Query psy3095
Match_columns 106
No_of_seqs 107 out of 182
Neff 4.0
Searched_HMMs 46136
Date Sat Aug 17 01:31:59 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy3095.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3095hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 cd01824 Phospholipase_B_like P 100.0 6E-30 1.3E-34 202.3 3.2 69 28-97 1-74 (288)
2 KOG3670|consensus 99.9 2.8E-26 6.2E-31 191.4 4.7 85 9-95 46-136 (397)
3 cd01844 SGNH_hydrolase_like_6 95.5 0.0044 9.5E-08 44.2 0.4 52 40-92 2-61 (177)
4 cd01820 PAF_acetylesterase_lik 95.1 0.0064 1.4E-07 44.9 0.3 36 40-75 35-71 (214)
5 cd01822 Lysophospholipase_L1_l 94.9 0.011 2.3E-07 41.2 0.8 15 40-54 3-17 (177)
6 cd01825 SGNH_hydrolase_peri1 S 93.7 0.015 3.2E-07 40.9 -0.5 36 40-75 2-39 (189)
7 cd01831 Endoglucanase_E_like E 93.1 0.033 7.1E-07 39.4 0.4 16 40-55 2-17 (169)
8 cd01832 SGNH_hydrolase_like_1 92.4 0.054 1.2E-06 38.1 0.8 15 40-54 2-16 (185)
9 cd01835 SGNH_hydrolase_like_3 92.1 0.054 1.2E-06 38.7 0.5 17 39-55 3-19 (193)
10 cd01839 SGNH_arylesterase_like 91.8 0.062 1.3E-06 39.0 0.5 16 40-55 2-17 (208)
11 cd04506 SGNH_hydrolase_YpmR_li 91.5 0.078 1.7E-06 38.2 0.8 16 40-55 2-17 (204)
12 cd01823 SEST_like SEST_like. A 91.4 0.09 1.9E-06 39.3 1.1 16 40-55 3-18 (259)
13 cd01830 XynE_like SGNH_hydrola 91.4 0.073 1.6E-06 38.9 0.6 16 40-55 2-17 (204)
14 cd01838 Isoamyl_acetate_hydrol 91.2 0.072 1.6E-06 37.3 0.4 16 40-55 2-17 (199)
15 cd01836 FeeA_FeeB_like SGNH_hy 90.7 0.086 1.9E-06 37.5 0.4 16 40-55 5-20 (191)
16 cd01827 sialate_O-acetylestera 90.3 0.1 2.2E-06 36.9 0.4 16 40-55 3-18 (188)
17 cd01829 SGNH_hydrolase_peri2 S 89.9 0.062 1.3E-06 38.4 -0.9 14 40-53 2-15 (200)
18 cd01841 NnaC_like NnaC (CMP-Ne 89.2 0.2 4.4E-06 35.0 1.3 17 39-55 2-18 (174)
19 cd04501 SGNH_hydrolase_like_4 88.1 0.24 5.2E-06 35.0 1.1 16 40-55 3-18 (183)
20 cd01834 SGNH_hydrolase_like_2 87.5 0.28 6E-06 34.1 1.1 14 40-53 4-17 (191)
21 cd00229 SGNH_hydrolase SGNH_hy 86.9 0.36 7.9E-06 31.5 1.3 18 40-57 1-18 (187)
22 cd01821 Rhamnogalacturan_acety 85.4 0.29 6.4E-06 35.2 0.3 15 40-54 3-17 (198)
23 PRK10528 multifunctional acyl- 85.1 0.39 8.4E-06 35.1 0.8 17 38-54 11-27 (191)
24 cd01833 XynB_like SGNH_hydrola 85.1 0.33 7.1E-06 33.4 0.4 11 40-50 3-13 (157)
25 PF00657 Lipase_GDSL: GDSL-lik 81.8 0.72 1.6E-05 32.6 1.1 11 40-50 1-11 (234)
26 cd01840 SGNH_hydrolase_yrhL_li 81.2 0.58 1.3E-05 32.8 0.4 13 40-52 2-14 (150)
27 PF13472 Lipase_GDSL_2: GDSL-l 80.4 0.89 1.9E-05 30.3 1.1 15 41-55 1-15 (179)
28 cd01828 sialate_O-acetylestera 75.3 1.2 2.7E-05 31.0 0.7 15 40-54 2-16 (169)
29 COG2755 TesA Lysophospholipase 69.8 2.4 5.3E-05 30.7 1.1 18 37-54 8-25 (216)
30 cd01826 acyloxyacyl_hydrolase_ 53.9 4.6 0.0001 33.6 0.2 36 40-75 14-65 (305)
31 KOG3189|consensus 33.7 20 0.00043 29.3 0.9 29 67-98 174-210 (252)
32 cd03699 lepA_II lepA_II: This 29.4 26 0.00055 22.7 0.7 16 27-42 55-70 (86)
33 PRK01964 4-oxalocrotonate taut 28.6 8.5 0.00018 23.6 -1.6 37 39-75 20-56 (64)
34 cd00491 4Oxalocrotonate_Tautom 27.9 31 0.00067 20.2 0.9 34 42-75 22-55 (58)
35 PF00983 Tymo_coat: Tymovirus 26.3 46 0.00099 25.8 1.7 35 60-94 100-138 (172)
36 TIGR01312 XylB D-xylulose kina 23.7 65 0.0014 26.5 2.3 23 34-56 225-247 (481)
37 cd00287 ribokinase_pfkB_like r 23.7 29 0.00064 24.1 0.2 15 38-53 179-193 (196)
38 PF12102 DUF3578: Domain of un 22.5 42 0.00091 25.4 0.9 33 68-102 45-78 (188)
39 PF00370 FGGY_N: FGGY family o 22.5 47 0.001 24.8 1.2 18 35-52 228-245 (245)
40 PRK02220 4-oxalocrotonate taut 21.8 37 0.00079 20.3 0.4 37 39-75 20-56 (61)
41 PRK13508 tagatose-6-phosphate 21.1 37 0.00081 26.1 0.4 17 37-54 246-262 (309)
42 cd04092 mtEFG2_II_like mtEFG2_ 20.9 36 0.00079 21.6 0.2 17 27-43 56-72 (83)
43 PRK12700 flgH flagellar basal 20.3 23 0.00051 28.1 -0.9 28 32-69 182-209 (230)
44 TIGR01231 lacC tagatose-6-phos 20.2 37 0.0008 26.2 0.2 16 37-53 246-261 (309)
No 1
>cd01824 Phospholipase_B_like Phospholipase-B_like. This subgroup of the SGNH-family of lipolytic enzymes may have both esterase and phospholipase-A/lysophospholipase activity. It's members may be involved in the conversion of phosphatidylcholine to fatty acids and glycerophosphocholine, perhaps in the context of dietary lipid uptake. Members may be membrane proteins. The tertiary fold of the SGNH-hydrolases is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; Its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases.
Probab=99.96 E-value=6e-30 Score=202.31 Aligned_cols=69 Identities=42% Similarity=0.729 Sum_probs=65.7
Q ss_pred cccccCCCCcceEeecchhHHHhcCCccCCCCCcccccccceeecCCCCCCcccc---c--ccccCCccccceee
Q psy3095 28 NVNQLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARRR---P--ANHYQVELISHTCQ 97 (106)
Q Consensus 28 sVh~LRP~DI~VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd~~~~~t~---p--lr~ynp~l~G~s~~ 97 (106)
|||+|||+|||||||||||+|||+||++.+.+|+..||||+||++||| .+|+++ | ||+|||+|+|+|+.
T Consensus 1 sv~~lrp~DI~viaA~GDSltag~ga~~~~~~~~~~e~rG~s~~~Gg~-~~~~~~~Tlpnil~~fnp~l~G~s~~ 74 (288)
T cd01824 1 SVHRLRPGDIKVIAALGDSLTAGNGAGSANNLDLLTEYRGLSWSIGGD-STLRGLTTLPNILREFNPSLYGYSVG 74 (288)
T ss_pred CccccccccCeEEeeccccccccCCCCCCCccccccccCCceEecCCc-ccccccccHHHHHHHhCCCcccccCC
Confidence 799999999999999999999999999999999999999999999999 998865 5 99999999999986
No 2
>KOG3670|consensus
Probab=99.92 E-value=2.8e-26 Score=191.43 Aligned_cols=85 Identities=34% Similarity=0.527 Sum_probs=74.8
Q ss_pred CCCCccCCCCCC-CCCCCCCcccccCCCCcceEeecchhHHHhcCCccCCCCCcccccccceeecCCCCCCccc---cc-
Q psy3095 9 YEGPFPCDLSQA-RSPLPPNNVNQLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARR---RP- 83 (106)
Q Consensus 9 ~~~~f~C~~~~~-~s~~~PtsVh~LRP~DI~VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd~~~~~t---~p- 83 (106)
+...+.|+.+.. |++++|||||+|||+||+||+|||||||+|+||.+.+ +++..||||+||++||| .+|++ +|
T Consensus 46 ~~~~~~~~~s~~~p~~~~ptsv~~lrP~dI~vIgAmGDSLt~G~ga~~~~-~~~~~e~rG~sF~~Ggd-~~ld~~vTipN 123 (397)
T KOG3670|consen 46 GLPNDQCDFSCPQPSKKTPTSVHSLRPEDIKVIGAMGDSLTNGAGAWPGN-LAVILEFRGLSFQIGGD-ANLDEHVTIPN 123 (397)
T ss_pred cCccccccccCCCccCCCCCcccccCcccceeeeeccchhhccCCCCCcc-hhhheecCcceeccCCc-hhhhcceeehh
Confidence 445555655533 9999999999999999999999999999999999988 88999999999999999 88875 56
Q ss_pred -ccccCCccccce
Q psy3095 84 -ANHYQVELISHT 95 (106)
Q Consensus 84 -lr~ynp~l~G~s 95 (106)
||+|||+|.|.|
T Consensus 124 Ilr~f~p~l~g~s 136 (397)
T KOG3670|consen 124 ILRKFNPKLYGKS 136 (397)
T ss_pred HHhhhCccccccc
Confidence 999999999744
No 3
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=95.48 E-value=0.0044 Score=44.24 Aligned_cols=52 Identities=12% Similarity=0.032 Sum_probs=30.6
Q ss_pred EeecchhHHHhcCCccC--CCCCccc---ccccceeecCCCCCCccccc---ccccCCccc
Q psy3095 40 VGAIGDSITAGNGIVAT--NPSQVNT---ENRGLSWSVGKNFGPARRRP---ANHYQVELI 92 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~~--~~~~~~~---EyRG~SfsiGGd~~~~~t~p---lr~ynp~l~ 92 (106)
|.++|||||.|.|.... ++...+. .+.=....+||+ ..+.... +..++|+++
T Consensus 2 iv~~GDSit~G~g~~~~~~~~~~~~~~~~~~~v~N~g~~G~-~~~~~~~~~~~~~~~pd~v 61 (177)
T cd01844 2 WVFYGTSISQGACASRPGMAWTAILARRLGLEVINLGFSGN-ARLEPEVAELLRDVPADLY 61 (177)
T ss_pred EEEEeCchhcCcCCCCCCCcHHHHHHHHhCCCeEEeeeccc-ccchHHHHHHHHhcCCCEE
Confidence 67899999999988532 2222221 233445667788 6554322 455666643
No 4
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues. In addition, PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=95.14 E-value=0.0064 Score=44.87 Aligned_cols=36 Identities=25% Similarity=0.294 Sum_probs=24.4
Q ss_pred EeecchhHHHhcCCcc-CCCCCcccccccceeecCCC
Q psy3095 40 VGAIGDSITAGNGIVA-TNPSQVNTENRGLSWSVGKN 75 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~-~~~~~~~~EyRG~SfsiGGd 75 (106)
|+++|||+|+|++... ..+.+.+.+++=+.+.++|+
T Consensus 35 iv~lGDSit~g~~~~~~~~~~~~~~~~~v~N~Gi~G~ 71 (214)
T cd01820 35 VVFIGDSITQNWEFTGLEVWRELYAPLHALNFGIGGD 71 (214)
T ss_pred EEEECchHhhhhcccchHHHHHHcCcCCeEeeeeccc
Confidence 7888999999998763 11122334555566778888
No 5
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=94.88 E-value=0.011 Score=41.17 Aligned_cols=15 Identities=53% Similarity=0.842 Sum_probs=13.2
Q ss_pred EeecchhHHHhcCCc
Q psy3095 40 VGAIGDSITAGNGIV 54 (106)
Q Consensus 40 IaAlGDSlTAG~ga~ 54 (106)
|.++|||+|+|.++.
T Consensus 3 i~~~GDSit~G~~~~ 17 (177)
T cd01822 3 ILALGDSLTAGYGLP 17 (177)
T ss_pred EEEEccccccCcCCC
Confidence 788999999999874
No 6
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=93.67 E-value=0.015 Score=40.88 Aligned_cols=36 Identities=22% Similarity=0.230 Sum_probs=20.9
Q ss_pred EeecchhHHHhcCCccC--CCCCcccccccceeecCCC
Q psy3095 40 VGAIGDSITAGNGIVAT--NPSQVNTENRGLSWSVGKN 75 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~~--~~~~~~~EyRG~SfsiGGd 75 (106)
|+++|||+|+|.+.-.. ..+++...++|.+-.+..+
T Consensus 2 iv~~GDS~t~g~~~~~~l~~~l~~~v~N~g~~G~t~~~ 39 (189)
T cd01825 2 IAQLGDSHIAGDFFTDVLRGLLGVIYDNLGVNGASASL 39 (189)
T ss_pred eeEecCccccccchhhHHHhhhceEEecCccCchhhhh
Confidence 67889999998643221 1223445566665554444
No 7
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=93.05 E-value=0.033 Score=39.44 Aligned_cols=16 Identities=50% Similarity=0.831 Sum_probs=14.0
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|..+|||+|+|+|...
T Consensus 2 i~~iGDSit~G~~~~~ 17 (169)
T cd01831 2 IEFIGDSITCGYGVTG 17 (169)
T ss_pred EEEEeccccccCccCC
Confidence 6789999999999854
No 8
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=92.39 E-value=0.054 Score=38.11 Aligned_cols=15 Identities=53% Similarity=0.583 Sum_probs=13.6
Q ss_pred EeecchhHHHhcCCc
Q psy3095 40 VGAIGDSITAGNGIV 54 (106)
Q Consensus 40 IaAlGDSlTAG~ga~ 54 (106)
|+++|||+|+|+++.
T Consensus 2 i~~~GDSit~G~~~~ 16 (185)
T cd01832 2 YVALGDSITEGVGDP 16 (185)
T ss_pred eeEecchhhcccCCC
Confidence 789999999999984
No 9
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=92.05 E-value=0.054 Score=38.68 Aligned_cols=17 Identities=29% Similarity=0.319 Sum_probs=14.0
Q ss_pred eEeecchhHHHhcCCcc
Q psy3095 39 IVGAIGDSITAGNGIVA 55 (106)
Q Consensus 39 VIaAlGDSlTAG~ga~~ 55 (106)
-|+++|||+|+|+|...
T Consensus 3 ~i~~lGDSit~G~~~~~ 19 (193)
T cd01835 3 RLIVVGDSLVYGWGDPE 19 (193)
T ss_pred EEEEEcCccccCCCCCC
Confidence 37889999999998753
No 10
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=91.76 E-value=0.062 Score=39.04 Aligned_cols=16 Identities=31% Similarity=0.090 Sum_probs=13.5
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|+++|||+|+|++...
T Consensus 2 I~~~GDSiT~G~~~~~ 17 (208)
T cd01839 2 ILCFGDSNTWGIIPDT 17 (208)
T ss_pred EEEEecCcccCCCCCC
Confidence 7889999999997643
No 11
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=91.50 E-value=0.078 Score=38.20 Aligned_cols=16 Identities=44% Similarity=0.619 Sum_probs=13.8
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|+++|||+|+|.|...
T Consensus 2 i~~~GDSit~G~g~~~ 17 (204)
T cd04506 2 IVALGDSLTEGVGDET 17 (204)
T ss_pred EeEEeccccCccCCCC
Confidence 6899999999998664
No 12
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=91.40 E-value=0.09 Score=39.35 Aligned_cols=16 Identities=44% Similarity=0.524 Sum_probs=14.1
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
+.|+|||+++|.|+..
T Consensus 3 ~v~iGDS~~~G~g~~~ 18 (259)
T cd01823 3 YVALGDSYAAGPGAGP 18 (259)
T ss_pred EEEecchhhcCCCCCc
Confidence 6899999999999754
No 13
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=91.40 E-value=0.073 Score=38.87 Aligned_cols=16 Identities=56% Similarity=0.771 Sum_probs=13.8
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|.++|||||.|++...
T Consensus 2 iv~~GDSiT~G~~~~~ 17 (204)
T cd01830 2 VVALGDSITDGRGSTP 17 (204)
T ss_pred EEEEecccccCCCCCC
Confidence 7899999999998754
No 14
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=91.24 E-value=0.072 Score=37.32 Aligned_cols=16 Identities=31% Similarity=0.108 Sum_probs=13.5
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|+++|||+|+|.+...
T Consensus 2 i~~~GDSit~g~~~~~ 17 (199)
T cd01838 2 IVLFGDSITQFSFDQG 17 (199)
T ss_pred EEEecCcccccccCCC
Confidence 7899999999987643
No 15
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=90.71 E-value=0.086 Score=37.49 Aligned_cols=16 Identities=38% Similarity=0.605 Sum_probs=13.5
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|.++|||+|.|+|+..
T Consensus 5 i~~~GDSit~G~g~~~ 20 (191)
T cd01836 5 LLVLGDSTAAGVGVET 20 (191)
T ss_pred EEEEeccccccccccc
Confidence 6778999999998754
No 16
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=90.30 E-value=0.1 Score=36.91 Aligned_cols=16 Identities=50% Similarity=0.856 Sum_probs=13.6
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|+++|||+|+|++...
T Consensus 3 i~~~GDSit~G~~~~~ 18 (188)
T cd01827 3 VACVGNSITEGAGLRA 18 (188)
T ss_pred EEEEecccccccCCCC
Confidence 6889999999998753
No 17
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=89.88 E-value=0.062 Score=38.37 Aligned_cols=14 Identities=43% Similarity=0.508 Sum_probs=11.7
Q ss_pred EeecchhHHHhcCC
Q psy3095 40 VGAIGDSITAGNGI 53 (106)
Q Consensus 40 IaAlGDSlTAG~ga 53 (106)
|+++|||+|+|++.
T Consensus 2 il~iGDS~~~g~~~ 15 (200)
T cd01829 2 VLVIGDSLAQGLAP 15 (200)
T ss_pred EEEEechHHHHHHH
Confidence 66889999999863
No 18
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=89.17 E-value=0.2 Score=35.04 Aligned_cols=17 Identities=29% Similarity=0.313 Sum_probs=14.1
Q ss_pred eEeecchhHHHhcCCcc
Q psy3095 39 IVGAIGDSITAGNGIVA 55 (106)
Q Consensus 39 VIaAlGDSlTAG~ga~~ 55 (106)
-|..+|||+|+|++...
T Consensus 2 ~iv~~GdS~t~~~~~~~ 18 (174)
T cd01841 2 NIVFIGDSLFEGWPLYE 18 (174)
T ss_pred CEEEEcchhhhcCchhh
Confidence 47899999999998643
No 19
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=88.14 E-value=0.24 Score=34.96 Aligned_cols=16 Identities=44% Similarity=0.520 Sum_probs=13.7
Q ss_pred EeecchhHHHhcCCcc
Q psy3095 40 VGAIGDSITAGNGIVA 55 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~ 55 (106)
|+++|||+|.|++...
T Consensus 3 i~~~GDSi~~g~~~~~ 18 (183)
T cd04501 3 VVCLGDSITYGYPVGP 18 (183)
T ss_pred EEEEccccccCcCCCC
Confidence 7889999999998754
No 20
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=87.53 E-value=0.28 Score=34.12 Aligned_cols=14 Identities=43% Similarity=0.572 Sum_probs=12.0
Q ss_pred EeecchhHHHhcCC
Q psy3095 40 VGAIGDSITAGNGI 53 (106)
Q Consensus 40 IaAlGDSlTAG~ga 53 (106)
|+++|||+|.|.+.
T Consensus 4 v~~~GDSit~g~~~ 17 (191)
T cd01834 4 IVFIGNSITDRGGY 17 (191)
T ss_pred EEEeCCChhhcccc
Confidence 78999999998843
No 21
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=86.93 E-value=0.36 Score=31.49 Aligned_cols=18 Identities=50% Similarity=0.669 Sum_probs=15.1
Q ss_pred EeecchhHHHhcCCccCC
Q psy3095 40 VGAIGDSITAGNGIVATN 57 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~~~ 57 (106)
|+++|||+|.|.+.....
T Consensus 1 i~~~GDS~~~g~~~~~~~ 18 (187)
T cd00229 1 ILVIGDSITAGYGASSGS 18 (187)
T ss_pred CeeeccccccccCCCCCC
Confidence 678999999999877653
No 22
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=85.39 E-value=0.29 Score=35.21 Aligned_cols=15 Identities=27% Similarity=0.093 Sum_probs=13.1
Q ss_pred EeecchhHHHhcCCc
Q psy3095 40 VGAIGDSITAGNGIV 54 (106)
Q Consensus 40 IaAlGDSlTAG~ga~ 54 (106)
|.++|||+|+|++..
T Consensus 3 i~~~GDS~t~G~~~~ 17 (198)
T cd01821 3 IFLAGDSTVADYDPG 17 (198)
T ss_pred EEEEecCCcccCCCC
Confidence 678899999999874
No 23
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=85.12 E-value=0.39 Score=35.13 Aligned_cols=17 Identities=35% Similarity=0.561 Sum_probs=14.1
Q ss_pred ceEeecchhHHHhcCCc
Q psy3095 38 DIVGAIGDSITAGNGIV 54 (106)
Q Consensus 38 ~VIaAlGDSlTAG~ga~ 54 (106)
+-|..+|||+|+|++..
T Consensus 11 ~~iv~~GDSit~G~~~~ 27 (191)
T PRK10528 11 DTLLILGDSLSAGYRMP 27 (191)
T ss_pred CEEEEEeCchhhcCCCC
Confidence 46888999999999763
No 24
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=85.09 E-value=0.33 Score=33.41 Aligned_cols=11 Identities=55% Similarity=0.779 Sum_probs=9.9
Q ss_pred EeecchhHHHh
Q psy3095 40 VGAIGDSITAG 50 (106)
Q Consensus 40 IaAlGDSlTAG 50 (106)
|.++|||+|+|
T Consensus 3 ~~~~Gds~~~g 13 (157)
T cd01833 3 IMPLGDSITWG 13 (157)
T ss_pred eeecCCceeec
Confidence 57899999999
No 25
>PF00657 Lipase_GDSL: GDSL-like Lipase/Acylhydrolase; InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=81.78 E-value=0.72 Score=32.55 Aligned_cols=11 Identities=45% Similarity=0.788 Sum_probs=10.3
Q ss_pred EeecchhHHHh
Q psy3095 40 VGAIGDSITAG 50 (106)
Q Consensus 40 IaAlGDSlTAG 50 (106)
|.++|||+|.|
T Consensus 1 i~~fGDS~td~ 11 (234)
T PF00657_consen 1 IVVFGDSLTDG 11 (234)
T ss_dssp EEEEESHHHHT
T ss_pred CEEEeehhccc
Confidence 68999999999
No 26
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism.
Probab=81.19 E-value=0.58 Score=32.83 Aligned_cols=13 Identities=38% Similarity=0.631 Sum_probs=10.6
Q ss_pred EeecchhHHHhcC
Q psy3095 40 VGAIGDSITAGNG 52 (106)
Q Consensus 40 IaAlGDSlTAG~g 52 (106)
|.++|||+|+|.+
T Consensus 2 v~~~GDSv~~~~~ 14 (150)
T cd01840 2 ITAIGDSVMLDSS 14 (150)
T ss_pred eeEEeehHHHchH
Confidence 4567999999974
No 27
>PF13472 Lipase_GDSL_2: GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=80.41 E-value=0.89 Score=30.29 Aligned_cols=15 Identities=53% Similarity=0.634 Sum_probs=12.3
Q ss_pred eecchhHHHhcCCcc
Q psy3095 41 GAIGDSITAGNGIVA 55 (106)
Q Consensus 41 aAlGDSlTAG~ga~~ 55 (106)
..+|||+|+|.+...
T Consensus 1 v~~GDS~t~g~~~~~ 15 (179)
T PF13472_consen 1 VFLGDSITAGYGAPN 15 (179)
T ss_dssp EEEESHHHHTTTTSS
T ss_pred CEEccccccCCCCCC
Confidence 368999999998753
No 28
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=75.31 E-value=1.2 Score=30.96 Aligned_cols=15 Identities=33% Similarity=0.479 Sum_probs=12.4
Q ss_pred EeecchhHHHhcCCc
Q psy3095 40 VGAIGDSITAGNGIV 54 (106)
Q Consensus 40 IaAlGDSlTAG~ga~ 54 (106)
|..+|||+|.|.+..
T Consensus 2 v~~~GdSi~~~~~~~ 16 (169)
T cd01828 2 LVFLGDSLTEGGPWA 16 (169)
T ss_pred EEEecchhhccCcHH
Confidence 678899999998744
No 29
>COG2755 TesA Lysophospholipase L1 and related esterases [Amino acid transport and metabolism]
Probab=69.80 E-value=2.4 Score=30.67 Aligned_cols=18 Identities=50% Similarity=0.619 Sum_probs=15.9
Q ss_pred cceEeecchhHHHhcCCc
Q psy3095 37 IDIVGAIGDSITAGNGIV 54 (106)
Q Consensus 37 I~VIaAlGDSlTAG~ga~ 54 (106)
++.|.++|||+|.|++..
T Consensus 8 ~~~i~~~GDSlt~g~~~~ 25 (216)
T COG2755 8 AGTVLALGDSLTAGYGPA 25 (216)
T ss_pred hceEEEeccchhccccCC
Confidence 337999999999999988
No 30
>cd01826 acyloxyacyl_hydrolase_like Acyloxyacyl-hydrolase like subfamily of the SGNH-hydrolase family. Acyloxyacyl-hydrolase is a leukocyte-secreted enzyme that deacetylates bacterial lipopolysaccharides.
Probab=53.91 E-value=4.6 Score=33.56 Aligned_cols=36 Identities=25% Similarity=0.042 Sum_probs=26.0
Q ss_pred EeecchhHHHhcCCccC----------C------CCCcccccccceeecCCC
Q psy3095 40 VGAIGDSITAGNGIVAT----------N------PSQVNTENRGLSWSVGKN 75 (106)
Q Consensus 40 IaAlGDSlTAG~ga~~~----------~------~~~~~~EyRG~SfsiGGd 75 (106)
|..+|||.+|.|.+-+. . ++..-.++.-+||++|=.
T Consensus 14 ~i~~gds~~ahf~ip~~~~~~~~~~~~~~~~~~~~~~~e~d~p~~s~~TG~~ 65 (305)
T cd01826 14 VILLGDSAGAHFHIPPEWLTVLLLSSEGFANIITIIANEFDWPMLSGATGFA 65 (305)
T ss_pred EEEecccccccccCChHHcCHHhcChhhhcchHHHhccccCCccccccccCC
Confidence 56899999999987653 1 112224788999999973
No 31
>KOG3189|consensus
Probab=33.67 E-value=20 Score=29.27 Aligned_cols=29 Identities=21% Similarity=0.312 Sum_probs=20.9
Q ss_pred cceeecCCCCCCccccc--------ccccCCccccceeeE
Q psy3095 67 GLSWSVGKNFGPARRRP--------ANHYQVELISHTCQV 98 (106)
Q Consensus 67 G~SfsiGGd~~~~~t~p--------lr~ynp~l~G~s~~~ 98 (106)
|+.|||||+ =...-+| |+|.-++ |+.+--
T Consensus 174 gLtFSIGGQ-ISfDvFP~GWDKtyCLqhle~d--gf~~Ih 210 (252)
T KOG3189|consen 174 GLTFSIGGQ-ISFDVFPKGWDKTYCLQHLEKD--GFDTIH 210 (252)
T ss_pred CeeEEECCe-EEEeecCCCcchhHHHHHhhhc--CCceEE
Confidence 899999999 5554455 8888776 665543
No 32
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well. LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=29.39 E-value=26 Score=22.68 Aligned_cols=16 Identities=19% Similarity=0.389 Sum_probs=12.7
Q ss_pred CcccccCCCCcceEee
Q psy3095 27 NNVNQLRPGDIDIVGA 42 (106)
Q Consensus 27 tsVh~LRP~DI~VIaA 42 (106)
..+.++.++||-+|.+
T Consensus 55 ~~~~~~~aGdI~~v~~ 70 (86)
T cd03699 55 TPTDELSAGQVGYIIA 70 (86)
T ss_pred cCCceECCCCEEEEEc
Confidence 5668899999988753
No 33
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=28.61 E-value=8.5 Score=23.61 Aligned_cols=37 Identities=14% Similarity=0.249 Sum_probs=29.7
Q ss_pred eEeecchhHHHhcCCccCCCCCcccccccceeecCCC
Q psy3095 39 IVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKN 75 (106)
Q Consensus 39 VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd 75 (106)
++.++=+++...+|.-...+.-.+.|+.--.|++||.
T Consensus 20 l~~~it~~l~~~lg~p~~~v~V~i~e~~~~~w~~gg~ 56 (64)
T PRK01964 20 LIREVTEAISATLDVPKERVRVIVNEVPSSHWGVAGV 56 (64)
T ss_pred HHHHHHHHHHHHhCcChhhEEEEEEEcChHHeeECCE
Confidence 4556667777788887777777888999999999996
No 34
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer. Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=27.91 E-value=31 Score=20.19 Aligned_cols=34 Identities=12% Similarity=0.239 Sum_probs=25.3
Q ss_pred ecchhHHHhcCCccCCCCCcccccccceeecCCC
Q psy3095 42 AIGDSITAGNGIVATNPSQVNTENRGLSWSVGKN 75 (106)
Q Consensus 42 AlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd 75 (106)
++=|.+..-+|....++.-.+.|++--.|++||.
T Consensus 22 ~i~~~l~~~~g~~~~~v~V~i~e~~~~~~~~gg~ 55 (58)
T cd00491 22 RVTEAVSEILGAPEATIVVIIDEMPKENWGIGGE 55 (58)
T ss_pred HHHHHHHHHhCcCcccEEEEEEEeCchhceECCE
Confidence 3445666667776666666788999999999996
No 35
>PF00983 Tymo_coat: Tymovirus coat protein; InterPro: IPR000574 This signature is found in coat proteins from the related tymoviruses. The coat protein is also known as the virion protein. The virus coat is composed of 180 copies of the coat protein arranged in an icosahedral shell.; GO: 0005198 structural molecule activity, 0019028 viral capsid; PDB: 2FZ1_B 2FZ2_B 1DDL_B 1E57_C 1QJZ_C 2WWS_A 2XPJ_B 1AUY_C 1W39_A.
Probab=26.35 E-value=46 Score=25.79 Aligned_cols=35 Identities=11% Similarity=0.162 Sum_probs=25.0
Q ss_pred CcccccccceeecCCCCCC--ccccc--ccccCCccccc
Q psy3095 60 QVNTENRGLSWSVGKNFGP--ARRRP--ANHYQVELISH 94 (106)
Q Consensus 60 ~~~~EyRG~SfsiGGd~~~--~~t~p--lr~ynp~l~G~ 94 (106)
+++.=|=|..|++||-+.. -.++| |+..||-+|..
T Consensus 100 ~iL~~yGGq~ftiGG~i~~~~~i~vP~~L~~vNp~IKdS 138 (172)
T PF00983_consen 100 QILSVYGGQRFTIGGPINSSSPIIVPADLSSVNPMIKDS 138 (172)
T ss_dssp GGGGBTTEEEEEESSSTTTTSEEEEE--TTTS-SEEESS
T ss_pred ceeeccCccEEEcCceeecCCcEEecCchhhcCCeEecc
Confidence 4567899999999997222 23456 99999988853
No 36
>TIGR01312 XylB D-xylulose kinase. D-xylulose kinase (XylB) generally is found with xylose isomerase (XylA) and acts in xylose utilization.
Probab=23.71 E-value=65 Score=26.48 Aligned_cols=23 Identities=13% Similarity=0.242 Sum_probs=19.9
Q ss_pred CCCcceEeecchhHHHhcCCccC
Q psy3095 34 PGDIDIVGAIGDSITAGNGIVAT 56 (106)
Q Consensus 34 P~DI~VIaAlGDSlTAG~ga~~~ 56 (106)
|.++.|+++.||...|..|+...
T Consensus 225 ~~g~pV~~g~~D~~aa~~g~g~~ 247 (481)
T TIGR01312 225 SAGVPVAAGGGDNAAGAIGTGTV 247 (481)
T ss_pred CCCCeEEecchHHHHHhhCCCcc
Confidence 37999999999999998888753
No 37
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase, 2-dehydro-3-deoxygluconokinase, 1-phosphofructokinase, the minor 6-phosphofructokinase (PfkB), inosine-guanosine kinase, and adenosine kinase. Even though there is a high degree of structural conservation within this superfamily, their multimerization level varies widely, monomeric (e.g. adenosine kinase), dimeric (e.g. ribokinase), and trimeric (e.g THZ kinase).
Probab=23.68 E-value=29 Score=24.12 Aligned_cols=15 Identities=40% Similarity=0.552 Sum_probs=10.8
Q ss_pred ceEeecchhHHHhcCC
Q psy3095 38 DIVGAIGDSITAGNGI 53 (106)
Q Consensus 38 ~VIaAlGDSlTAG~ga 53 (106)
+..+| ||+++||+.+
T Consensus 179 dt~GA-GD~f~ag~~~ 193 (196)
T cd00287 179 DTTGA-GDAFLAALAA 193 (196)
T ss_pred cCCCc-hHHHHHHHHH
Confidence 34444 9999999843
No 38
>PF12102 DUF3578: Domain of unknown function (DUF3578); InterPro: IPR021961 This presumed domain is functionally uncharacterised. This domain is found in bacteria and archaea. This domain is typically between 177 to 191 amino acids in length. ; PDB: 3SSD_B 3SSE_A 3SSC_B.
Probab=22.54 E-value=42 Score=25.43 Aligned_cols=33 Identities=18% Similarity=0.172 Sum_probs=19.4
Q ss_pred ceeecCCCCCCccccc-ccccCCccccceeeEEEEE
Q psy3095 68 LSWSVGKNFGPARRRP-ANHYQVELISHTCQVYLIV 102 (106)
Q Consensus 68 ~SfsiGGd~~~~~t~p-lr~ynp~l~G~s~~~~~~~ 102 (106)
+.-|. |. ++|.++| +.-|++++.=-.++-|-+|
T Consensus 45 VkgS~-G~-G~wA~iPWIai~d~~it~s~q~G~YiV 78 (188)
T PF12102_consen 45 VKGSF-GQ-GNWAEIPWIAIFDKRITTSTQKGIYIV 78 (188)
T ss_dssp EEEES-ES-SSEESSEEEEEE-T--T-BTTBSEEEE
T ss_pred EEEec-CC-CCccCCeEEEEEcccCCCCccCCEEEE
Confidence 44444 56 8999999 9999998765444433333
No 39
>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related. These enzymes include L-fucolokinase (2.7.1.51 from EC) (gene fucK); gluconokinase (2.7.1.12 from EC) (gene gntK); glycerol kinase (2.7.1.30 from EC) (gene glpK); xylulokinase (2.7.1.17 from EC) (gene xylB); and L-xylulose kinase (2.7.1.53 from EC) (gene lyxK). These enzymes are proteins of from 480 to 520 amino acid residues. This entry represents the N-terminal domain of these proteins. It adopts a ribonuclease H-like fold and is structurally related to the C-terminal domain [, ].; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3G25_D 3GE1_D 2NLX_A 2ITM_A 2ZF5_Y 3L0Q_B 3GG4_B 3I8B_A 3H3O_C 3FLC_X ....
Probab=22.48 E-value=47 Score=24.79 Aligned_cols=18 Identities=22% Similarity=0.344 Sum_probs=15.8
Q ss_pred CCcceEeecchhHHHhcC
Q psy3095 35 GDIDIVGAIGDSITAGNG 52 (106)
Q Consensus 35 ~DI~VIaAlGDSlTAG~g 52 (106)
.++.|+++.||+..|..|
T Consensus 228 ~~~pV~~g~~D~~aa~lG 245 (245)
T PF00370_consen 228 EGTPVIAGGGDQAAAALG 245 (245)
T ss_dssp TTEEEEEEEEHHHHHHHH
T ss_pred CCCEEEEEchHHHHhhcC
Confidence 689999999999988764
No 40
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=21.85 E-value=37 Score=20.26 Aligned_cols=37 Identities=16% Similarity=0.259 Sum_probs=27.8
Q ss_pred eEeecchhHHHhcCCccCCCCCcccccccceeecCCC
Q psy3095 39 IVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKN 75 (106)
Q Consensus 39 VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd 75 (106)
++.++=|++...+|.-..++.-.+.|+.--.|+.||.
T Consensus 20 l~~~it~~l~~~~~~p~~~v~V~i~e~~~~~~~~gG~ 56 (61)
T PRK02220 20 LVKDVTAAVSKNTGAPAEHIHVIINEMSKNHYAVGGK 56 (61)
T ss_pred HHHHHHHHHHHHhCcChhhEEEEEEEeChhHeEECCE
Confidence 3445556777777776666666788999999999996
No 41
>PRK13508 tagatose-6-phosphate kinase; Provisional
Probab=21.10 E-value=37 Score=26.13 Aligned_cols=17 Identities=41% Similarity=0.556 Sum_probs=12.5
Q ss_pred cceEeecchhHHHhcCCc
Q psy3095 37 IDIVGAIGDSITAGNGIV 54 (106)
Q Consensus 37 I~VIaAlGDSlTAG~ga~ 54 (106)
+|.++| |||++||+-+.
T Consensus 246 vDttGA-GDaF~Agfi~~ 262 (309)
T PRK13508 246 VNPVGS-GDSTVAGIASG 262 (309)
T ss_pred cCCcCh-hHHHHHHHHHH
Confidence 455555 99999999543
No 42
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species. Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria. Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs. No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2. There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=20.93 E-value=36 Score=21.61 Aligned_cols=17 Identities=18% Similarity=0.577 Sum_probs=13.5
Q ss_pred CcccccCCCCcceEeec
Q psy3095 27 NNVNQLRPGDIDIVGAI 43 (106)
Q Consensus 27 tsVh~LRP~DI~VIaAl 43 (106)
..+.++.++||-.|+-+
T Consensus 56 ~~v~~~~aGdI~~i~gl 72 (83)
T cd04092 56 QEIPSLSAGNIGVITGL 72 (83)
T ss_pred eECCeeCCCCEEEEECC
Confidence 45688999999888764
No 43
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed
Probab=20.28 E-value=23 Score=28.14 Aligned_cols=28 Identities=21% Similarity=0.332 Sum_probs=19.4
Q ss_pred cCCCCcceEeecchhHHHhcCCccCCCCCcccccccce
Q psy3095 32 LRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLS 69 (106)
Q Consensus 32 LRP~DI~VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~S 69 (106)
+||.||+ +.|-..+..+.|.-+||.|-=
T Consensus 182 VRP~DI~----------~~NtV~S~~IAdArI~Y~G~G 209 (230)
T PRK12700 182 VDPRSIT----------GSNTVSSTRVADARIEYRSKG 209 (230)
T ss_pred ECHHHCC----------CCCeEccceeeeEEEEEccee
Confidence 5777775 556666666777778888753
No 44
>TIGR01231 lacC tagatose-6-phosphate kinase. This enzyme is part of the tagatose-6-phosphate pathway of lactose degradation.
Probab=20.23 E-value=37 Score=26.16 Aligned_cols=16 Identities=44% Similarity=0.626 Sum_probs=12.1
Q ss_pred cceEeecchhHHHhcCC
Q psy3095 37 IDIVGAIGDSITAGNGI 53 (106)
Q Consensus 37 I~VIaAlGDSlTAG~ga 53 (106)
+|-++| |||++||+-+
T Consensus 246 vDttGA-GDaF~agfl~ 261 (309)
T TIGR01231 246 VNPVGS-GDSTVAGITS 261 (309)
T ss_pred CCCcch-HHHHHHHHHH
Confidence 455566 9999999854
Done!