Diaphorina citri psyllid: psy3115


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MNKHTPLEGHDVKDLDLFTEIQKDRLYFATFKSNRERPTTTKIHFFCTDETHVYLNFFGDFGPICLSTLYRYCDKLKAKLNSSTLKHKVIIHYTGNNPKKRLNAAFLIGCYAIIYLKFTPNEIYKALQANNKVPFIAFQDASDENSKYTLELLECFNAVFKARQHNLFDFDDFDVDEMEKYERIQFGDISWIVPNKLLAFSGPNTTEQNTCYHPPEFYLDKVSIPI
ccccccccccccccccccEEEEcccEEEEEccccccccccccEEEEEccccEEccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHcccccccEEEEEcccEEEccccccccccccccccccccccccccc
************KDLDLFTEIQKDRLYFATFKSNRERPTTTKIHFFCTDETHVYLNFFGDFGPICLSTLYRYCDKLKAKLNSSTLKHKVIIHYTGNNPKKRLNAAFLIGCYAIIYLKFTPNEIYKALQANNKVPFIAFQDASDENSKYTLELLECFNAVFKARQHNLFDFDDFDVDEMEKYERIQFGDISWIVPNKLLAFSGPNTTEQNTCYHPPEFYLDKVSIPI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKHTPLEGHDVKDLDLFTEIQKDRLYFATFKSNRERPTTTKIHFFCTDETHVYLNFFGDFGPICLSTLYRYCDKLKAKLNSSTLKHKVIIHYTGNNPKKRLNAAFLIGCYAIIYLKFTPNEIYKALQANNKVPFIAFQDASDENSKYTLELLECFNAVFKARQHNLFDFDDFDVDEMEKYERIQFGDISWIVPNKLLAFSGPNTTEQNTCYHPPEFYLDKVSIPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity protein phosphatase CDC14A Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis.confidentQ6GQT0
Dual specificity protein phosphatase CDC14A Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis.confidentQ9UNH5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OHE, chain A
Confidence level:very confident
Coverage over the Query: 12-223
View the alignment between query and template
View the model in PyMOL