Diaphorina citri psyllid: psy3087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MDIVAALHWLRENLHAFGGDPDRITLMGHGTGASLANILAVSPVAKGKCYRTGSVRGEDVPYVLGLPLVDGGPFFPHNYSDQDAAISKQLIHYIANFARKGDPNGPTPPASLDPNHQVPFWDTYDSINQLYLELGSKTEIRNHYRGHKMSLWLNLIPQLHRPGVEDLSMRHHNFLEDGVQYYDASSSSSSIF
cHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEcccccccccccHHHHcHHHHHHHHHccccccccccccccccccccccccccccccccc
MDIVAALHWLRENLHAFGGDPDRITLMGHGTGASLANILAVSPVAKGKCYRTGSVRGEDVPYVLGLPLVDGGPFFPHNYSDQDAAISKQLIHYIANFARKGDPN*********PNHQVPFWDTYDSINQLYLELGSKTEIRNHYRGHKMSLWLNLIPQLHRP***************GVQYY**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIVAALHWLRENLHAFGGDPDRITLMGHGTGASLANILAVSPVAKGKCYRTGSVRGEDVPYVLGLPLVDGGPFFPHNYSDQDAAISKQLIHYIANFARKGDPNGPTPPASLDPNHQVPFWDTYDSINQLYLELGSKTEIRNHYRGHKMSLWLNLIPQLHRPGVEDLSMRHHNFLEDGVQYYDASSSSSSIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0097090 [BP]presynaptic membrane organizationprobableGO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071709 [BP]membrane assemblyprobableGO:0022607, GO:0016044, GO:0009987, GO:0016043, GO:0008150, GO:0061024, GO:0044085, GO:0044091, GO:0071840, GO:0044763, GO:0044699
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0001941 [BP]postsynaptic membrane organizationprobableGO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0045202 [CC]synapseprobableGO:0005575
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0072657 [BP]protein localization to membraneprobableGO:0008104, GO:0070727, GO:0016044, GO:0034613, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0007416 [BP]synapse assemblyprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0032501, GO:0009987, GO:0048856, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0071840, GO:0048731, GO:0007275, GO:0044699, GO:0044085
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0044087 [BP]regulation of cellular component biogenesisprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OGT, chain A
Confidence level:very confident
Coverage over the Query: 55-106,117-153
View the alignment between query and template
View the model in PyMOL
Template: 3GA7, chain A
Confidence level:confident
Coverage over the Query: 2-26
View the alignment between query and template
View the model in PyMOL
Template: 3BL8, chain A
Confidence level:probable
Coverage over the Query: 45-157
View the alignment between query and template
View the model in PyMOL