.9  Score=22.01  Aligned_cols=21  Identities=43%  Similarity=0.705  Sum_probs=16.6

Q ss_pred             eeeeeeCCchHHHHHHhhcCcC
Q psy3064          39 TECVPVPSSEHVAEIVGRQGFG   60 (61)
Q Consensus        39 te~VpVPSsehvaEivgrqGCK   60 (61)
                      |+.+.|| ..++.-++|++|..
T Consensus         1 T~~i~vp-~~~~~~iIG~~G~~   21 (60)
T PF00013_consen    1 TERIEVP-SSLVGRIIGKKGSN   21 (60)
T ss_dssp             EEEEEEE-HHHHHHHHTGGGHH
T ss_pred             CEEEEEC-HHHcCEEECCCCCc
Confidence            5778888 57888899999853


No 3  
>PF02880 PGM_PMM_III:  Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III;  InterPro: IPR005846 The alpha-D-phosphohexomutase superfamily is composed of four related enzymes, each of which catalyses a phosphoryl transfer on their sugar substrates: phosphoglucomutase (PGM), phosphoglucomutase/phosphomannomutase (PGM/PMM), phosphoglucosamine mutase (PNGM), and phosphoacetylglucosamine mutase (PAGM) []. PGM (5.4.2.2 from EC) converts D-glucose 1-phosphate into D-glucose 6-phosphate, and participates in both the breakdown and synthesis of glucose []. PGM/PMM (5.4.2.2 from EC; 5.4.2.8 from EC) are primarily bacterial enzymes that use either glucose or mannose as substrate, participating in the biosynthesis of a variety of carbohydrates such as lipopolysaccharides and alginate [, ]. Both PNGM (5.4.2.3 from EC) and PAGM (5.4.2.10 from EC) are involved in the biosynthesis of UDP-N-acetylglucosamine [, ].  Despite differences in substrate specificity, these enzymes share a similar catalytic mechanism, converting 1-phospho-sugars to 6-phospho-sugars via a biphosphorylated 1,6-phospho-sugar. The active enzyme is phosphorylated at a conserved serine residue and binds one magnesium ion; residues around the active site serine are well conserved among family members. The reaction mechanism involves phosphoryl transfer from the phosphoserine to the substrate to create a biophosphorylated sugar, followed by a phosphoryl transfer from the substrate back to the enzyme []. The structures of PGM and PGM/PMM have been determined, and were found to be very similar in topology. These enzymes are both composed of four domains and a large central active site cleft, where each domain contains residues essential for catalysis and/or substrate recognition. Domain I contains the catalytic phosphoserine, domain II contains a metal-binding loop to coordinate the magnesium ion, domain III contains the sugar-binding loop that recognises the two different binding orientations of the 1- and 6-phospho-sugars, and domain IV contains a phosphate-binding site required for orienting the incoming phospho-sugar substrate. This entry represents domain III found in alpha-D-phosphohexomutase enzymes. This domain has a 3-layer alpha/beta/alpha topology.; GO: 0016868 intramolecular transferase activity, phosphotransferases, 0005975 carbohydrate metabolic process; PDB: 1C47_A 1VKL_B 1LXT_A 1JDY_B 3PMG_A 1C4G_B 3UW2_A 2F7L_B 3I3W_B 2Z0F_A ....
Probab=61.98  E-value=7.6  Score=23.57  Aligned_cols=22  Identities=32%  Similarity=0.303  Sum_probs=19.6

Q ss_pred             eeeeeeCCchHHHHHHhhcCcC
Q psy3064          39 TECVPVPSSEHVAEIVGRQGFG   60 (61)
Q Consensus        39 te~VpVPSsehvaEivgrqGCK   60 (61)
                      +.+++|.+|..+.+++.+.|++
T Consensus        22 ~vv~~v~sS~~~~~~~~~~g~~   43 (113)
T PF02880_consen   22 TVVVTVVSSRALDKIAEKHGGK   43 (113)
T ss_dssp             EEEEETTS-THHHHHHHHTTSE
T ss_pred             EEEEeCHHHHHHHHHHHHCCCE
Confidence            7889999999999999999986


No 4  
>COG3646 Uncharacterized phage-encoded protein [Function unknown]
Probab=36.98  E-value=20  Score=25.35  Aligned_cols=15  Identities=40%  Similarity=0.680  Sum_probs=13.8

Q ss_pred             eeCCchHHHHHHhhc
Q psy3064          43 PVPSSEHVAEIVGRQ   57 (61)
Q Consensus        43 pVPSsehvaEivgrq   57 (61)
                      ++.+|.+|||.||+|
T Consensus        13 i~t~S~~IAe~~gkr   27 (167)
T COG3646          13 IVTNSREIAEMVGKR   27 (167)
T ss_pred             eeecHHHHHHHHhhh
Confidence            688999999999987


No 5  
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like.  The vigilin family is a large and extended family of multiple KH-domain proteins, including vigilin, also called high density lipoprotein binding protien (HBP), fungal Scp160 and bicaudal-C. Yeast Scp160p has been shown to bind RNA and to associate with both soluble and membrane-bound polyribosomes as a mRNP component. Bicaudal-C is a RNA-binding molecule believed to function in embryonic development at the post-transcriptional level. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=26.36  E-value=33  Score=18.41  Aligned_cols=21  Identities=33%  Similarity=0.504  Sum_probs=14.1

Q ss_pred             eeeeeeCCchHHHHHHhhcCcC
Q psy3064          39 TECVPVPSSEHVAEIVGRQGFG   60 (61)
Q Consensus        39 te~VpVPSsehvaEivgrqGCK   60 (61)
                      ++.+.||. +.+.-+.|+.|..
T Consensus         1 ~~~i~Vp~-~~~~~iIG~~G~~   21 (62)
T cd02394           1 TEEVEIPK-KLHRFIIGKKGSN   21 (62)
T ss_pred             CeEEEeCH-HHhhhccCCCCCc
Confidence            35677887 4557788887753


No 6  
>PF13871 Helicase_C_4:  Helicase_C-like
Probab=24.92  E-value=11  Score=27.97  Aligned_cols=12  Identities=58%  Similarity=0.877  Sum_probs=10.3

Q ss_pred             hHHHHHHhhcCc
Q psy3064          48 EHVAEIVGRQGF   59 (61)
Q Consensus        48 ehvaEivgrqGC   59 (61)
                      +.||||+||.|+
T Consensus        14 ~~VAEiTGR~~r   25 (278)
T PF13871_consen   14 DKVAEITGRSGR   25 (278)
T ss_pred             CeEEEccCCcee
Confidence            479999999985


No 7  
>PF04359 DUF493:  Protein of unknown function (DUF493);  InterPro: IPR007454 This family includes several proteins of uncharacterised function.; PDB: 1RWU_A 2JOQ_A 2H9Z_A.
Probab=24.14  E-value=96  Score=18.20  Aligned_cols=26  Identities=31%  Similarity=0.277  Sum_probs=22.0

Q ss_pred             hhcccceeceeeeeeCCchHHHHHHh
Q psy3064          30 LRNKKSANMTECVPVPSSEHVAEIVG   55 (61)
Q Consensus        30 ~~~~ks~n~te~VpVPSsehvaEivg   55 (61)
                      -+..|.+++|..+.|.|.++|-+|-.
T Consensus        48 S~~GkY~Svtv~v~v~s~eq~~~iy~   73 (85)
T PF04359_consen   48 SSKGKYVSVTVSVTVESAEQVDAIYR   73 (85)
T ss_dssp             STTSSEEEEEEEEEESSHHHHHHHHH
T ss_pred             CCCCeEEEEEEEEEECCHHHHHHHHH
Confidence            35678899999999999999988754


No 8  
>cd05799 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/ph
Probab=23.56  E-value=68  Score=23.97  Aligned_cols=25  Identities=24%  Similarity=0.216  Sum_probs=21.7

Q ss_pred             eeceeeeeeCCchHHHHHHhhcCcC
Q psy3064          36 ANMTECVPVPSSEHVAEIVGRQGFG   60 (61)
Q Consensus        36 ~n~te~VpVPSsehvaEivgrqGCK   60 (61)
                      .+...++|+++|..+.+++.+.||+
T Consensus       305 ~~~~vV~~v~sS~~i~~ia~~~g~~  329 (487)
T cd05799         305 KNPVIVKTIVSSELLRKIAKKYGVK  329 (487)
T ss_pred             CCcEEEEeehhHHHHHHHHHHcCCe
Confidence            3446899999999999999999986


No 9  
>KOG3272|consensus
Probab=22.25  E-value=34  Score=25.39  Aligned_cols=10  Identities=30%  Similarity=0.189  Sum_probs=7.3

Q ss_pred             HHHhhcCcCC
Q psy3064          52 EIVGRQGFGM   61 (61)
Q Consensus        52 EivgrqGCK~   61 (61)
                      ..=-+|||||
T Consensus        75 KaNSIQG~Km   84 (207)
T KOG3272|consen   75 KANSIQGNKM   84 (207)
T ss_pred             Hhcccccccc
Confidence            3446899997


No 10 
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases.
Probab=20.13  E-value=64  Score=22.04  Aligned_cols=12  Identities=42%  Similarity=0.531  Sum_probs=8.7

Q ss_pred             CCchH--HHHHHhh
Q psy3064          45 PSSEH--VAEIVGR   56 (61)
Q Consensus        45 PSseh--vaEivgr   56 (61)
                      |||+|  +||+.|+
T Consensus        17 psssht~laerlG~   30 (208)
T TIGR00719        17 PSSSHTAGAAKIAN   30 (208)
T ss_pred             CChhHHHHHHHHHH
Confidence            89998  4566665


Done!