BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy3109
(58 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1Q7L|A Chain A, Zn-binding Domain Of The T347g Mutant Of Human
Aminoacylase- I
pdb|1Q7L|C Chain C, Zn-binding Domain Of The T347g Mutant Of Human
Aminoacylase- I
Length = 198
Score = 52.4 bits (124), Expect = 6e-08, Method: Composition-based stats.
Identities = 21/32 (65%), Positives = 25/32 (78%)
Query: 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
MKCV IQYLE +RR EG +F RTIH++FVP
Sbjct: 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.138 0.413
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,523,456
Number of Sequences: 62578
Number of extensions: 39369
Number of successful extensions: 158
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 157
Number of HSP's gapped (non-prelim): 1
length of query: 58
length of database: 14,973,337
effective HSP length: 30
effective length of query: 28
effective length of database: 13,095,997
effective search space: 366687916
effective search space used: 366687916
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)