Query         psy3095
Match_columns 106
No_of_seqs    107 out of 182
Neff          4.0 
Searched_HMMs 46136
Date          Sat Aug 17 01:31:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3095.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3095hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01824 Phospholipase_B_like P 100.0   6E-30 1.3E-34  202.3   3.2   69   28-97      1-74  (288)
  2 KOG3670|consensus               99.9 2.8E-26 6.2E-31  191.4   4.7   85    9-95     46-136 (397)
  3 cd01844 SGNH_hydrolase_like_6   95.5  0.0044 9.5E-08   44.2   0.4   52   40-92      2-61  (177)
  4 cd01820 PAF_acetylesterase_lik  95.1  0.0064 1.4E-07   44.9   0.3   36   40-75     35-71  (214)
  5 cd01822 Lysophospholipase_L1_l  94.9   0.011 2.3E-07   41.2   0.8   15   40-54      3-17  (177)
  6 cd01825 SGNH_hydrolase_peri1 S  93.7   0.015 3.2E-07   40.9  -0.5   36   40-75      2-39  (189)
  7 cd01831 Endoglucanase_E_like E  93.1   0.033 7.1E-07   39.4   0.4   16   40-55      2-17  (169)
  8 cd01832 SGNH_hydrolase_like_1   92.4   0.054 1.2E-06   38.1   0.8   15   40-54      2-16  (185)
  9 cd01835 SGNH_hydrolase_like_3   92.1   0.054 1.2E-06   38.7   0.5   17   39-55      3-19  (193)
 10 cd01839 SGNH_arylesterase_like  91.8   0.062 1.3E-06   39.0   0.5   16   40-55      2-17  (208)
 11 cd04506 SGNH_hydrolase_YpmR_li  91.5   0.078 1.7E-06   38.2   0.8   16   40-55      2-17  (204)
 12 cd01823 SEST_like SEST_like. A  91.4    0.09 1.9E-06   39.3   1.1   16   40-55      3-18  (259)
 13 cd01830 XynE_like SGNH_hydrola  91.4   0.073 1.6E-06   38.9   0.6   16   40-55      2-17  (204)
 14 cd01838 Isoamyl_acetate_hydrol  91.2   0.072 1.6E-06   37.3   0.4   16   40-55      2-17  (199)
 15 cd01836 FeeA_FeeB_like SGNH_hy  90.7   0.086 1.9E-06   37.5   0.4   16   40-55      5-20  (191)
 16 cd01827 sialate_O-acetylestera  90.3     0.1 2.2E-06   36.9   0.4   16   40-55      3-18  (188)
 17 cd01829 SGNH_hydrolase_peri2 S  89.9   0.062 1.3E-06   38.4  -0.9   14   40-53      2-15  (200)
 18 cd01841 NnaC_like NnaC (CMP-Ne  89.2     0.2 4.4E-06   35.0   1.3   17   39-55      2-18  (174)
 19 cd04501 SGNH_hydrolase_like_4   88.1    0.24 5.2E-06   35.0   1.1   16   40-55      3-18  (183)
 20 cd01834 SGNH_hydrolase_like_2   87.5    0.28   6E-06   34.1   1.1   14   40-53      4-17  (191)
 21 cd00229 SGNH_hydrolase SGNH_hy  86.9    0.36 7.9E-06   31.5   1.3   18   40-57      1-18  (187)
 22 cd01821 Rhamnogalacturan_acety  85.4    0.29 6.4E-06   35.2   0.3   15   40-54      3-17  (198)
 23 PRK10528 multifunctional acyl-  85.1    0.39 8.4E-06   35.1   0.8   17   38-54     11-27  (191)
 24 cd01833 XynB_like SGNH_hydrola  85.1    0.33 7.1E-06   33.4   0.4   11   40-50      3-13  (157)
 25 PF00657 Lipase_GDSL:  GDSL-lik  81.8    0.72 1.6E-05   32.6   1.1   11   40-50      1-11  (234)
 26 cd01840 SGNH_hydrolase_yrhL_li  81.2    0.58 1.3E-05   32.8   0.4   13   40-52      2-14  (150)
 27 PF13472 Lipase_GDSL_2:  GDSL-l  80.4    0.89 1.9E-05   30.3   1.1   15   41-55      1-15  (179)
 28 cd01828 sialate_O-acetylestera  75.3     1.2 2.7E-05   31.0   0.7   15   40-54      2-16  (169)
 29 COG2755 TesA Lysophospholipase  69.8     2.4 5.3E-05   30.7   1.1   18   37-54      8-25  (216)
 30 cd01826 acyloxyacyl_hydrolase_  53.9     4.6  0.0001   33.6   0.2   36   40-75     14-65  (305)
 31 KOG3189|consensus               33.7      20 0.00043   29.3   0.9   29   67-98    174-210 (252)
 32 cd03699 lepA_II lepA_II: This   29.4      26 0.00055   22.7   0.7   16   27-42     55-70  (86)
 33 PRK01964 4-oxalocrotonate taut  28.6     8.5 0.00018   23.6  -1.6   37   39-75     20-56  (64)
 34 cd00491 4Oxalocrotonate_Tautom  27.9      31 0.00067   20.2   0.9   34   42-75     22-55  (58)
 35 PF00983 Tymo_coat:  Tymovirus   26.3      46 0.00099   25.8   1.7   35   60-94    100-138 (172)
 36 TIGR01312 XylB D-xylulose kina  23.7      65  0.0014   26.5   2.3   23   34-56    225-247 (481)
 37 cd00287 ribokinase_pfkB_like r  23.7      29 0.00064   24.1   0.2   15   38-53    179-193 (196)
 38 PF12102 DUF3578:  Domain of un  22.5      42 0.00091   25.4   0.9   33   68-102    45-78  (188)
 39 PF00370 FGGY_N:  FGGY family o  22.5      47   0.001   24.8   1.2   18   35-52    228-245 (245)
 40 PRK02220 4-oxalocrotonate taut  21.8      37 0.00079   20.3   0.4   37   39-75     20-56  (61)
 41 PRK13508 tagatose-6-phosphate   21.1      37 0.00081   26.1   0.4   17   37-54    246-262 (309)
 42 cd04092 mtEFG2_II_like mtEFG2_  20.9      36 0.00079   21.6   0.2   17   27-43     56-72  (83)
 43 PRK12700 flgH flagellar basal   20.3      23 0.00051   28.1  -0.9   28   32-69    182-209 (230)
 44 TIGR01231 lacC tagatose-6-phos  20.2      37  0.0008   26.2   0.2   16   37-53    246-261 (309)

No 1  
>cd01824 Phospholipase_B_like Phospholipase-B_like. This subgroup of the SGNH-family of lipolytic enzymes may have both esterase and phospholipase-A/lysophospholipase activity.  It's members may be involved in the conversion of phosphatidylcholine to fatty acids and glycerophosphocholine, perhaps in the context of dietary lipid uptake. Members may be membrane proteins. The tertiary fold of the SGNH-hydrolases is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; Its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases.
Probab=99.96  E-value=6e-30  Score=202.31  Aligned_cols=69  Identities=42%  Similarity=0.729  Sum_probs=65.7

Q ss_pred             cccccCCCCcceEeecchhHHHhcCCccCCCCCcccccccceeecCCCCCCcccc---c--ccccCCccccceee
Q psy3095          28 NVNQLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARRR---P--ANHYQVELISHTCQ   97 (106)
Q Consensus        28 sVh~LRP~DI~VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd~~~~~t~---p--lr~ynp~l~G~s~~   97 (106)
                      |||+|||+|||||||||||+|||+||++.+.+|+..||||+||++||| .+|+++   |  ||+|||+|+|+|+.
T Consensus         1 sv~~lrp~DI~viaA~GDSltag~ga~~~~~~~~~~e~rG~s~~~Gg~-~~~~~~~Tlpnil~~fnp~l~G~s~~   74 (288)
T cd01824           1 SVHRLRPGDIKVIAALGDSLTAGNGAGSANNLDLLTEYRGLSWSIGGD-STLRGLTTLPNILREFNPSLYGYSVG   74 (288)
T ss_pred             CccccccccCeEEeeccccccccCCCCCCCccccccccCCceEecCCc-ccccccccHHHHHHHhCCCcccccCC
Confidence            799999999999999999999999999999999999999999999999 998865   5  99999999999986


No 2  
>KOG3670|consensus
Probab=99.92  E-value=2.8e-26  Score=191.43  Aligned_cols=85  Identities=34%  Similarity=0.527  Sum_probs=74.8

Q ss_pred             CCCCccCCCCCC-CCCCCCCcccccCCCCcceEeecchhHHHhcCCccCCCCCcccccccceeecCCCCCCccc---cc-
Q psy3095           9 YEGPFPCDLSQA-RSPLPPNNVNQLRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKNFGPARR---RP-   83 (106)
Q Consensus         9 ~~~~f~C~~~~~-~s~~~PtsVh~LRP~DI~VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd~~~~~t---~p-   83 (106)
                      +...+.|+.+.. |++++|||||+|||+||+||+|||||||+|+||.+.+ +++..||||+||++||| .+|++   +| 
T Consensus        46 ~~~~~~~~~s~~~p~~~~ptsv~~lrP~dI~vIgAmGDSLt~G~ga~~~~-~~~~~e~rG~sF~~Ggd-~~ld~~vTipN  123 (397)
T KOG3670|consen   46 GLPNDQCDFSCPQPSKKTPTSVHSLRPEDIKVIGAMGDSLTNGAGAWPGN-LAVILEFRGLSFQIGGD-ANLDEHVTIPN  123 (397)
T ss_pred             cCccccccccCCCccCCCCCcccccCcccceeeeeccchhhccCCCCCcc-hhhheecCcceeccCCc-hhhhcceeehh
Confidence            445555655533 9999999999999999999999999999999999988 88999999999999999 88875   56 


Q ss_pred             -ccccCCccccce
Q psy3095          84 -ANHYQVELISHT   95 (106)
Q Consensus        84 -lr~ynp~l~G~s   95 (106)
                       ||+|||+|.|.|
T Consensus       124 Ilr~f~p~l~g~s  136 (397)
T KOG3670|consen  124 ILRKFNPKLYGKS  136 (397)
T ss_pred             HHhhhCccccccc
Confidence             999999999744


No 3  
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=95.48  E-value=0.0044  Score=44.24  Aligned_cols=52  Identities=12%  Similarity=0.032  Sum_probs=30.6

Q ss_pred             EeecchhHHHhcCCccC--CCCCccc---ccccceeecCCCCCCccccc---ccccCCccc
Q psy3095          40 VGAIGDSITAGNGIVAT--NPSQVNT---ENRGLSWSVGKNFGPARRRP---ANHYQVELI   92 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~~--~~~~~~~---EyRG~SfsiGGd~~~~~t~p---lr~ynp~l~   92 (106)
                      |.++|||||.|.|....  ++...+.   .+.=....+||+ ..+....   +..++|+++
T Consensus         2 iv~~GDSit~G~g~~~~~~~~~~~~~~~~~~~v~N~g~~G~-~~~~~~~~~~~~~~~pd~v   61 (177)
T cd01844           2 WVFYGTSISQGACASRPGMAWTAILARRLGLEVINLGFSGN-ARLEPEVAELLRDVPADLY   61 (177)
T ss_pred             EEEEeCchhcCcCCCCCCCcHHHHHHHHhCCCeEEeeeccc-ccchHHHHHHHHhcCCCEE
Confidence            67899999999988532  2222221   233445667788 6554322   455666643


No 4  
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues.  In addition,  PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=95.14  E-value=0.0064  Score=44.87  Aligned_cols=36  Identities=25%  Similarity=0.294  Sum_probs=24.4

Q ss_pred             EeecchhHHHhcCCcc-CCCCCcccccccceeecCCC
Q psy3095          40 VGAIGDSITAGNGIVA-TNPSQVNTENRGLSWSVGKN   75 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~-~~~~~~~~EyRG~SfsiGGd   75 (106)
                      |+++|||+|+|++... ..+.+.+.+++=+.+.++|+
T Consensus        35 iv~lGDSit~g~~~~~~~~~~~~~~~~~v~N~Gi~G~   71 (214)
T cd01820          35 VVFIGDSITQNWEFTGLEVWRELYAPLHALNFGIGGD   71 (214)
T ss_pred             EEEECchHhhhhcccchHHHHHHcCcCCeEeeeeccc
Confidence            7888999999998763 11122334555566778888


No 5  
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=94.88  E-value=0.011  Score=41.17  Aligned_cols=15  Identities=53%  Similarity=0.842  Sum_probs=13.2

Q ss_pred             EeecchhHHHhcCCc
Q psy3095          40 VGAIGDSITAGNGIV   54 (106)
Q Consensus        40 IaAlGDSlTAG~ga~   54 (106)
                      |.++|||+|+|.++.
T Consensus         3 i~~~GDSit~G~~~~   17 (177)
T cd01822           3 ILALGDSLTAGYGLP   17 (177)
T ss_pred             EEEEccccccCcCCC
Confidence            788999999999874


No 6  
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=93.67  E-value=0.015  Score=40.88  Aligned_cols=36  Identities=22%  Similarity=0.230  Sum_probs=20.9

Q ss_pred             EeecchhHHHhcCCccC--CCCCcccccccceeecCCC
Q psy3095          40 VGAIGDSITAGNGIVAT--NPSQVNTENRGLSWSVGKN   75 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~~--~~~~~~~EyRG~SfsiGGd   75 (106)
                      |+++|||+|+|.+.-..  ..+++...++|.+-.+..+
T Consensus         2 iv~~GDS~t~g~~~~~~l~~~l~~~v~N~g~~G~t~~~   39 (189)
T cd01825           2 IAQLGDSHIAGDFFTDVLRGLLGVIYDNLGVNGASASL   39 (189)
T ss_pred             eeEecCccccccchhhHHHhhhceEEecCccCchhhhh
Confidence            67889999998643221  1223445566665554444


No 7  
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=93.05  E-value=0.033  Score=39.44  Aligned_cols=16  Identities=50%  Similarity=0.831  Sum_probs=14.0

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |..+|||+|+|+|...
T Consensus         2 i~~iGDSit~G~~~~~   17 (169)
T cd01831           2 IEFIGDSITCGYGVTG   17 (169)
T ss_pred             EEEEeccccccCccCC
Confidence            6789999999999854


No 8  
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=92.39  E-value=0.054  Score=38.11  Aligned_cols=15  Identities=53%  Similarity=0.583  Sum_probs=13.6

Q ss_pred             EeecchhHHHhcCCc
Q psy3095          40 VGAIGDSITAGNGIV   54 (106)
Q Consensus        40 IaAlGDSlTAG~ga~   54 (106)
                      |+++|||+|+|+++.
T Consensus         2 i~~~GDSit~G~~~~   16 (185)
T cd01832           2 YVALGDSITEGVGDP   16 (185)
T ss_pred             eeEecchhhcccCCC
Confidence            789999999999984


No 9  
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=92.05  E-value=0.054  Score=38.68  Aligned_cols=17  Identities=29%  Similarity=0.319  Sum_probs=14.0

Q ss_pred             eEeecchhHHHhcCCcc
Q psy3095          39 IVGAIGDSITAGNGIVA   55 (106)
Q Consensus        39 VIaAlGDSlTAG~ga~~   55 (106)
                      -|+++|||+|+|+|...
T Consensus         3 ~i~~lGDSit~G~~~~~   19 (193)
T cd01835           3 RLIVVGDSLVYGWGDPE   19 (193)
T ss_pred             EEEEEcCccccCCCCCC
Confidence            37889999999998753


No 10 
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=91.76  E-value=0.062  Score=39.04  Aligned_cols=16  Identities=31%  Similarity=0.090  Sum_probs=13.5

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |+++|||+|+|++...
T Consensus         2 I~~~GDSiT~G~~~~~   17 (208)
T cd01839           2 ILCFGDSNTWGIIPDT   17 (208)
T ss_pred             EEEEecCcccCCCCCC
Confidence            7889999999997643


No 11 
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=91.50  E-value=0.078  Score=38.20  Aligned_cols=16  Identities=44%  Similarity=0.619  Sum_probs=13.8

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |+++|||+|+|.|...
T Consensus         2 i~~~GDSit~G~g~~~   17 (204)
T cd04506           2 IVALGDSLTEGVGDET   17 (204)
T ss_pred             EeEEeccccCccCCCC
Confidence            6899999999998664


No 12 
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=91.40  E-value=0.09  Score=39.35  Aligned_cols=16  Identities=44%  Similarity=0.524  Sum_probs=14.1

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      +.|+|||+++|.|+..
T Consensus         3 ~v~iGDS~~~G~g~~~   18 (259)
T cd01823           3 YVALGDSYAAGPGAGP   18 (259)
T ss_pred             EEEecchhhcCCCCCc
Confidence            6899999999999754


No 13 
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=91.40  E-value=0.073  Score=38.87  Aligned_cols=16  Identities=56%  Similarity=0.771  Sum_probs=13.8

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |.++|||||.|++...
T Consensus         2 iv~~GDSiT~G~~~~~   17 (204)
T cd01830           2 VVALGDSITDGRGSTP   17 (204)
T ss_pred             EEEEecccccCCCCCC
Confidence            7899999999998754


No 14 
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash.  The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=91.24  E-value=0.072  Score=37.32  Aligned_cols=16  Identities=31%  Similarity=0.108  Sum_probs=13.5

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |+++|||+|+|.+...
T Consensus         2 i~~~GDSit~g~~~~~   17 (199)
T cd01838           2 IVLFGDSITQFSFDQG   17 (199)
T ss_pred             EEEecCcccccccCCC
Confidence            7899999999987643


No 15 
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=90.71  E-value=0.086  Score=37.49  Aligned_cols=16  Identities=38%  Similarity=0.605  Sum_probs=13.5

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |.++|||+|.|+|+..
T Consensus         5 i~~~GDSit~G~g~~~   20 (191)
T cd01836           5 LLVLGDSTAAGVGVET   20 (191)
T ss_pred             EEEEeccccccccccc
Confidence            6778999999998754


No 16 
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=90.30  E-value=0.1  Score=36.91  Aligned_cols=16  Identities=50%  Similarity=0.856  Sum_probs=13.6

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |+++|||+|+|++...
T Consensus         3 i~~~GDSit~G~~~~~   18 (188)
T cd01827           3 VACVGNSITEGAGLRA   18 (188)
T ss_pred             EEEEecccccccCCCC
Confidence            6889999999998753


No 17 
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=89.88  E-value=0.062  Score=38.37  Aligned_cols=14  Identities=43%  Similarity=0.508  Sum_probs=11.7

Q ss_pred             EeecchhHHHhcCC
Q psy3095          40 VGAIGDSITAGNGI   53 (106)
Q Consensus        40 IaAlGDSlTAG~ga   53 (106)
                      |+++|||+|+|++.
T Consensus         2 il~iGDS~~~g~~~   15 (200)
T cd01829           2 VLVIGDSLAQGLAP   15 (200)
T ss_pred             EEEEechHHHHHHH
Confidence            66889999999863


No 18 
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=89.17  E-value=0.2  Score=35.04  Aligned_cols=17  Identities=29%  Similarity=0.313  Sum_probs=14.1

Q ss_pred             eEeecchhHHHhcCCcc
Q psy3095          39 IVGAIGDSITAGNGIVA   55 (106)
Q Consensus        39 VIaAlGDSlTAG~ga~~   55 (106)
                      -|..+|||+|+|++...
T Consensus         2 ~iv~~GdS~t~~~~~~~   18 (174)
T cd01841           2 NIVFIGDSLFEGWPLYE   18 (174)
T ss_pred             CEEEEcchhhhcCchhh
Confidence            47899999999998643


No 19 
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=88.14  E-value=0.24  Score=34.96  Aligned_cols=16  Identities=44%  Similarity=0.520  Sum_probs=13.7

Q ss_pred             EeecchhHHHhcCCcc
Q psy3095          40 VGAIGDSITAGNGIVA   55 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~   55 (106)
                      |+++|||+|.|++...
T Consensus         3 i~~~GDSi~~g~~~~~   18 (183)
T cd04501           3 VVCLGDSITYGYPVGP   18 (183)
T ss_pred             EEEEccccccCcCCCC
Confidence            7889999999998754


No 20 
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=87.53  E-value=0.28  Score=34.12  Aligned_cols=14  Identities=43%  Similarity=0.572  Sum_probs=12.0

Q ss_pred             EeecchhHHHhcCC
Q psy3095          40 VGAIGDSITAGNGI   53 (106)
Q Consensus        40 IaAlGDSlTAG~ga   53 (106)
                      |+++|||+|.|.+.
T Consensus         4 v~~~GDSit~g~~~   17 (191)
T cd01834           4 IVFIGNSITDRGGY   17 (191)
T ss_pred             EEEeCCChhhcccc
Confidence            78999999998843


No 21 
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=86.93  E-value=0.36  Score=31.49  Aligned_cols=18  Identities=50%  Similarity=0.669  Sum_probs=15.1

Q ss_pred             EeecchhHHHhcCCccCC
Q psy3095          40 VGAIGDSITAGNGIVATN   57 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~~~   57 (106)
                      |+++|||+|.|.+.....
T Consensus         1 i~~~GDS~~~g~~~~~~~   18 (187)
T cd00229           1 ILVIGDSITAGYGASSGS   18 (187)
T ss_pred             CeeeccccccccCCCCCC
Confidence            678999999999877653


No 22 
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=85.39  E-value=0.29  Score=35.21  Aligned_cols=15  Identities=27%  Similarity=0.093  Sum_probs=13.1

Q ss_pred             EeecchhHHHhcCCc
Q psy3095          40 VGAIGDSITAGNGIV   54 (106)
Q Consensus        40 IaAlGDSlTAG~ga~   54 (106)
                      |.++|||+|+|++..
T Consensus         3 i~~~GDS~t~G~~~~   17 (198)
T cd01821           3 IFLAGDSTVADYDPG   17 (198)
T ss_pred             EEEEecCCcccCCCC
Confidence            678899999999874


No 23 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=85.12  E-value=0.39  Score=35.13  Aligned_cols=17  Identities=35%  Similarity=0.561  Sum_probs=14.1

Q ss_pred             ceEeecchhHHHhcCCc
Q psy3095          38 DIVGAIGDSITAGNGIV   54 (106)
Q Consensus        38 ~VIaAlGDSlTAG~ga~   54 (106)
                      +-|..+|||+|+|++..
T Consensus        11 ~~iv~~GDSit~G~~~~   27 (191)
T PRK10528         11 DTLLILGDSLSAGYRMP   27 (191)
T ss_pred             CEEEEEeCchhhcCCCC
Confidence            46888999999999763


No 24 
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=85.09  E-value=0.33  Score=33.41  Aligned_cols=11  Identities=55%  Similarity=0.779  Sum_probs=9.9

Q ss_pred             EeecchhHHHh
Q psy3095          40 VGAIGDSITAG   50 (106)
Q Consensus        40 IaAlGDSlTAG   50 (106)
                      |.++|||+|+|
T Consensus         3 ~~~~Gds~~~g   13 (157)
T cd01833           3 IMPLGDSITWG   13 (157)
T ss_pred             eeecCCceeec
Confidence            57899999999


No 25 
>PF00657 Lipase_GDSL:  GDSL-like Lipase/Acylhydrolase;  InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=81.78  E-value=0.72  Score=32.55  Aligned_cols=11  Identities=45%  Similarity=0.788  Sum_probs=10.3

Q ss_pred             EeecchhHHHh
Q psy3095          40 VGAIGDSITAG   50 (106)
Q Consensus        40 IaAlGDSlTAG   50 (106)
                      |.++|||+|.|
T Consensus         1 i~~fGDS~td~   11 (234)
T PF00657_consen    1 IVVFGDSLTDG   11 (234)
T ss_dssp             EEEEESHHHHT
T ss_pred             CEEEeehhccc
Confidence            68999999999


No 26 
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism.
Probab=81.19  E-value=0.58  Score=32.83  Aligned_cols=13  Identities=38%  Similarity=0.631  Sum_probs=10.6

Q ss_pred             EeecchhHHHhcC
Q psy3095          40 VGAIGDSITAGNG   52 (106)
Q Consensus        40 IaAlGDSlTAG~g   52 (106)
                      |.++|||+|+|.+
T Consensus         2 v~~~GDSv~~~~~   14 (150)
T cd01840           2 ITAIGDSVMLDSS   14 (150)
T ss_pred             eeEEeehHHHchH
Confidence            4567999999974


No 27 
>PF13472 Lipase_GDSL_2:  GDSL-like Lipase/Acylhydrolase family; PDB: 1ES9_A 1WAB_A 3DT9_A 1BWQ_A 1FXW_A 3DT6_A 1BWR_A 3DT8_A 1BWP_A 2WAA_A ....
Probab=80.41  E-value=0.89  Score=30.29  Aligned_cols=15  Identities=53%  Similarity=0.634  Sum_probs=12.3

Q ss_pred             eecchhHHHhcCCcc
Q psy3095          41 GAIGDSITAGNGIVA   55 (106)
Q Consensus        41 aAlGDSlTAG~ga~~   55 (106)
                      ..+|||+|+|.+...
T Consensus         1 v~~GDS~t~g~~~~~   15 (179)
T PF13472_consen    1 VFLGDSITAGYGAPN   15 (179)
T ss_dssp             EEEESHHHHTTTTSS
T ss_pred             CEEccccccCCCCCC
Confidence            368999999998753


No 28 
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=75.31  E-value=1.2  Score=30.96  Aligned_cols=15  Identities=33%  Similarity=0.479  Sum_probs=12.4

Q ss_pred             EeecchhHHHhcCCc
Q psy3095          40 VGAIGDSITAGNGIV   54 (106)
Q Consensus        40 IaAlGDSlTAG~ga~   54 (106)
                      |..+|||+|.|.+..
T Consensus         2 v~~~GdSi~~~~~~~   16 (169)
T cd01828           2 LVFLGDSLTEGGPWA   16 (169)
T ss_pred             EEEecchhhccCcHH
Confidence            678899999998744


No 29 
>COG2755 TesA Lysophospholipase L1 and related esterases [Amino acid transport and metabolism]
Probab=69.80  E-value=2.4  Score=30.67  Aligned_cols=18  Identities=50%  Similarity=0.619  Sum_probs=15.9

Q ss_pred             cceEeecchhHHHhcCCc
Q psy3095          37 IDIVGAIGDSITAGNGIV   54 (106)
Q Consensus        37 I~VIaAlGDSlTAG~ga~   54 (106)
                      ++.|.++|||+|.|++..
T Consensus         8 ~~~i~~~GDSlt~g~~~~   25 (216)
T COG2755           8 AGTVLALGDSLTAGYGPA   25 (216)
T ss_pred             hceEEEeccchhccccCC
Confidence            337999999999999988


No 30 
>cd01826 acyloxyacyl_hydrolase_like Acyloxyacyl-hydrolase like subfamily of the SGNH-hydrolase family. Acyloxyacyl-hydrolase is a leukocyte-secreted enzyme that deacetylates bacterial lipopolysaccharides.
Probab=53.91  E-value=4.6  Score=33.56  Aligned_cols=36  Identities=25%  Similarity=0.042  Sum_probs=26.0

Q ss_pred             EeecchhHHHhcCCccC----------C------CCCcccccccceeecCCC
Q psy3095          40 VGAIGDSITAGNGIVAT----------N------PSQVNTENRGLSWSVGKN   75 (106)
Q Consensus        40 IaAlGDSlTAG~ga~~~----------~------~~~~~~EyRG~SfsiGGd   75 (106)
                      |..+|||.+|.|.+-+.          .      ++..-.++.-+||++|=.
T Consensus        14 ~i~~gds~~ahf~ip~~~~~~~~~~~~~~~~~~~~~~~e~d~p~~s~~TG~~   65 (305)
T cd01826          14 VILLGDSAGAHFHIPPEWLTVLLLSSEGFANIITIIANEFDWPMLSGATGFA   65 (305)
T ss_pred             EEEecccccccccCChHHcCHHhcChhhhcchHHHhccccCCccccccccCC
Confidence            56899999999987653          1      112224788999999973


No 31 
>KOG3189|consensus
Probab=33.67  E-value=20  Score=29.27  Aligned_cols=29  Identities=21%  Similarity=0.312  Sum_probs=20.9

Q ss_pred             cceeecCCCCCCccccc--------ccccCCccccceeeE
Q psy3095          67 GLSWSVGKNFGPARRRP--------ANHYQVELISHTCQV   98 (106)
Q Consensus        67 G~SfsiGGd~~~~~t~p--------lr~ynp~l~G~s~~~   98 (106)
                      |+.|||||+ =...-+|        |+|.-++  |+.+--
T Consensus       174 gLtFSIGGQ-ISfDvFP~GWDKtyCLqhle~d--gf~~Ih  210 (252)
T KOG3189|consen  174 GLTFSIGGQ-ISFDVFPKGWDKTYCLQHLEKD--GFDTIH  210 (252)
T ss_pred             CeeEEECCe-EEEeecCCCcchhHHHHHhhhc--CCceEE
Confidence            899999999 5554455        8888776  665543


No 32 
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well.  LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=29.39  E-value=26  Score=22.68  Aligned_cols=16  Identities=19%  Similarity=0.389  Sum_probs=12.7

Q ss_pred             CcccccCCCCcceEee
Q psy3095          27 NNVNQLRPGDIDIVGA   42 (106)
Q Consensus        27 tsVh~LRP~DI~VIaA   42 (106)
                      ..+.++.++||-+|.+
T Consensus        55 ~~~~~~~aGdI~~v~~   70 (86)
T cd03699          55 TPTDELSAGQVGYIIA   70 (86)
T ss_pred             cCCceECCCCEEEEEc
Confidence            5668899999988753


No 33 
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=28.61  E-value=8.5  Score=23.61  Aligned_cols=37  Identities=14%  Similarity=0.249  Sum_probs=29.7

Q ss_pred             eEeecchhHHHhcCCccCCCCCcccccccceeecCCC
Q psy3095          39 IVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKN   75 (106)
Q Consensus        39 VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd   75 (106)
                      ++.++=+++...+|.-...+.-.+.|+.--.|++||.
T Consensus        20 l~~~it~~l~~~lg~p~~~v~V~i~e~~~~~w~~gg~   56 (64)
T PRK01964         20 LIREVTEAISATLDVPKERVRVIVNEVPSSHWGVAGV   56 (64)
T ss_pred             HHHHHHHHHHHHhCcChhhEEEEEEEcChHHeeECCE
Confidence            4556667777788887777777888999999999996


No 34 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=27.91  E-value=31  Score=20.19  Aligned_cols=34  Identities=12%  Similarity=0.239  Sum_probs=25.3

Q ss_pred             ecchhHHHhcCCccCCCCCcccccccceeecCCC
Q psy3095          42 AIGDSITAGNGIVATNPSQVNTENRGLSWSVGKN   75 (106)
Q Consensus        42 AlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd   75 (106)
                      ++=|.+..-+|....++.-.+.|++--.|++||.
T Consensus        22 ~i~~~l~~~~g~~~~~v~V~i~e~~~~~~~~gg~   55 (58)
T cd00491          22 RVTEAVSEILGAPEATIVVIIDEMPKENWGIGGE   55 (58)
T ss_pred             HHHHHHHHHhCcCcccEEEEEEEeCchhceECCE
Confidence            3445666667776666666788999999999996


No 35 
>PF00983 Tymo_coat:  Tymovirus coat protein;  InterPro: IPR000574 This signature is found in coat proteins from the related tymoviruses. The coat protein is also known as the virion protein. The virus coat is composed of 180 copies of the coat protein arranged in an icosahedral shell.; GO: 0005198 structural molecule activity, 0019028 viral capsid; PDB: 2FZ1_B 2FZ2_B 1DDL_B 1E57_C 1QJZ_C 2WWS_A 2XPJ_B 1AUY_C 1W39_A.
Probab=26.35  E-value=46  Score=25.79  Aligned_cols=35  Identities=11%  Similarity=0.162  Sum_probs=25.0

Q ss_pred             CcccccccceeecCCCCCC--ccccc--ccccCCccccc
Q psy3095          60 QVNTENRGLSWSVGKNFGP--ARRRP--ANHYQVELISH   94 (106)
Q Consensus        60 ~~~~EyRG~SfsiGGd~~~--~~t~p--lr~ynp~l~G~   94 (106)
                      +++.=|=|..|++||-+..  -.++|  |+..||-+|..
T Consensus       100 ~iL~~yGGq~ftiGG~i~~~~~i~vP~~L~~vNp~IKdS  138 (172)
T PF00983_consen  100 QILSVYGGQRFTIGGPINSSSPIIVPADLSSVNPMIKDS  138 (172)
T ss_dssp             GGGGBTTEEEEEESSSTTTTSEEEEE--TTTS-SEEESS
T ss_pred             ceeeccCccEEEcCceeecCCcEEecCchhhcCCeEecc
Confidence            4567899999999997222  23456  99999988853


No 36 
>TIGR01312 XylB D-xylulose kinase. D-xylulose kinase (XylB) generally is found with xylose isomerase (XylA) and acts in xylose utilization.
Probab=23.71  E-value=65  Score=26.48  Aligned_cols=23  Identities=13%  Similarity=0.242  Sum_probs=19.9

Q ss_pred             CCCcceEeecchhHHHhcCCccC
Q psy3095          34 PGDIDIVGAIGDSITAGNGIVAT   56 (106)
Q Consensus        34 P~DI~VIaAlGDSlTAG~ga~~~   56 (106)
                      |.++.|+++.||...|..|+...
T Consensus       225 ~~g~pV~~g~~D~~aa~~g~g~~  247 (481)
T TIGR01312       225 SAGVPVAAGGGDNAAGAIGTGTV  247 (481)
T ss_pred             CCCCeEEecchHHHHHhhCCCcc
Confidence            37999999999999998888753


No 37 
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase, 2-dehydro-3-deoxygluconokinase, 1-phosphofructokinase, the minor 6-phosphofructokinase (PfkB), inosine-guanosine kinase, and adenosine kinase. Even though there is a high degree of structural conservation within this superfamily, their multimerization level varies widely, monomeric  (e.g. adenosine kinase), dimeric (e.g. ribokinase), and trimeric (e.g THZ kinase).
Probab=23.68  E-value=29  Score=24.12  Aligned_cols=15  Identities=40%  Similarity=0.552  Sum_probs=10.8

Q ss_pred             ceEeecchhHHHhcCC
Q psy3095          38 DIVGAIGDSITAGNGI   53 (106)
Q Consensus        38 ~VIaAlGDSlTAG~ga   53 (106)
                      +..+| ||+++||+.+
T Consensus       179 dt~GA-GD~f~ag~~~  193 (196)
T cd00287         179 DTTGA-GDAFLAALAA  193 (196)
T ss_pred             cCCCc-hHHHHHHHHH
Confidence            34444 9999999843


No 38 
>PF12102 DUF3578:  Domain of unknown function (DUF3578);  InterPro: IPR021961  This presumed domain is functionally uncharacterised. This domain is found in bacteria and archaea. This domain is typically between 177 to 191 amino acids in length. ; PDB: 3SSD_B 3SSE_A 3SSC_B.
Probab=22.54  E-value=42  Score=25.43  Aligned_cols=33  Identities=18%  Similarity=0.172  Sum_probs=19.4

Q ss_pred             ceeecCCCCCCccccc-ccccCCccccceeeEEEEE
Q psy3095          68 LSWSVGKNFGPARRRP-ANHYQVELISHTCQVYLIV  102 (106)
Q Consensus        68 ~SfsiGGd~~~~~t~p-lr~ynp~l~G~s~~~~~~~  102 (106)
                      +.-|. |. ++|.++| +.-|++++.=-.++-|-+|
T Consensus        45 VkgS~-G~-G~wA~iPWIai~d~~it~s~q~G~YiV   78 (188)
T PF12102_consen   45 VKGSF-GQ-GNWAEIPWIAIFDKRITTSTQKGIYIV   78 (188)
T ss_dssp             EEEES-ES-SSEESSEEEEEE-T--T-BTTBSEEEE
T ss_pred             EEEec-CC-CCccCCeEEEEEcccCCCCccCCEEEE
Confidence            44444 56 8999999 9999998765444433333


No 39 
>PF00370 FGGY_N:  FGGY family of carbohydrate kinases, N-terminal domain;  InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related. These enzymes include L-fucolokinase (2.7.1.51 from EC) (gene fucK); gluconokinase (2.7.1.12 from EC) (gene gntK); glycerol kinase (2.7.1.30 from EC) (gene glpK); xylulokinase (2.7.1.17 from EC) (gene xylB); and L-xylulose kinase (2.7.1.53 from EC) (gene lyxK). These enzymes are proteins of from 480 to 520 amino acid residues. This entry represents the N-terminal domain of these proteins. It adopts a ribonuclease H-like fold and is structurally related to the C-terminal domain [, ].; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3G25_D 3GE1_D 2NLX_A 2ITM_A 2ZF5_Y 3L0Q_B 3GG4_B 3I8B_A 3H3O_C 3FLC_X ....
Probab=22.48  E-value=47  Score=24.79  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=15.8

Q ss_pred             CCcceEeecchhHHHhcC
Q psy3095          35 GDIDIVGAIGDSITAGNG   52 (106)
Q Consensus        35 ~DI~VIaAlGDSlTAG~g   52 (106)
                      .++.|+++.||+..|..|
T Consensus       228 ~~~pV~~g~~D~~aa~lG  245 (245)
T PF00370_consen  228 EGTPVIAGGGDQAAAALG  245 (245)
T ss_dssp             TTEEEEEEEEHHHHHHHH
T ss_pred             CCCEEEEEchHHHHhhcC
Confidence            689999999999988764


No 40 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=21.85  E-value=37  Score=20.26  Aligned_cols=37  Identities=16%  Similarity=0.259  Sum_probs=27.8

Q ss_pred             eEeecchhHHHhcCCccCCCCCcccccccceeecCCC
Q psy3095          39 IVGAIGDSITAGNGIVATNPSQVNTENRGLSWSVGKN   75 (106)
Q Consensus        39 VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~SfsiGGd   75 (106)
                      ++.++=|++...+|.-..++.-.+.|+.--.|+.||.
T Consensus        20 l~~~it~~l~~~~~~p~~~v~V~i~e~~~~~~~~gG~   56 (61)
T PRK02220         20 LVKDVTAAVSKNTGAPAEHIHVIINEMSKNHYAVGGK   56 (61)
T ss_pred             HHHHHHHHHHHHhCcChhhEEEEEEEeChhHeEECCE
Confidence            3445556777777776666666788999999999996


No 41 
>PRK13508 tagatose-6-phosphate kinase; Provisional
Probab=21.10  E-value=37  Score=26.13  Aligned_cols=17  Identities=41%  Similarity=0.556  Sum_probs=12.5

Q ss_pred             cceEeecchhHHHhcCCc
Q psy3095          37 IDIVGAIGDSITAGNGIV   54 (106)
Q Consensus        37 I~VIaAlGDSlTAG~ga~   54 (106)
                      +|.++| |||++||+-+.
T Consensus       246 vDttGA-GDaF~Agfi~~  262 (309)
T PRK13508        246 VNPVGS-GDSTVAGIASG  262 (309)
T ss_pred             cCCcCh-hHHHHHHHHHH
Confidence            455555 99999999543


No 42 
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2.  There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=20.93  E-value=36  Score=21.61  Aligned_cols=17  Identities=18%  Similarity=0.577  Sum_probs=13.5

Q ss_pred             CcccccCCCCcceEeec
Q psy3095          27 NNVNQLRPGDIDIVGAI   43 (106)
Q Consensus        27 tsVh~LRP~DI~VIaAl   43 (106)
                      ..+.++.++||-.|+-+
T Consensus        56 ~~v~~~~aGdI~~i~gl   72 (83)
T cd04092          56 QEIPSLSAGNIGVITGL   72 (83)
T ss_pred             eECCeeCCCCEEEEECC
Confidence            45688999999888764


No 43 
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed
Probab=20.28  E-value=23  Score=28.14  Aligned_cols=28  Identities=21%  Similarity=0.332  Sum_probs=19.4

Q ss_pred             cCCCCcceEeecchhHHHhcCCccCCCCCcccccccce
Q psy3095          32 LRPGDIDIVGAIGDSITAGNGIVATNPSQVNTENRGLS   69 (106)
Q Consensus        32 LRP~DI~VIaAlGDSlTAG~ga~~~~~~~~~~EyRG~S   69 (106)
                      +||.||+          +.|-..+..+.|.-+||.|-=
T Consensus       182 VRP~DI~----------~~NtV~S~~IAdArI~Y~G~G  209 (230)
T PRK12700        182 VDPRSIT----------GSNTVSSTRVADARIEYRSKG  209 (230)
T ss_pred             ECHHHCC----------CCCeEccceeeeEEEEEccee
Confidence            5777775          556666666777778888753


No 44 
>TIGR01231 lacC tagatose-6-phosphate kinase. This enzyme is part of the tagatose-6-phosphate pathway of lactose degradation.
Probab=20.23  E-value=37  Score=26.16  Aligned_cols=16  Identities=44%  Similarity=0.626  Sum_probs=12.1

Q ss_pred             cceEeecchhHHHhcCC
Q psy3095          37 IDIVGAIGDSITAGNGI   53 (106)
Q Consensus        37 I~VIaAlGDSlTAG~ga   53 (106)
                      +|-++| |||++||+-+
T Consensus       246 vDttGA-GDaF~agfl~  261 (309)
T TIGR01231       246 VNPVGS-GDSTVAGITS  261 (309)
T ss_pred             CCCcch-HHHHHHHHHH
Confidence            455566 9999999854


Done!