Diaphorina citri psyllid: psy3113

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MNKHTPLEGHDVKDLDLFTEIQKDRLYFATFKSNRERPTTTKIHFFCTDETHVYLNFFGDFGPICLSTLYRYCDKLKAKLNSSTLKHKVIIHYTGNNPKKRLNAAFLIGCYAIIYLKFTPNEIYKALQANNKVPFIAFQDASDENSKYTLELLECFNAVFKARQHNLFDFDDFDVDEMEKYERIQFGDISWIVPNKLLAFSGPNTTEQNTCYHPPEFYLDYFLQNGVQLVVRLNQKNYDERKFTEAGLDHVDFYFPDGTAPPNDILCEFIKVCEKYKGPIAVHCKAGLGRTGCLIGAYMIKHVRRRRTVLTKRNQYHQLRWVPGPLET

ccccccccccccccccccEEEEcccEEEEEccccccccccccEEEECccccEEccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccEEcccEEEEEccccccccccccccHHHHHHHHHcccEEEEEEcccccccHHHHccccEEEEECccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccccccccHHHHHHccccccccccc

************KDLDLFTEIQKDRLYFATFKSNRERPTTTKIHFFCTDETHVYLNFFGDFGPICLSTLYRYCDKLKAKLNSSTLKHKVIIHYTGNNPKKRLNAAFLIGCYAIIYLKFTPNEIYKALQANNKVPFIAFQDASDENSKYTLELLECFNAVFKARQHNLFDFDDFDVDEMEKYERIQFGDISWIVPNKLLAFSGPNTTEQNTCYHPPEFYLDYFLQNGVQLVVRLNQKNYDERKFTEAGLDHVDFYFPDGTAPPNDILCEFIKVCEKYKGPIAVHCKAGLGRTGCLIGAYMIKHVRRRRTVLTKRNQYHQLRWVPGP***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dual specificity protein phosphatase CDC14A	Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis.	confident	Q6GQT0
Dual specificity protein phosphatase CDC14A	Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis.	confident	Q9UNH5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0035335 [BP]	peptidyl-tyrosine dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051726 [BP]	regulation of cell cycle	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0004725 [MF]	protein tyrosine phosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OHE, chain A
Confidence level:very confident
Coverage over the Query: 12-328
View the alignment between query and template
View the model in PyMOL