Diaphorina citri psyllid: psy306

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190

MQGRDKQPKLQIDYLDAESESLQSCQIADYKKRKEMFQTIFDEDIHASLLSRGDRSLSHKALQGAILITMYRDEPRFHLPSQILSALMDIDCCTAKWRHNHVLMVQRMIGSQHLGTGGTSGYQYLRSTLSDRYKIFLDLFNVSSFLLPKQYIPVLSGTLKSQLSATPHHPRNREHADSKKNCVKHLNGNL

cccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHccccccccccccccHHHHHHcccccccccccccccccHHHHHHccccc

************************CQIADYKKRKEMFQTIFDEDIHASLLSRGDRSLSHKALQGAILITMYRDEPRFHLPSQILSALMDIDCCTAKWRHNHVLMVQRMIGSQHLGTGGTSGYQYLRSTLSDRYKIFLDLFNVSSFLLPKQYIPVLSGTLKSQLSATP***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQGRDKQPKLQIDYLDAESESLQSCQIADYKKRKEMFQTIFDEDIHASLLSRGDRSLSHKALQGAILITMYRDEPRFHLPSQILSALMDIDCCTAKWRHNHVLMVQRMIGSQHLGTGGTSGYQYLRSTLSDRYKIFLDLFNVSSFLLPKQYIPVLSGTLKSQLSATPHHPRNREHADSKKNCVKHLNGNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tryptophan 2,3-dioxygenase	Catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring.	confident	Q55DB4
Tryptophan 2,3-dioxygenase	Catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring.	confident	Q5EBG2
Tryptophan 2,3-dioxygenase	Catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring.	confident	Q09474

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016597 [MF]	amino acid binding	probable	GO:0043168, GO:0003674, GO:0031406, GO:0005488, GO:0043167
GO:0019825 [MF]	oxygen binding	probable	GO:0003674, GO:0005488
GO:0004833 [MF]	tryptophan 2,3-dioxygenase activity	probable	GO:0051213, GO:0016702, GO:0016701, GO:0003824, GO:0003674, GO:0016491
GO:0020037 [MF]	heme binding	probable	GO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0019441 [BP]	tryptophan catabolic process to kynurenine	probable	GO:0042537, GO:0009310, GO:0019752, GO:0009063, GO:0043436, GO:0042402, GO:0006807, GO:0044281, GO:0044282, GO:1901360, GO:1901361, GO:0046700, GO:1901575, GO:0070189, GO:0006520, GO:0006569, GO:0006568, GO:0071704, GO:0006082, GO:0046483, GO:1901605, GO:1901606, GO:0044712, GO:0044270, GO:0009308, GO:0044238, GO:0009987, GO:0006725, GO:0044710, GO:0006586, GO:0044106, GO:0008150, GO:0008152, GO:0009074, GO:0046218, GO:0042436, GO:0009056, GO:0042430, GO:0009072, GO:0006575, GO:0044248, GO:1901564, GO:0042180, GO:0006576, GO:0046395, GO:0016054, GO:0034641, GO:0044237, GO:0019439, GO:1901565
GO:0019442 [BP]	tryptophan catabolic process to acetyl-CoA	probable	GO:0006637, GO:0006732, GO:0009310, GO:0019752, GO:0009063, GO:0043436, GO:0042402, GO:0006807, GO:0044281, GO:0044282, GO:1901360, GO:1901361, GO:0046700, GO:1901575, GO:0051186, GO:0006520, GO:0006569, GO:0006568, GO:0071704, GO:0006082, GO:0046483, GO:1901605, GO:1901606, GO:0044712, GO:0035383, GO:0009308, GO:0044238, GO:0009987, GO:0006725, GO:0044710, GO:0006586, GO:0044106, GO:0008150, GO:0008152, GO:0009074, GO:0046218, GO:0042436, GO:0009056, GO:0042430, GO:0009072, GO:1901565, GO:0006084, GO:0044248, GO:1901564, GO:0044270, GO:0006576, GO:0046395, GO:0016054, GO:0034641, GO:0044237, GO:0006793, GO:0019439

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NOX, chain A
Confidence level:very confident
Coverage over the Query: 23-146
View the alignment between query and template
View the model in PyMOL