RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3118
         (227 letters)



>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 68.0 bits (167), Expect = 9e-14
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 9   YRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHI----ESKIYKLMQGGVG 64
           Y L RK+GSGSFG +Y   +  TG+ VA+K+   ++   +       E +I + +     
Sbjct: 1   YELLRKLGSGSFGTVYKAKHKGTGKIVAVKILKKRSEKSKKDQTARREIRILRRLSHPNI 60

Query: 65  IPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSR--RFSLKTVLLLADQL 112
           +  I     + D+  +VME       DLF++ SR    S      +A Q+
Sbjct: 61  VRLIDAFE-DKDHLYLVMEYCEGG--DLFDYLSRGGPLSEDEAKKIALQI 107



 Score = 41.1 bits (97), Expect = 2e-04
 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 9/94 (9%)

Query: 131 GTNISTGEEVAIKLECIKTRHPQLHI----ESKIYKLMQGGVGIPQIKWCGSEGDYNVMV 186
             +  TG+ VA+K+   ++   +       E +I + +     +  I     + D+  +V
Sbjct: 18  AKHKGTGKIVAVKILKKRSEKSKKDQTARREIRILRRLSHPNIVRLIDAFE-DKDHLYLV 76

Query: 187 MELLGPSLEDLFNFCSR--RFSLKTVLLLADQLF 218
           ME       DLF++ SR    S      +A Q+ 
Sbjct: 77  MEYCEGG--DLFDYLSRGGPLSEDEAKKIALQIL 108


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 56.1 bits (136), Expect = 9e-10
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 5/102 (4%)

Query: 15  IGSGSFGDIYLGTNISTGEEVAIKLECIKTRHP---QLHIESKIYKLMQGGVGIPQIKWC 71
           +G G FG +YL  +  TG++VAIK+   +       +L  E +I K +     I ++   
Sbjct: 1   LGEGGFGTVYLARDKKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLN-HPNIVKLYGV 59

Query: 72  GSEGDYNVMVMELL-GPSLEDLFNFCSRRFSLKTVLLLADQL 112
             + ++  +VME   G SL+DL      + S   +L +  Q+
Sbjct: 60  FEDENHLYLVMEYCEGGSLKDLLKENEGKLSEDEILRILLQI 101



 Score = 38.0 bits (89), Expect = 0.002
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 131 GTNISTGEEVAIKLECIKTRHP---QLHIESKIYKLMQGGVGIPQIKWCGSEGDYNVMVM 187
             +  TG++VAIK+   +       +L  E +I K +     I ++     + ++  +VM
Sbjct: 12  ARDKKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLNH-PNIVKLYGVFEDENHLYLVM 70

Query: 188 ELL-GPSLEDLFNFCSRRFSLKTVLLLADQL 217
           E   G SL+DL      + S   +L +  Q+
Sbjct: 71  EYCEGGSLKDLLKENEGKLSEDEILRILLQI 101


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 53.6 bits (127), Expect = 2e-08
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 11/113 (9%)

Query: 8   KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK-----LECIKTRHPQLHIESKIYKLMQGG 62
            YR+ RK+G GSFG++YL  +    + VA+K     LE       +   E +I   +   
Sbjct: 1   SYRILRKLGEGSFGEVYLARDR---KLVALKVLAKKLESKSKEVERFLREIQILASLNHP 57

Query: 63  VGIPQIKWCGSEGDYNVMVMELL-GPSLEDLFNFCSR--RFSLKTVLLLADQL 112
             I ++     +     +VME + G SLEDL     R    S    L +  Q+
Sbjct: 58  PNIVKLYDFFQDEGSLYLVMEYVDGGSLEDLLKKIGRKGPLSESEALFILAQI 110


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 52.1 bits (126), Expect = 3e-08
 Identities = 33/108 (30%), Positives = 48/108 (44%), Gaps = 6/108 (5%)

Query: 9   YRLGRKIGSGSFGDIYLGTNISTGEEVAIK---LECIKTRHPQLHIESKIYKLMQGGVGI 65
           Y +  K+G GSFG +YL  +  TG+ VAIK    + IK    ++  E KI K ++    I
Sbjct: 1   YEILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKKIKKDRERILREIKILKKLK-HPNI 59

Query: 66  PQIKWCGSEGDYNVMVMELL-GPSLEDLFNFCSRRFSLKTVLLLADQL 112
            ++     + D   +VME   G  L DL      R S         Q+
Sbjct: 60  VRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKR-GRLSEDEARFYLRQI 106



 Score = 27.5 bits (62), Expect = 5.3
 Identities = 24/93 (25%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 131 GTNISTGEEVAIK---LECIKTRHPQLHIESKIYKLMQGGVGIPQIKWCGSEGDYNVMVM 187
             +  TG+ VAIK    + IK    ++  E KI K ++    I ++     + D   +VM
Sbjct: 18  ARDKKTGKLVAIKVIKKKKIKKDRERILREIKILKKLK-HPNIVRLYDVFEDEDKLYLVM 76

Query: 188 ELL-GPSLEDLFNFCSRRFSLKTVLLLADQLFL 219
           E   G  L DL      R S         Q+  
Sbjct: 77  EYCEGGDLFDLLKKR-GRLSEDEARFYLRQILS 108


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
           Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
           Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CCRK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CCRK was previously called p42. It is a
           Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
           which is essential for the activation of CDK2. It is
           indispensable for cell growth and has been implicated in
           the progression of glioblastoma multiforme. In the
           heart, a splice variant of CCRK with a different
           C-terminal half is expressed, this variant promotes
           cardiac cell growth and survival and is significantly
           down-regulated during the development of heart failure.
          Length = 286

 Score = 50.7 bits (122), Expect = 1e-07
 Identities = 24/109 (22%), Positives = 43/109 (39%), Gaps = 5/109 (4%)

Query: 8   KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRH----PQLHIESKIYKLMQGGV 63
           +Y++  +IG G+ G ++   +  TGE VA+K   ++        Q   E K  +  Q   
Sbjct: 1   RYKILGRIGEGAHGIVFKAKDRETGETVALKKVALRRLEGGIPNQALREIKALQACQHP- 59

Query: 64  GIPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQL 112
            + ++      G   V+VME +   L ++     R      V      L
Sbjct: 60  YVVKLLDVFPHGSGFVLVMEYMPSDLSEVLRDEERPLPEAQVKSYMRML 108



 Score = 34.2 bits (79), Expect = 0.037
 Identities = 21/105 (20%), Positives = 36/105 (34%), Gaps = 5/105 (4%)

Query: 118 GIIDQEQKSVMVVGTNISTGEEVAIKLECIKTRH----PQLHIESKIYKLMQGGVGIPQI 173
           G I +    ++    +  TGE VA+K   ++        Q   E K  +  Q    + ++
Sbjct: 6   GRIGEGAHGIVFKAKDRETGETVALKKVALRRLEGGIPNQALREIKALQACQHP-YVVKL 64

Query: 174 KWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQLF 218
                 G   V+VME +   L ++     R      V      L 
Sbjct: 65  LDVFPHGSGFVLVMEYMPSDLSEVLRDEERPLPEAQVKSYMRMLL 109


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-Activated Protein
          Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks)
          are also called MAP/ERK kinase kinases (MEKKs) in some
          cases. They phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. This subfamily is composed of
          the Apoptosis Signal-regulating Kinases ASK1 (or
          MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3,
          MEKK4, as well as plant and fungal MAPKKKs. Also
          included in this subfamily are the cell division
          control proteins Schizosaccharomyces pombe Cdc7 and
          Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 49.1 bits (118), Expect = 4e-07
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          ++  G  +G GSFG +YL  +  TGE +A+K
Sbjct: 1  EWTRGELLGRGSFGSVYLALDKDTGELMAVK 31


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 48.7 bits (117), Expect = 5e-07
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 18/108 (16%)

Query: 8   KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQGGVGIPQ 67
            + +  KIG G FG++Y   +  TG+EVAIK+  IK          +  + +   + I +
Sbjct: 1   LFEILEKIGKGGFGEVYKARHKRTGKEVAIKV--IKLE------SKEKKEKIINEIQILK 52

Query: 68  -------IKWCGS--EGDYNVMVMELL-GPSLEDLFNFCSRRFSLKTV 105
                  +K+ GS  + D   +VME   G SL+DL    ++  +   +
Sbjct: 53  KCKHPNIVKYYGSYLKKDELWIVMEFCSGGSLKDLLKSTNQTLTESQI 100


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
          cell-Associated Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Male germ
          cell-Associated Kinase (MAK)-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of human MAK and MAK-related kinase (MRK),
          Saccharomyces cerevisiae Ime2p, Schizosaccharomyces
          pombe Mei4-dependent protein 3 (Mde3) and Pit1,
          Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK,
          and similar proteins. These proteins play important
          roles during meiosis. MAK is highly expressed in
          testicular cells specifically in the meiotic phase, but
          is not essential for spermatogenesis and fertility. It
          functions as a coactivator of the androgen receptor in
          prostate cells. MRK, also called Intestinal Cell Kinase
          (ICK), is expressed ubiquitously, with highest
          expression in the ovary and uterus. A missense mutation
          in MRK causes endocrine-cerebro-osteodysplasia (ECO),
          suggesting that this protein plays an important role in
          the development of many organs. MAK and MRK may be
          involved in regulating cell cycle and cell fate. Ime2p
          is a meiosis-specific kinase that is important during
          meiotic initiation and during the later stages of
          meiosis. Mde3 functions downstream of the transcription
          factor Mei-4 which is essential for meiotic prophase I.
          Length = 283

 Score = 46.4 bits (111), Expect = 3e-06
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          Y++ +++G G+FG +YL  N  TGE VAIK
Sbjct: 1  YKVIKQLGDGTFGSVYLARNKETGELVAIK 30


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
          protein kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), mammalian Ste20-like
          protein kinase 3 (MST3)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1
          and Sid1, Saccharomyces cerevisiae sporulation-specific
          protein 1 (SPS1), and related proteins. Nak1 is
          required by fission yeast for polarizing the tips of
          actin cytoskeleton and is involved in cell growth, cell
          separation, cell morphology and cell-cycle progression.
          Sid1 is a component in the septation initiation network
          (SIN) signaling pathway, and plays a role in
          cytokinesis. SPS1 plays a role in regulating proteins
          required for spore wall formation. MST4 plays a role in
          mitogen-activated protein kinase (MAPK) signaling
          during cytoskeletal rearrangement, morphogenesis, and
          apoptosis. MST3 phosphorylates the STK NDR and may play
          a role in cell cycle progression and cell morphology.
          STK25 may play a role in the regulation of cell
          migration and polarization.
          Length = 274

 Score = 46.5 bits (111), Expect = 3e-06
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
            + L   IG GSFG++Y   +  T + VAIK
Sbjct: 1  ELFTLLECIGKGSFGEVYKAIDKRTNQVVAIK 32


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 44.1 bits (105), Expect = 2e-05
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 7   NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQGGVGIP 66
             Y+   KIG G+ G++Y  T+ +TG+EVAIK         ++ +  +  +L+   + I 
Sbjct: 19  ELYKNLEKIGEGASGEVYKATDRATGKEVAIK---------KMRLRKQNKELIINEILIM 69

Query: 67  Q-------IKWCGS--EGDYNVMVMELL-GPSLEDLFNFCSRRFS 101
           +       + +  S   GD   +VME + G SL D+      R +
Sbjct: 70  KDCKHPNIVDYYDSYLVGDELWVVMEYMDGGSLTDIITQNFVRMN 114



 Score = 27.9 bits (63), Expect = 4.3
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 19/87 (21%)

Query: 130 VGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQGGVGIPQ-------IKWCGS--EG 180
             T+ +TG+EVAIK         ++ +  +  +L+   + I +       + +  S   G
Sbjct: 37  KATDRATGKEVAIK---------KMRLRKQNKELIINEILIMKDCKHPNIVDYYDSYLVG 87

Query: 181 DYNVMVMELL-GPSLEDLFNFCSRRFS 206
           D   +VME + G SL D+      R +
Sbjct: 88  DELWVVMEYMDGGSLTDIITQNFVRMN 114


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Phosphoinositide-dependent
          kinase 1.  Serine/Threonine Kinases (STKs),
          Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The PDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PDK1 carries an
          N-terminal catalytic domain and a C-terminal pleckstrin
          homology (PH) domain that binds phosphoinositides. It
          phosphorylates the activation loop of AGC kinases that
          are regulated by PI3K such as PKB, SGK, and PKC, among
          others, and is crucial for their activation. Thus, it
          contributes in regulating many processes including
          metabolism, growth, proliferation, and survival. PDK1
          also has the ability to autophosphorylate and is
          constitutively active in mammalian cells. PDK1 is
          essential for normal embryo development and is
          important in regulating cell volume.
          Length = 280

 Score = 42.2 bits (100), Expect = 8e-05
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          + ++ G+ IG GSF  + L     T +E AIK
Sbjct: 1  DDFKFGKIIGEGSFSTVVLAKEKETNKEYAIK 32


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division
          control protein 7-like Protein Serine/Threonine
          Kinases.  Serine/threonine kinases (STKs),  (Cdc7)-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Cdc7-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          include Schizosaccharomyces pombe Cdc7, Saccharomyces
          cerevisiae Cdc15, Arabidopsis thaliana
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) epsilon, and related proteins. MAPKKKs
          phosphorylate and activate MAPK kinases (MAPKKs or MKKs
          or MAP2Ks), which in turn phosphorylate and activate
          MAPKs during signaling cascades that are important in
          mediating cellular responses to extracellular signals.
          Fission yeast Cdc7 is essential for cell division by
          playing a key role in the initiation of septum
          formation and cytokinesis. Budding yeast Cdc15
          functions to coordinate mitotic exit with cytokinesis.
          Arabidopsis MAPKKK epsilon is required for pollen
          development in the plasma membrane.
          Length = 254

 Score = 41.9 bits (99), Expect = 1e-04
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
           Y+LG  IG G+FG +Y G N+ TG+ VAIK
Sbjct: 1  NYQLGDLIGRGAFGVVYKGLNLETGDFVAIK 31


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase (Nek)
          family, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The Nek family is composed
          of 11 different mammalian members (Nek1-11) with
          similarity to the catalytic domain of Aspergillus
          nidulans NIMA kinase, the founding member of the Nek
          family which was identified in a screen for cell cycle
          mutants that were prevented from entering mitosis. Neks
          contain a conserved N-terminal catalytic domain and a
          more divergent C-terminal regulatory region of various
          sizes and structures. They are involved in the
          regulation of downstream processes following the
          activation of Cdc2, and many of their functions are
          cell cycle-related. They play critical roles in
          microtubule dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 41.3 bits (98), Expect = 2e-04
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY + ++IG GSFG +YL    S G+   +K
Sbjct: 1  KYEIIKQIGKGSFGKVYLVRRKSDGKLYVLK 31


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
          Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          4 (MEKK4) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK4 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MEKK4 is a
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MKKK or MAP3K), that phosphorylates and
          activates MAPK kinases (MAPKKs or MKKs or MAP2Ks),
          which in turn phosphorylate and activate MAPKs during
          signaling cascades that are important in mediating
          cellular responses to extracellular signals. MEKK4
          activates the c-Jun N-terminal kinase (JNK) and p38
          MAPK signaling pathways by directly activating their
          respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. JNK and p38
          are collectively known as stress-activated MAPKs, as
          they are activated in response to a variety of
          environmental stresses and pro-inflammatory cytokines.
          MEKK4 also plays roles in the re-polarization of the
          actin cytoskeleton in response to osmotic stress, in
          the proper closure of the neural tube, in
          cardiovascular development, and in immune responses.
          Length = 264

 Score = 40.8 bits (96), Expect = 2e-04
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTR------HPQLHIESKIYKLM 59
          +++ G KIG G+FG +Y   N+ TGE +A+K   I+ +        ++  E K+ +L+
Sbjct: 1  RWQRGNKIGGGTFGKVYTAVNLDTGELMAVKE--IRIQDNDPKTIKEIADEMKVLELL 56


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
          Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
          kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The plant MEKK1 subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of plant mitogen-activated protein kinase
          (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
          including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
          is a MAPKKK that phosphorylates and activates MAPK
          kinases (MAPKKs or MKKs or MAP2Ks), which in turn
          phosphorylate and activate MAPKs during signaling
          cascades that are important in mediating cellular
          responses to extracellular signals. Arabidopsis
          thaliana MEKK1 activates MPK4, a MAPK that regulates
          systemic acquired resistance. MEKK1 also participates
          in the regulation of temperature-sensitive and
          tissue-specific cell death.
          Length = 258

 Score = 40.5 bits (95), Expect = 3e-04
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECI 42
          ++R G  +GSGSFG +Y G N+  G+  A+K   +
Sbjct: 1  RWRKGELLGSGSFGSVYEGLNLDDGDFFAVKEVSL 35


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
          protein kinase kinase kinase kinase-like Protein
          Serine/Threonine Kinases.  Serine/threonine kinases
          (STKs), mitogen-activated protein kinase (MAPK) kinase
          kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily includes
          MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins.
          Vertebrate members contain an N-terminal catalytic
          domain and a C-terminal citron homology (CNH)
          regulatory domain, similar to MAP4K4/6. MAP4Ks are
          involved in some MAPK signaling pathways that are
          important in mediating cellular responses to
          extracellular signals by activating a MAPK kinase
          kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. MAP4K1, also called haematopoietic progenitor
          kinase 1 (HPK1), is a hematopoietic-specific STK
          involved in many cellular signaling cascades including
          MAPK, antigen receptor, apoptosis, growth factor, and
          cytokine signaling. It participates in the regulation
          of T cell receptor signaling and T cell-mediated immune
          responses. MAP4K2 was referred to as germinal center
          (GC) kinase because of its preferred location in GC B
          cells. MAP4K3 plays a role in the nutrient-responsive
          pathway of mTOR (mammalian target of rapamycin)
          signaling. It is required in the activation of S6
          kinase by amino acids and for the phosphorylation of
          the mTOR-regulated inhibitor of eukaryotic initiation
          factor 4E. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 39.6 bits (93), Expect = 6e-04
 Identities = 17/32 (53%), Positives = 25/32 (78%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
           Y L ++IGSG++GD+Y   +I+TGE VAIK+
Sbjct: 4  DYELIQRIGSGTYGDVYKARDIATGELVAIKV 35


>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-activated protein
          kinase kinase kinase kinase 3.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          MAP4K4/6. MAP4Ks are involved in some MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K3 plays a role in the
          nutrient-responsive pathway of mTOR (mammalian target
          of rapamycin) signaling. MAP4K3 is required in the
          activation of S6 kinase by amino acids and for the
          phosphorylation of the mTOR-regulated inhibitor of
          eukaryotic initiation factor 4E. mTOR regulates
          ribosome biogenesis and protein translation, and is
          frequently deregulated in cancer.
          Length = 267

 Score = 39.3 bits (91), Expect = 7e-04
 Identities = 15/31 (48%), Positives = 24/31 (77%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          + L ++IGSG++GD+Y   N++TGE  AIK+
Sbjct: 11 FELIQRIGSGTYGDVYKARNVNTGELAAIKV 41


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
          Phosphotransferases. Tyrosine-specific kinase
          subfamily.
          Length = 257

 Score = 39.1 bits (92), Expect = 0.001
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 10 RLGRKIGSGSFGDIYLGT----NISTGEEVAIKLECIKTRHPQLHIE 52
           LG+K+G G+FG++Y G           EVA+K   +K    +  IE
Sbjct: 2  TLGKKLGEGAFGEVYKGKLKGKGGKKKVEVAVK--TLKEDASEQQIE 46


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-activated protein
          kinase kinase kinase kinase 5.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          MAP4K4/6. MAP4Ks are involved in some MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
          also facilitates Wnt signaling in B cells, and may
          therefore be implicated in the control of cell fate,
          proliferation, and polarity.
          Length = 267

 Score = 38.9 bits (90), Expect = 0.001
 Identities = 14/31 (45%), Positives = 23/31 (74%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          Y L +++GSG++GD+Y   N+ TGE  A+K+
Sbjct: 11 YELIQRVGSGTYGDVYKARNLHTGELAAVKI 41


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
          Phosphotransferases. The specificity of this class of
          kinases can not be predicted. Possible dual-specificity
          Ser/Thr/Tyr kinase.
          Length = 258

 Score = 38.7 bits (91), Expect = 0.001
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 10 RLGRKIGSGSFGDIYLGT----NISTGEEVAIKLECIKTRHPQLHIE 52
           LG+K+G G+FG++Y GT          EVA+K   +K    +  IE
Sbjct: 2  TLGKKLGEGAFGEVYKGTLKGKGDGKEVEVAVK--TLKEDASEQQIE 46


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
          Serine/Threonine Kinase, Group I p21-activated kinase. 
          Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) subfamily, Group I, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PAK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PAKs are Rho
          family GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs are implicated in the regulation of
          many cellular processes including growth factor
          receptor-mediated proliferation, cell polarity, cell
          motility, cell death and survival, and actin
          cytoskeleton organization. PAKs from higher eukaryotes
          are classified into two groups (I and II), according to
          their biochemical and structural features. Group I
          PAKs, also called conventional PAKs, include PAK1,
          PAK2, and PAK3. Group I PAKs contain a PBD (p21-binding
          domain) overlapping with an AID (autoinhibitory
          domain), a C-terminal catalytic domain, SH3 binding
          sites and a non-classical SH3 binding site for PIX
          (PAK-interacting exchange factor). They interact with
          the SH3 domain containing proteins Nck, Grb2 and PIX.
          Binding of group I PAKs to activated GTPases leads to
          conformational changes that destabilize the AID,
          allowing autophosphorylation and full activation of the
          kinase domain. Known group I PAK substrates include
          MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
          Stat5a, and Aurora A, among others.
          Length = 293

 Score = 38.7 bits (90), Expect = 0.001
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY    KIG G+ G +Y   +++TG+EVAIK
Sbjct: 20 KYTRFEKIGQGASGTVYTAIDVATGQEVAIK 50


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 7.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 7 (CDK7) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK7 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK7 plays essential roles in the cell cycle
          and in transcription. It associates with cyclin H and
          MAT1 and acts as a CDK-Activating Kinase (CAK) by
          phosphorylating and activating cell cycle CDKs
          (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
          also a component of the general transcription factor
          TFIIH, which phosphorylates the C-terminal domain (CTD)
          of RNA polymerase II when it is bound with
          unphosphorylated DNA, as present in the pre-initiation
          complex. Following phosphorylation, the CTD dissociates
          from the DNA which allows transcription initiation.
          Length = 298

 Score = 38.7 bits (91), Expect = 0.001
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +Y  G+K+G G++  +Y   +  TG  VAIK
Sbjct: 1  RYEKGKKLGEGTYAVVYKARDKETGRIVAIK 31


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
          Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase (MAPKKK) subfamily, fungal Byr2-like
          proteins, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this group
          include the MAPKKKs Schizosaccharomyces pombe Byr2,
          Saccharomyces cerevisiae and Cryptococcus neoformans
          Ste11, and related proteins. They contain an N-terminal
          SAM (sterile alpha-motif) domain, which mediates
          protein-protein interaction, and a C-terminal catalytic
          domain. MAPKKKs phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. Fission yeast Byr2 is regulated
          by Ras1. It responds to pheromone signaling and
          controls mating through the MAPK pathway. Budding yeast
          Ste11 functions in MAPK cascades that regulate mating,
          high osmolarity glycerol, and filamentous growth
          responses.
          Length = 267

 Score = 38.7 bits (90), Expect = 0.001
 Identities = 17/27 (62%), Positives = 21/27 (77%)

Query: 12 GRKIGSGSFGDIYLGTNISTGEEVAIK 38
          G  IGSGSFG +YLG N S+GE +A+K
Sbjct: 5  GALIGSGSFGSVYLGMNASSGELMAVK 31


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase
          kinase 3-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          3 (MEKK3)-like subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK3-like subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of MEKK3, MEKK2, and related proteins, all
          containing an N-terminal PB1 domain, which mediates
          oligomerization, and a C-terminal catalytic domain.
          MEKK2 and MEKK3 are mitogen-activated protein kinase
          (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
          proteins that phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. MEKK2 and MEKK3 activate MEK5
          (also called MKK5), which activates extracellular
          signal-regulated kinase 5 (ERK5). The ERK5 cascade
          plays roles in promoting cell proliferation,
          differentiation, neuronal survival, and
          neuroprotection. MEKK3 plays an essential role in
          embryonic angiogenesis and early heart development.
          MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
          N-terminal kinase (JNK) and p38, through their
          respective MAPKKs.
          Length = 263

 Score = 38.6 bits (90), Expect = 0.001
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
            +R G+ +G G+FG +YL  ++ TG E+A+K
Sbjct: 2  TNWRRGKLLGQGAFGRVYLCYDVDTGRELAVK 33


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          proteins.  Serine/threonine kinases (STKs),
          thousand-and-one amino acids (TAO) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The TAO subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. TAO proteins possess
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MAP3K or MKKK) activity. They activate the
          MAPKs, p38 and c-Jun N-terminal kinase (JNK), by
          phosphorylating and activating the respective MAP/ERK
          kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
          and MKK4/MKK7. MAPK signaling cascades are important in
          mediating cellular responses to extracellular signals.
          Vertebrates contain three TAO subfamily members, named
          TAO1, TAO2, and TAO3.
          Length = 307

 Score = 38.2 bits (89), Expect = 0.002
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIK 38
          R+IG GSFG +Y   ++ T E VAIK
Sbjct: 21 REIGHGSFGAVYFARDVRTNEVVAIK 46


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 37.9 bits (89), Expect = 0.002
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 4/33 (12%)

Query: 10 RLGRKIGSGSFGDIYLGT----NISTGEEVAIK 38
           LG+K+G G+FG++Y GT       T  +VA+K
Sbjct: 2  ELGKKLGEGAFGEVYKGTLKGDGEGTETKVAVK 34


>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
          Bck1-like MAP Kinase Kinase Kinases.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase (MAPKKK) subfamily, fungal Bck1-like
          proteins, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this group
          include the MAPKKKs Saccharomyces cerevisiae Bck1 and
          Schizosaccharomyces pombe Mkh1, and related proteins.
          MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs
          or MKKs or MAP2Ks), which in turn phosphorylate and
          activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. Budding yeast Bck1 is part of
          the cell integrity MAPK pathway, which is activated by
          stresses and aggressions to the cell wall. The MAPKKK
          Bck1, MAPKKs Mkk1 and Mkk2, and the MAPK Slt2 make up
          the cascade that is important in the maintenance of
          cell wall homeostasis. Fission yeast Mkh1 is involved
          in MAPK cascades regulating cell morphology, cell wall
          integrity, salt resistance, and filamentous growth in
          response to stress.
          Length = 272

 Score = 37.9 bits (88), Expect = 0.002
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 12 GRKIGSGSFGDIYLGTNISTGEEVAIK 38
          G  IG G++G +YL  N++TGE +A+K
Sbjct: 6  GELIGKGTYGRVYLALNVTTGEMMAVK 32


>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein
           Tyrosine Kinases, Janus kinases.  Protein Tyrosine
           Kinase (PTK) family; Janus kinase (Jak) subfamily;
           catalytic (c) domain (repeat 2). The Jak subfamily is
           composed of Jak1, Jak2, Jak3, TYK2, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Jak subfamily proteins are cytoplasmic (or nonreceptor)
           tyr kinases containing an N-terminal FERM domain,
           followed by a Src homology 2 (SH2) domain, a
           pseudokinase domain, and a C-terminal tyr kinase
           catalytic domain. Most Jaks are expressed in a wide
           variety of tissues, except for Jak3, which is expressed
           only in hematopoietic cells. Jaks are crucial for
           cytokine receptor signaling. They are activated by
           autophosphorylation upon cytokine-induced receptor
           aggregation, and subsequently trigger downstream
           signaling events such as the phosphorylation of signal
           transducers and activators of transcription (STATs).
           Jaks are also involved in regulating the surface
           expression of some cytokine receptors. The Jak-STAT
           pathway is involved in many biological processes
           including hematopoiesis, immunoregulation, host defense,
           fertility, lactation, growth, and embryogenesis.
          Length = 284

 Score = 37.8 bits (88), Expect = 0.002
 Identities = 27/110 (24%), Positives = 48/110 (43%), Gaps = 11/110 (10%)

Query: 13  RKIGSGSFGDIYLGT----NISTGEEVAIKL---ECIKTRHPQLHIESKIYKLMQGGVGI 65
           +++G G FG + L        +TGE+VA+K       +        E +I + +     +
Sbjct: 10  KQLGEGHFGKVELCRYDPLGDNTGEQVAVKSLNHSGEEQHRSDFEREIEILRTLDHENIV 69

Query: 66  PQIKWCGSEGDYNV-MVMELLGP--SLEDLFNFCSRRFSLKTVLLLADQL 112
                C   G  ++ ++ME L P  SL D       + +LK +LL + Q+
Sbjct: 70  KYKGVCEKPGGRSLRLIMEYL-PSGSLRDYLQRHRDQINLKRLLLFSSQI 118


>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 9.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK9 together with a cyclin partner (cyclin
          T1, T2a, T2b, or K) is the main component of distinct
          positive transcription elongation factors (P-TEFb),
          which function as Ser2 C-terminal domain kinases of RNA
          polymerase II. P-TEFb participates in multiple steps of
          gene expression including transcription elongation,
          mRNA synthesis, processing, export, and translation. It
          also plays a role in mediating cytokine induced
          transcription networks such as IL6-induced STAT3
          signaling. In addition, the CDK9/cyclin T2a complex
          promotes muscle differentiation and enhances the
          function of some myogenic regulatory factors.
          Length = 310

 Score = 37.0 bits (86), Expect = 0.004
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +KY    KIG G+FG+++   +  T + VA+K
Sbjct: 12 SKYEKLAKIGQGTFGEVFKARHKKTKQIVALK 43


>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
          kinase 3-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          3 (MEKK3)-like subfamily, catalytic (c) domain,
          functionally uncharacterized subgroup 1. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MEKK3-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The MEKK3-like subfamily is
          composed of MEKK3, MEKK2, and related proteins, all
          containing an N-terminal PB1 domain, which mediates
          oligomerization, and a C-terminal catalytic domain.
          MEKK2 and MEKK3 are mitogen-activated protein kinase
          (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
          proteins that phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. MEKK2 and MEKK3 activate MEK5
          (also called MKK5), which activates extracellular
          signal-regulated kinase 5 (ERK5). The ERK5 cascade
          plays roles in promoting cell proliferation,
          differentiation, neuronal survival, and
          neuroprotection. MEKK3 plays an essential role in
          embryonic angiogenesis and early heart development.
          MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
          N-terminal kinase (JNK) and p38, through their
          respective MAPKKs.
          Length = 264

 Score = 36.9 bits (85), Expect = 0.005
 Identities = 14/30 (46%), Positives = 23/30 (76%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +RLG+ +G G+FG++YL  +  TG E+A+K
Sbjct: 4  WRLGKLLGRGAFGEVYLCYDADTGRELAVK 33


>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
          Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          2 (MEKK2) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK2 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MEKK2 is a
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MKKK or MAP3K), that phosphorylates and
          activates the MAPK kinase MEK5 (or MKK5), which in turn
          phosphorylates and activates extracellular
          signal-regulated kinase 5 (ERK5). The ERK5 cascade
          plays roles in promoting cell proliferation,
          differentiation, neuronal survival, and
          neuroprotection. MEKK2 also activates ERK1/2, c-Jun
          N-terminal kinase (JNK) and p38 through their
          respective MAPKKs MEK1/2, JNK-activating kinase 2
          (JNKK2), and MKK3/6. MEKK2 plays roles in T cell
          receptor signaling, immune synapse formation, cytokine
          gene expression, as well as in EGF and FGF receptor
          signaling.
          Length = 265

 Score = 36.9 bits (85), Expect = 0.005
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +RLG+ +G G+FG +YL  +  TG E+A+K
Sbjct: 4  WRLGKLLGQGAFGRVYLCYDADTGRELAVK 33


>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional.
          Length = 440

 Score = 36.9 bits (85), Expect = 0.005
 Identities = 17/30 (56%), Positives = 21/30 (70%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          Y+LG  IG+GSFG +Y    I T E+VAIK
Sbjct: 68 YKLGNIIGNGSFGVVYEAICIDTSEKVAIK 97


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
          UAS Requirement 1 and similar proteins.
          Serine/Threonine Kinases (STKs), Bypass UAS Requirement
          1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          BUR1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. BUR1, also called SGV1, is a yeast
          Cyclin-Dependent protein Kinase (CDK) that is
          functionally equivalent to mammalian CDK9. It
          associates with the cyclin BUR2. BUR genes were
          orginally identified in a genetic screen as factors
          involved in general transcription. The BUR1/BUR2
          complex phosphorylates the C-terminal domain of RNA
          polymerase II. In addition, this complex regulates
          histone modification by phosporylating Rad6 and
          mediating the association of the Paf1 complex with
          chromatin.
          Length = 311

 Score = 36.9 bits (86), Expect = 0.005
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHI----ESKIYKLMQ 60
          Y +  K+G G+FG++Y    I TG  VA+K   +        I    E KI K ++
Sbjct: 10 YEILGKLGEGTFGEVYKARQIKTGRVVALKKILMHNEKDGFPITALREIKILKKLK 65


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 9-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK9 and CDK12
          from higher eukaryotes, yeast BUR1, C-type plant CDKs
          (CdkC), and similar proteins. CDK9, BUR1, and CdkC are
          functionally equivalent. They act as a kinase for the
          C-terminal domain of RNA polymerase II and participate
          in regulating mutliple steps of gene expression
          including transcription elongation and RNA processing.
          CDK9 and CdkC associate with T-type cyclins while BUR1
          associates with the cyclin BUR2. CDK12 is a unique CDK
          that contains an arginine/serine-rich (RS) domain,
          which is predominantly found in splicing factors. CDK12
          interacts with cyclins L1 and L2, and participates in
          regulating transcription and alternative splicing.
          Length = 287

 Score = 36.8 bits (86), Expect = 0.006
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          Y    +IG G++G +Y   N  TGE VA+K
Sbjct: 1  YEKIAQIGEGTYGQVYKARNKKTGELVALK 30


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
          Serine/Threonine Kinases, Mammalian Ste20-like protein
          kinase 1 and 2.  Serine/threonine kinases (STKs),
          mammalian Ste20-like protein kinase 1 (MST1) and MST2
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MST1/2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST1, MST2, and related proteins including
          Drosophila Hippo and Dictyostelium discoideum Krs1
          (kinase responsive to stress 1). MST1/2 and Hippo are
          involved in a conserved pathway that governs cell
          contact inhibition, organ size control, and tumor
          development. MST1 activates the mitogen-activated
          protein kinases (MAPKs) p38 and c-Jun N-terminal kinase
          (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK
          kinase kinase) by acting as a MAPK kinase kinase kinase
          (MAPKKKK). Activation of JNK by MST1 leads to caspase
          activation and apoptosis. MST1 has also been implicated
          in cell proliferation and differentiation. Krs1 may
          regulate cell growth arrest and apoptosis in response
          to cellular stress.
          Length = 256

 Score = 36.1 bits (84), Expect = 0.007
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          + +  K+G GS+G +Y   +  TG+ VAIK+
Sbjct: 5  FDILEKLGEGSYGSVYKAIHKETGQVVAIKV 35


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine
          Kinase, MAPK/MAK/MRK Overlapping Kinase.
          Serine/Threonine Kinases (STKs), MAPK/MAK/MRK
          Overlapping Kinase (MOK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MOK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MOK, also called Renal tumor
          antigen 1 (RAGE-1), is widely expressed and is enriched
          in testis, kidney, lung, and brain. It is expressed in
          approximately 50% of renal cell carcinomas (RCC) and is
          a potential target for immunotherapy. MOK is stabilized
          by its association with the HSP90 molecular chaperone.
          It is induced by the transcription factor Cdx2 and may
          be involved in regulating intestinal epithelial
          development and differentiation.
          Length = 282

 Score = 35.3 bits (82), Expect = 0.014
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          Y++  KIG G+F ++    +  TG+  AIK
Sbjct: 1  YKILGKIGEGTFSEVLKAQSRKTGKYYAIK 30


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
          protein Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase (CDK)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKs are partly regulated by their
          subcellular localization, which defines substrate
          phosphorylation and the resulting specific function.
          CDK1, CDK2, CDK4, and CDK6 have well-defined functions
          in the cell cycle, such as the regulation of the early
          G1 phase by CDK4 or CDK6, the G1/S phase transition by
          CDK2, or the entry of mitosis by CDK1. They also
          exhibit overlapping cyclin specificity and functions in
          certain conditions. Knockout mice with a single CDK
          deleted remain viable with specific phenotypes, showing
          that some CDKs can compensate for each other. For
          example, CDK4 can compensate for the loss of CDK6,
          however, double knockout mice with both CDK4 and CDK6
          deleted die in utero. CDK8 and CDK9 are mainly involved
          in transcription while CDK5 is implicated in neuronal
          function. CDK7 plays essential roles in both the cell
          cycle as a CDK-Activating Kinase (CAK) and in
          transcription as a component of the general
          transcription factor TFIIH.
          Length = 282

 Score = 35.2 bits (82), Expect = 0.016
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          Y    K+G G++G +Y   +  TGE VA+K
Sbjct: 1  YEKLEKLGEGTYGVVYKARDKKTGEIVALK 30


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase (MAPK) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAPK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation. Typical MAPK pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPK kinase (MAP2K or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAP3K or MKKK). Each cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. There are three main typical MAPK subfamilies:
          Extracellular signal-Regulated Kinase (ERK), c-Jun
          N-terminal Kinase (JNK), and p38. Some MAPKs are
          atypical in that they are not regulated by MAP2Ks.
          These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 35.2 bits (82), Expect = 0.019
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +Y L + IGSG++G +    +  TG +VAIK
Sbjct: 1  RYELLKPIGSGAYGVVCSAVDKRTGRKVAIK 31


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
          myosin-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), Class III myosin-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          class III myosin-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Class III
          myosins are motor proteins with an N-terminal kinase
          catalytic domain and a C-terminal actin-binding motor
          domain. Class III myosins are present in the
          photoreceptors of invertebrates and vertebrates and in
          the auditory hair cells of mammals. The kinase domain
          of myosin III can phosphorylate several cytoskeletal
          proteins, conventional myosin regulatory light chains,
          and can autophosphorylate the C-terminal motor domain.
          Myosin III may play an important role in maintaining
          the structural integrity of photoreceptor cell
          microvilli. It may also function as a cargo carrier
          during light-dependent translocation, in photoreceptor
          cells, of proteins such as transducin and arrestin. The
          Drosophila class III myosin, called NinaC (Neither
          inactivation nor afterpotential protein C), is critical
          in normal adaptation and termination of photoresponse. 
          Vertebrates contain two isoforms of class III myosin,
          IIIA and IIIB. This subfamily also includes mammalian
          NIK-like embryo-specific kinase (NESK), Traf2- and
          Nck-interacting kinase (TNIK), mitogen-activated
          protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4
          or MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are
          involved in some MAPK signaling pathways by activating
          a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each
          MAPK cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAPK signaling cascades are important
          in mediating cellular responses to extracellular
          signals.
          Length = 275

 Score = 34.9 bits (81), Expect = 0.021
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query: 6  GNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
             + L   IG G++G +Y   +  TG+ VAIK
Sbjct: 5  TGIFELVEVIGEGTYGKVYKARHKKTGQLVAIK 37


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
          Serine/Threonine Kinase, p21-activated kinase 3.
          Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) 3, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PAK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PAKs are Rho family
          GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs from higher eukaryotes are classified
          into two groups (I and II), according to their
          biochemical and structural features. PAK3 belongs to
          group I. Group I PAKs contain a PBD (p21-binding
          domain) overlapping with an AID (autoinhibitory
          domain), a C-terminal catalytic domain, SH3 binding
          sites and a non-classical SH3 binding site for PIX
          (PAK-interacting exchange factor). PAK3 is highly
          expressed in the brain. It is implicated in neuronal
          plasticity, synapse formation, dendritic spine
          morphogenesis, cell cycle progression, neuronal
          migration, and apoptosis. Inactivating mutations in the
          PAK3 gene cause X-linked non-syndromic mental
          retardation, the severity of which depends on the site
          of the mutation.
          Length = 297

 Score = 35.1 bits (80), Expect = 0.023
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY    KIG G+ G +Y   +I+TG+EVAIK
Sbjct: 20 KYTRFEKIGQGASGTVYTAIDIATGQEVAIK 50


>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin
          Receptor-like Protein Tyrosine Kinases.  Protein
          Tyrosine Kinase (PTK) family; Insulin Receptor (InsR)
          subfamily; catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). The InsR subfamily is
          composed of InsR, Insulin-like Growth Factor-1 Receptor
          (IGF-1R), and similar proteins. PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. InsR and
          IGF-1R are receptor tyr kinases (RTKs) composed of two
          alphabeta heterodimers. Binding of the ligand (insulin,
          IGF-1, or IGF-2) to the extracellular alpha subunit
          activates the intracellular tyr kinase domain of the
          transmembrane beta subunit. Receptor activation leads
          to autophosphorylation, stimulating downstream kinase
          activities, which initiate signaling cascades and
          biological function. InsR and IGF-1R, which share 84%
          sequence identity in their kinase domains, display
          physiologically distinct yet overlapping functions in
          cell growth, differentiation, and metabolism. InsR
          activation leads primarily to metabolic effects while
          IGF-1R activation stimulates mitogenic pathways. In
          cells expressing both receptors, InsR/IGF-1R hybrids
          are found together with classical receptors. Both
          receptors can interact with common adaptor molecules
          such as IRS-1 and IRS-2.
          Length = 277

 Score = 34.6 bits (80), Expect = 0.030
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 5/37 (13%)

Query: 7  NKYRLGRKIGSGSFGDIYLGT--NISTGE---EVAIK 38
           K  L R++G GSFG +Y G    +  GE    VAIK
Sbjct: 6  EKITLIRELGQGSFGMVYEGLAKGVVKGEPETRVAIK 42


>gnl|CDD|225023 COG2112, COG2112, Predicted Ser/Thr protein kinase [Signal
           transduction mechanisms].
          Length = 201

 Score = 33.9 bits (78), Expect = 0.039
 Identities = 32/153 (20%), Positives = 59/153 (38%), Gaps = 27/153 (17%)

Query: 3   LRVGNKYRLG--RKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQ 60
                KY L   +++  G+   +YLG     G EVA+K+    +    L  E+KI +++ 
Sbjct: 16  NVEEGKYELRVEKELAKGTTSVVYLGE--WRGGEVALKVRRRDSPRRNLEKEAKILEILA 73

Query: 61  GGVGIPQIKWCGSEGDYNVMVME-LLGPSLEDLFNFCSRR---------FSLKTVLLLAD 110
           G    P++ + G     + + ME + G  L  L     R+         + L  + +   
Sbjct: 74  GEGVTPEVYFYG----EDFIRMEYIDGRPLGKLEIGGDRKHLLRVLEKAYKLDRLGIEHG 129

Query: 111 QLS------ITAPG---IIDQEQKSVMVVGTNI 134
           +LS      +       IID +  +      N+
Sbjct: 130 ELSRPWKNVLVNDRDVYIIDFDSATFKKKPRNV 162



 Score = 27.8 bits (62), Expect = 4.4
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 5/70 (7%)

Query: 136 TGEEVAIKLECIKTRHPQLHIESKIYKLMQGGVGIPQIKWCGSEGDYNVMVME-LLGPSL 194
            G EVA+K+    +    L  E+KI +++ G    P++ + G     + + ME + G  L
Sbjct: 44  RGGEVALKVRRRDSPRRNLEKEAKILEILAGEGVTPEVYFYG----EDFIRMEYIDGRPL 99

Query: 195 EDLFNFCSRR 204
             L     R+
Sbjct: 100 GKLEIGGDRK 109


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
          Protein Tyrosine Kinase (PTK) family, catalytic domain.
          This PTKc family is part of a larger superfamily that
          includes the catalytic domains of protein
          serine/threonine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. They can
          be classified into receptor and non-receptor tyr
          kinases. PTKs play important roles in many cellular
          processes including, lymphocyte activation, epithelium
          growth and maintenance, metabolism control,
          organogenesis regulation, survival, proliferation,
          differentiation, migration, adhesion, motility, and
          morphogenesis. Receptor tyr kinases (RTKs) are integral
          membrane proteins which contain an extracellular
          ligand-binding region, a transmembrane segment, and an
          intracellular tyr kinase domain. RTKs are usually
          activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain, leading to
          intracellular signaling. Some RTKs are orphan receptors
          with no known ligands. Non-receptor (or cytoplasmic)
          tyr kinases are distributed in different intracellular
          compartments and are usually multi-domain proteins
          containing a catalytic tyr kinase domain as well as
          various regulatory domains such as SH3 and SH2. PTKs
          are usually autoinhibited and require a mechanism for
          activation. In many PTKs, the phosphorylation of tyr
          residues in the activation loop is essential for
          optimal activity. Aberrant expression of PTKs is
          associated with many development abnormalities and
          cancers.
          Length = 262

 Score = 34.0 bits (79), Expect = 0.041
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 3/29 (10%)

Query: 13 RKIGSGSFGDIYLGT---NISTGEEVAIK 38
          +K+G G+FG++Y G          EVA+K
Sbjct: 1  KKLGEGAFGEVYKGKLKGKDGKTTEVAVK 29


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
          Protein Serine/Threonine Kinases.  Serine/threonine
          kinases (STKs), Nak1 subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The Nak1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of Schizosaccharomyces pombe Nak1,
          Saccharomyces cerevisiae Kic1p (kinase that interacts
          with Cdc31p) and related proteins. Nak1 (also known as
          N-rich kinase 1), is required by fission yeast for
          polarizing the tips of actin cytoskeleton and is
          involved in cell growth, cell separation, cell
          morphology and cell-cycle progression. Kic1p is
          required by budding yeast for cell integrity and
          morphogenesis. Kic1p interacts with Cdc31p, the yeast
          homologue of centrin, and phosphorylates substrates in
          a Cdc31p-dependent manner.
          Length = 277

 Score = 34.0 bits (78), Expect = 0.046
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          Y+    IG G++G +Y G ++ TG  VA+K+
Sbjct: 3  YQRLELIGRGAYGAVYRGKHVPTGRVVALKI 33


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          3.  Serine/threonine kinases (STKs), thousand-and-one
          amino acids 3 (TAO3) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The TAO subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. TAO proteins
          possess mitogen-activated protein kinase (MAPK) kinase
          kinase (MAPKKK or MAP3K or MKKK) activity. MAPK
          signaling cascades are important in mediating cellular
          responses to extracellular signals. TAO3 is also known
          as JIK (JNK inhibitory kinase) or KFC (kinase from
          chicken). It specifically activates c-Jun N-terminal
          kinase (JNK), presumably by phosphorylating and
          activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3
          is a component of the RAM (regulation of Ace2p activity
          and cellular morphogenesis) signaling pathway. TAO3 is
          upregulated in retinal ganglion cells after axotomy,
          and may play a role in apoptosis.
          Length = 313

 Score = 33.8 bits (77), Expect = 0.049
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIK 38
          +IG GSFG +Y  TN  T E VA+K
Sbjct: 28 EIGHGSFGAVYFATNSHTNEVVAVK 52


>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like
          Protein Tyrosine Kinases.  Protein Tyrosine Kinase
          (PTK) family; Src kinase subfamily; catalytic (c)
          domain. Src subfamily members include Src, Lck, Hck,
          Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Src (or
          c-Src) proteins are cytoplasmic (or non-receptor) tyr
          kinases which are anchored to the plasma membrane. They
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. They were identified as the first
          proto-oncogene products, and they regulate cell
          adhesion, invasion, and motility in cancer cells and
          tumor vasculature, contributing to cancer progression
          and metastasis. Src kinases are overexpressed in a
          variety of human cancers, making them attractive
          targets for therapy. They are also implicated in acute
          inflammatory responses and osteoclast function. Src,
          Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
          Hck, Fgr, and Lyn show a limited expression pattern.
          Length = 261

 Score = 33.4 bits (77), Expect = 0.061
 Identities = 14/30 (46%), Positives = 24/30 (80%), Gaps = 3/30 (10%)

Query: 10 RLGRKIGSGSFGDIYLGT-NISTGEEVAIK 38
          +L RK+G+G FG++++GT N +T  +VA+K
Sbjct: 9  KLERKLGAGQFGEVWMGTWNGTT--KVAVK 36


>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, p21-activated kinase 1.
          Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) 1, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PAK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PAKs are Rho family
          GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs from higher eukaryotes are classified
          into two groups (I and II), according to their
          biochemical and structural features. PAK1 belongs to
          group I. Group I PAKs contain a PBD (p21-binding
          domain) overlapping with an AID (autoinhibitory
          domain), a C-terminal catalytic domain, SH3 binding
          sites and a non-classical SH3 binding site for PIX
          (PAK-interacting exchange factor). PAK1 is important in
          the regulation of many cellular processes including
          cytoskeletal dynamics, cell motility, growth, and
          proliferation. Although PAK1 has been regarded mainly
          as a cytosolic protein, recent reports indicate that
          PAK1 also exists in significant amounts in the nucleus,
          where it is involved in transcription modulation and in
          cell cycle regulatory events. PAK1 is also involved in
          transformation and tumorigenesis. Its overexpression,
          hyperactivation and increased nuclear accumulation is
          correlated to breast cancer invasiveness and
          progression. Nuclear accumulation is also linked to
          tamoxifen resistance in breast cancer cells.
          Length = 296

 Score = 33.5 bits (76), Expect = 0.065
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY    KIG G+ G +Y   +++TG+EVAI+
Sbjct: 21 KYTRFEKIGQGASGTVYTAMDVATGQEVAIR 51


>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; C-terminal Src kinase (Csk)
          subfamily; catalytic (c) domain. The Csk subfamily is
          composed of Csk, Chk, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Csk
          subfamily kinases are cytoplasmic (or nonreceptor) tyr
          kinases containing the Src homology domains, SH3 and
          SH2, N-terminal to the catalytic tyr kinase domain.
          They negatively regulate the activity of Src kinases
          that are anchored to the plasma membrane. To inhibit
          Src kinases, Csk and Chk are translocated to the
          membrane via binding to specific transmembrane
          proteins, G-proteins, or adaptor proteins near the
          membrane. Csk catalyzes the tyr phosphorylation of the
          regulatory C-terminal tail of Src kinases, resulting in
          their inactivation. Chk inhibit Src kinases using a
          noncatalytic mechanism by simply binding to them. As
          negative regulators of Src kinases, Csk and Chk play
          important roles in cell proliferation, survival, and
          differentiation, and consequently, in cancer
          development and progression.
          Length = 256

 Score = 33.1 bits (76), Expect = 0.072
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 4/33 (12%)

Query: 11 LGRKIGSGSFGDIYLGTNISTGEEVAIKLECIK 43
          LG  IG G FGD+ LG     G++VA+K  C+K
Sbjct: 10 LGATIGKGEFGDVMLGD--YRGQKVAVK--CLK 38


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase 15.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK15 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. Human MAPK15 is also called Extracellular
          signal Regulated Kinase 8 (ERK8) while the rat protein
          is called ERK7. ERK7 and ERK8 display both similar and
          different biochemical properties. They
          autophosphorylate and activate themselves and do not
          require upstream activating kinases. ERK7 is
          constitutively active and is not affected by
          extracellular stimuli whereas ERK8 shows low basal
          activity and is activated by DNA-damaging agents. ERK7
          and ERK8 also have different substrate profiles. Genome
          analysis shows that they are orthologs with similar
          gene structures. ERK7 and ERK 8 may be involved in the
          signaling of some nuclear receptor transcription
          factors. ERK7 regulates hormone-dependent degradation
          of estrogen receptor alpha while ERK8 down-regulates
          the transcriptional co-activation androgen and
          glucocorticoid receptors.
          Length = 337

 Score = 33.3 bits (77), Expect = 0.089
 Identities = 11/37 (29%), Positives = 22/37 (59%)

Query: 2  ELRVGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +  +  KY + +K+G G++G ++   +  T E VA+K
Sbjct: 2  DKHILRKYEILQKLGKGAYGIVWKAIDRRTKEVVALK 38


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          1.  Serine/threonine kinases (STKs), thousand-and-one
          amino acids 1 (TAO1) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The TAO subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. TAO proteins
          possess mitogen-activated protein kinase (MAPK) kinase
          kinase (MAPKKK or MAP3K or MKKK) activity. MAPK
          signaling cascades are important in mediating cellular
          responses to extracellular signals. TAO1 is sometimes
          referred to as prostate-derived sterile 20-like kinase
          2 (PSK2). TAO1 activates the p38 MAPK through direct
          interaction with and activation of MEK3. TAO1 is highly
          expressed in the brain and may play a role in neuronal
          apoptosis. TAO1 interacts with the checkpoint proteins
          BubR1 and Mad2, and plays an important role in
          regulating mitotic progression, which is required for
          both chromosome congression and checkpoint-induced
          anaphase delay. TAO1 may play a role in protecting
          genomic stability.
          Length = 317

 Score = 32.8 bits (74), Expect = 0.11
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIK 38
          R+IG GSFG +Y   ++ T E VAIK
Sbjct: 31 REIGHGSFGAVYFARDVRTNEVVAIK 56


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 32.7 bits (75), Expect = 0.11
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIK 38
           KIG G++G +Y   +  TGE VAIK
Sbjct: 5  GKIGEGTYGVVYKARDKLTGEIVAIK 30


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
          Serine/Threonine Kinase, p21-activated kinase 2.
          Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) 2, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PAK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PAKs are Rho family
          GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs from higher eukaryotes are classified
          into two groups (I and II), according to their
          biochemical and structural features. PAK2 belongs to
          group I. Group I PAKs contain a PBD (p21-binding
          domain) overlapping with an AID (autoinhibitory
          domain), a C-terminal catalytic domain, SH3 binding
          sites and a non-classical SH3 binding site for PIX
          (PAK-interacting exchange factor). PAK2 plays a role in
          pro-apoptotic signaling. It is cleaved and activated by
          caspases leading to morphological changes during
          apoptosis. PAK2 is also activated in response to a
          variety of stresses including DNA damage,
          hyperosmolarity, serum starvation, and contact
          inhibition, and may play a role in coordinating the
          stress response. PAK2 also contributes to cancer cell
          invasion through a mechanism distinct from that of
          PAK1.
          Length = 296

 Score = 32.8 bits (74), Expect = 0.12
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY    KIG G+ G ++   +++TG+EVAIK
Sbjct: 20 KYTRYEKIGQGASGTVFTAIDVATGQEVAIK 50


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
          Kinase,  Extracellular signal-Regulated Kinase 5.
          Serine/Threonine Kinases (STKs), Extracellular
          signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ERK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7,
          has a unique C-terminal extension, making it
          approximately twice as big as other MAPKs. This
          extension contains transcriptional activation
          capability which is inhibited by the N-terminal half.
          ERK5 is activated in response to growth factors and
          stress by a cascade that leads to its phosphorylation
          by the MAP2K MEK5, which in turn is regulated by the
          MAP3Ks MEKK2 and MEKK3. Activated ERK5 phosphorylates
          its targets including myocyte enhancer factor 2 (MEF2),
          Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
          cell proliferation during the G1/S phase transition.
          Studies on knockout mice revealed that ERK5 is
          essential for cardiovascular development and plays an
          important role in angiogenesis. It is also critical for
          neural differentiation and survival. The ERK5 pathway
          has been implicated in the pathogenesis of many
          diseases including cancer, cardiac hypertrophy, and
          atherosclerosis.
          Length = 334

 Score = 32.7 bits (75), Expect = 0.12
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 4  RVGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
           VG++Y+    IGSG++G +    +  +G++VAIK
Sbjct: 2  DVGSRYKPIENIGSGAYGVVCSAIDTRSGKKVAIK 36


>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
          Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          3 (MEKK3) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK3 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MEKK3 is a
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MKKK or MAP3K), that phosphorylates and
          activates the MAPK kinase MEK5 (or MKK5), which in turn
          phosphorylates and activates extracellular
          signal-regulated kinase 5 (ERK5). The ERK5 cascade
          plays roles in promoting cell proliferation,
          differentiation, neuronal survival, and
          neuroprotection. MEKK3 plays an essential role in
          embryonic angiogenesis and early heart development. In
          addition, MEKK3 is involved in interleukin-1 receptor
          and Toll-like receptor 4 signaling. It is also a
          specific regulator of the proinflammatory cytokines
          IL-6 and GM-CSF in some immune cells. MEKK3 also
          regulates calcineurin, which plays a critical role in T
          cell activation, apoptosis, skeletal myocyte
          differentiation, and cardiac hypertrophy.
          Length = 266

 Score = 32.7 bits (74), Expect = 0.13
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +R G+ +G G+FG +YL  ++ TG E+A K
Sbjct: 4  WRRGKLLGQGAFGRVYLCYDVDTGRELAAK 33


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Apoptosis signal-regulating
          kinase.  Serine/threonine kinases (STKs), Apoptosis
          signal-regulating kinase (ASK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ASK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Subfamily members are
          mitogen-activated protein kinase (MAPK) kinase kinases
          (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2,
          and MAPKKK15. MAPKKKs phosphorylate and activate MAPK
          kinases (MAPKKs or MKKs or MAP2Ks), which in turn
          phosphorylate and activate MAPKs during signaling
          cascades that are important in mediating cellular
          responses to extracellular signals. ASK1 (also called
          MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
          and p38 MAPK signaling pathways by directly activating
          their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
          plays important roles in cytokine and stress responses,
          as well as in reactive oxygen species (ROS)-mediated
          cellular responses. ASK1 is implicated in various
          diseases mediated by oxidative stress including
          inschemic heart disease, hypertension, vessel injury,
          brain ischemia, Fanconi anemia, asthma, and pulmonary
          edema, among others. ASK2 (also called MAPKKK6)
          functions only in a heteromeric complex with ASK1, and
          can activate ASK1 by direct phosphorylation. The
          function of MAPKKK15 is still unknown.
          Length = 268

 Score = 32.1 bits (73), Expect = 0.16
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 15 IGSGSFGDIYLGTNISTGEEVAIK-LECIKTRHPQ-LHIESKIYKLMQGGVGIPQIKWCG 72
          +G G++G +Y   ++ST   +AIK +    +R+ Q LH E  ++  ++    I Q     
Sbjct: 16 LGKGTYGIVYAARDLSTQVRIAIKEIPERDSRYVQPLHEEIALHSYLKHR-NIVQYLGSD 74

Query: 73 SEGDYNVMVMELL-GPSLEDL 92
          SE  +  + ME + G SL  L
Sbjct: 75 SENGFFKIFMEQVPGGSLSAL 95


>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine
          Kinase, Focal Adhesion Kinase.  Protein Tyrosine Kinase
          (PTK) family; Focal Adhesion Kinase (FAK); catalytic
          (c) domain. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. FAK is a cytoplasmic (or nonreceptor) tyr
          kinase that contains an autophosphorylation site and a
          FERM domain at the N-terminus, a central tyr kinase
          domain, proline-rich regions, and a C-terminal FAT
          (focal adhesion targeting) domain. FAK activity is
          dependent on integrin-mediated cell adhesion, which
          facilitates N-terminal autophosphorylation. Full
          activation is achieved by the phosphorylation of its
          two adjacent A-loop tyrosines. FAK is important in
          mediating signaling initiated at sites of cell
          adhesions and at growth factor receptors. Through
          diverse molecular interactions, FAK functions as a
          biosensor or integrator to control cell motility. It is
          a key regulator of cell survival, proliferation,
          migration and invasion, and thus plays an important
          role in the development and progression of cancer. Src
          binds to autophosphorylated FAK forming the FAK-Src
          dual kinase complex, which is activated in a wide
          variety of tumor cells and generates signals promoting
          growth and metastasis. FAK is being developed as a
          target for cancer therapy.
          Length = 270

 Score = 32.4 bits (74), Expect = 0.16
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 11 LGRKIGSGSFGDIYLGTNISTGEE---VAIK 38
          LGR IG G FGD+Y G  +S   E   VA+K
Sbjct: 10 LGRCIGEGQFGDVYQGVYMSPENEKIAVAVK 40


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
          Serine/Threonine Kinase, Thousand-and-one amino acids
          2.  Serine/threonine kinases (STKs), thousand-and-one
          amino acids 2 (TAO2) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The TAO subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. TAO proteins
          possess mitogen-activated protein kinase (MAPK) kinase
          kinase (MAPKKK or MAP3K or MKKK) activity. MAPK
          signaling cascades are important in mediating cellular
          responses to extracellular signals. Human TAO2 is also
          known as prostate-derived Ste20-like kinase (PSK) and
          was identified in a screen for overexpressed RNAs in
          prostate cancer. TAO2 activates both p38 and c-Jun
          N-terminal kinase (JNK), by phosphorylating and
          activating the respective MAP/ERK kinases (MEKs, also
          known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. TAO2
          contains a long C-terminal extension with
          autoinhibitory segments. It is activated by the release
          of this inhibition and the phosphorylation of its
          activation loop serine. TAO2 functions as a regulator
          of actin cytoskeletal and microtubule organization. In
          addition, it regulates the transforming growth
          factor-activated kinase 1 (TAK1), which is a MAPKKK
          that plays an essential role in the signaling pathways
          of tumor necrosis factor (TNF), interleukin 1 (IL-1),
          and Toll-like receptor (TLR).
          Length = 308

 Score = 32.3 bits (73), Expect = 0.16
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIK 38
          R+IG GSFG +Y   ++   E VAIK
Sbjct: 21 REIGHGSFGAVYFARDVRNSEVVAIK 46


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 2.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek2 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The Nek2 subfamily includes
          Aspergillus nidulans NIMA kinase, the founding member
          of the Nek family, which was identified in a screen for
          cell cycle mutants prevented from entering mitosis.
          NIMA is essential for mitotic entry and progression
          through mitosis, and its degradation is essential for
          mitotic exit. NIMA is involved in nuclear membrane
          fission. Vertebrate Nek2 is a cell cycle-regulated STK,
          localized in centrosomes and kinetochores, that
          regulates centrosome splitting at the G2/M phase. It
          also interacts with other mitotic kinases such as
          Polo-like kinase 1 and may play a role in spindle
          checkpoint. An increase in the expression of the human
          NEK2 gene is strongly associated with the progression
          of non-Hodgkin lymphoma.
          Length = 265

 Score = 31.8 bits (73), Expect = 0.25
 Identities = 10/31 (32%), Positives = 14/31 (45%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
           Y +   IG GSFG +      S G+ +  K
Sbjct: 1  DYEVLETIGKGSFGTVRKVRRKSDGKILVWK 31


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of
          Microtubule-associated serine/threonine kinase-like
          proteins.  Serine/Threonine Kinases (STKs),
          Microtubule-associated serine/threonine (MAST) kinase
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAST kinase subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The MAST kinase subfamily
          includes MAST kinases, MAST-like (MASTL) kinases, and
          fungal kinases with similarity to Saccharomyces
          cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
          MAST kinases contain an N-terminal domain of unknown
          function, a central catalytic domain, and a C-terminal
          PDZ domain that mediates protein-protein interactions.
          MASTL kinases carry only a catalytic domain which
          contains a long insert relative to other kinases. The
          fungal kinases in this subfamily harbor other domains
          in addition to a central catalytic domain, which also
          contains an insert relative to MAST kinases like MASTL.
          Rim15 contains a C-terminal signal receiver (REC)
          domain while cek1 contains an N-terminal PAS domain.
          MAST kinases are cytoskeletal associated kinases of
          unknown function that are also expressed at
          neuromuscular junctions and postsynaptic densities. The
          fungal proteins Rim15 and cek1 are involved in the
          regulation of meiosis and mitosis, respectively.
          Length = 265

 Score = 31.4 bits (72), Expect = 0.26
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 15 IGSGSFGDIYLGTNISTGEEVAIK 38
          I  G++G ++L    STG+  AIK
Sbjct: 1  ISKGAYGRVFLAKKKSTGDIYAIK 24


>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Fes subfamily; catalytic (c) domain. Fes
          subfamily members include Fes (or Fps), Fer, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Fes subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal
          region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
          domains, followed by a SH2 domain, and a C-terminal
          catalytic domain. The genes for Fes (feline sarcoma)
          and Fps (Fujinami poultry sarcoma) were first isolated
          from tumor-causing retroviruses. The viral oncogenes
          encode chimeric Fes proteins consisting of Gag
          sequences at the N-termini, resulting in unregulated
          tyr kinase activity. Fes and Fer kinases play roles in
          haematopoiesis, inflammation and immunity, growth
          factor signaling, cytoskeletal regulation, cell
          migration and adhesion, and the regulation of cell-cell
          interactions. Fes and Fer show redundancy in their
          biological functions.
          Length = 251

 Score = 31.3 bits (71), Expect = 0.31
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQGG 62
           KIG G+FGD+Y G  +    EVA+K  C  T  P L       K +Q  
Sbjct: 1  EKIGKGNFGDVYKGV-LKGNTEVAVK-TCRSTLPPDLKR-----KFLQEA 43


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 5.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 5 (CDK5) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK5 is unusual in that it is regulated by
          non-cyclin proteins, p35 and p39. It is highly
          expressed in the nervous system and is critical in
          normal neural development and function. It plays a role
          in neuronal migration and differentiation, and is also
          important in synaptic plasticity and learning. CDK5
          also participates in protecting against cell death and
          promoting angiogenesis. Impaired CDK5 activity is
          implicated in Alzheimer's disease, amyotrophic lateral
          sclerosis, Parkinson's disease, Huntington's disease
          and acute neuronal injury.
          Length = 284

 Score = 31.2 bits (71), Expect = 0.32
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY    KIG G++G ++   N  T E VA+K
Sbjct: 1  KYEKLEKIGEGTYGTVFKAKNRETHEIVALK 31


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, STK25 or Yeast
          Sps1/Ste20-related kinase 1.  Serine/threonine kinases
          (STKs), STK25 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The STK25 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. STK25 is also
          called Ste20/oxidant stress response kinase 1 (SOK1) or
          yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is
          localized in the Golgi apparatus through its
          interaction with the Golgi matrix protein GM130. It may
          play a role in the regulation of cell migration and
          polarization. STK25 binds and phosphorylates CCM3
          (cerebral cavernous malformation 3), also called PCD10
          (programmed cell death 10), and may play a role in
          apoptosis. Human STK25 is a candidate gene responsible
          for pseudopseudohypoparathyroidism (PPHP), a disease
          that shares features with the Albright hereditary
          osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 31.2 bits (70), Expect = 0.32
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIKL 39
          +IG GSFG++Y G +  T E VAIK+
Sbjct: 11 RIGKGSFGEVYKGIDNRTKEVVAIKI 36


>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the
          Serine/Threonine Kinase, Plant B-type Cyclin-Dependent
          protein Kinase.  Serine/Threonine Kinases (STKs), Plant
          B-type Cyclin-Dependent protein Kinase (CdkB)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CdkB subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. The plant-specific B-type CDKs are expressed
          from the late S to the M phase of the cell cycle. They
          are characterized by the cyclin binding motif
          PPT[A/T]LRE. They play a role in controlling mitosis
          and integrating developmental pathways, such as stomata
          and leaf development. CdkB has been shown to associate
          with both cyclin B, which controls G2/M transition, and
          cyclin D, which acts as a mediator in linking
          extracellular signals to the cell cycle.
          Length = 295

 Score = 31.3 bits (71), Expect = 0.33
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 4/39 (10%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTR 45
          + Y    KIG G++G +Y   + +TG+ VA+K    KTR
Sbjct: 1  DAYEKLEKIGEGTYGKVYKARDKNTGKLVALK----KTR 35


>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 1 from higher
          eukaryotes-like.  Serine/Threonine Kinases (STKs),
          Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes. CDK1 is also called Cell division
          control protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression.
          CDK1/cyclin A2 has also been implicated as an important
          regulator of S phase events. The CDK1/cyclin B complex
          is critical for G2 to M phase transition. It induces
          mitosis by activating nuclear enzymes that regulate
          chromatin condensation, nuclear membrane degradation,
          mitosis-specific microtubule and cytoskeletal
          reorganization. CDK1 also associates with cyclin E and
          plays a role in the entry into S phase. CDK1
          transcription is stable throughout the cell cycle but
          is modulated in some pathological conditions. It may
          play a role in regulating apoptosis under these
          conditions. In breast cancer cells, HER2 can mediate
          apoptosis by inactivating CDK1. Activation of CDK1 may
          contribute to HIV-1 induced apoptosis and neuronal
          apoptosis in neurodegenerative diseases.
          Length = 285

 Score = 31.2 bits (71), Expect = 0.35
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIK 38
          KIG G++G +Y G N  TG+ VA+K
Sbjct: 7  KIGEGTYGVVYKGRNKKTGQIVAMK 31


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
          signal-Regulated Kinase 1 and 2-like Serine/Threonine
          Kinases.  Serine/Threonine Kinases (STKs),
          Extracellular signal-regulated kinases 1 and 2 (ERK1/2)
          and Fus3 subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. This
          ERK1/2-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of the mitogen-activated protein kinases (MAPKs) ERK1,
          ERK2, baker's yeast Fus3, and similar proteins. MAPK
          pathways are important mediators of cellular responses
          to extracellular signals. ERK1/2 activation is
          preferentially by mitogenic factors, differentiation
          stimuli, and cytokines, through a kinase cascade
          involving the MAPK kinases MEK1/2 and a MAPK kinase
          kinase from the Raf family. ERK1/2 have numerous
          substrates, many of which are nuclear and participate
          in transcriptional regulation of many cellular
          processes. They regulate cell growth, cell
          proliferation, and cell cycle progression from G1 to S
          phase. Although the distinct roles of ERK1 and ERK2
          have not been fully determined, it is known that ERK2
          can maintain most functions in the absence of ERK1, and
          that the deletion of ERK2 is embryonically lethal. The
          MAPK, Fus3, regulates yeast mating processes including
          mating-specific gene expression, G1 arrest, mating
          projection, and cell fusion.
          Length = 336

 Score = 31.1 bits (71), Expect = 0.36
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 5  VGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          VG +Y+    IG G++G +   T+  TG +VAIK
Sbjct: 3  VGPRYQNLSYIGEGAYGMVCSATHKPTGVKVAIK 36


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TEY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TEY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TEY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. There are two subtypes of plant
          MAPKs based on the conserved phosphorylation motif
          present in the activation loop, TEY and TDY. This
          subfamily represents the TEY subtype and is further
          subdivided into three groups (A, B, and C). Group A is
          represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
          (NtNTF4), among others. They are mostly involved in
          environmental and hormonal responses. AtMPK3 and
          AtMPK6 are also key regulators for stomatal development
          and patterning. Group B is represented by AtMPK4,
          AtMPK13, and NtNTF6, among others. They may be involved
          in both cell division and environmental stress
          response. AtMPK4 also participates in regulating innate
          immunity. Group C is represented by AtMPK1, AtMPK2,
          NtNTF3, Oryza sativa MAPK4 (OsMAPK4), among others.
          They may also be involved in stress responses. AtMPK1
          and AtMPK2 are activated following mechanical injury
          and in the presence of stress chemicals such as
          jasmonic acid, hydrogen peroxide and abscisic acid.
          OsMAPK4 is also called OsMSRMK3 for Multiple
          Stress-Responsive MAPK3.
          Length = 337

 Score = 31.2 bits (71), Expect = 0.38
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 5  VGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          V  KY   + IG G++G +    N  T E+VAIK
Sbjct: 3  VDTKYVPIKPIGRGAYGIVCSAKNSETNEKVAIK 36


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
          Serine/Threonine Kinase, Group II p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
          (PAK) subfamily, Group II, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The PAK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. PAKs are Rho
          family GTPase-regulated kinases that serve as important
          mediators in the function of Cdc42 (cell division cycle
          42) and Rac. PAKs from higher eukaryotes are classified
          into two groups (I and II), according to their
          biochemical and structural features. Group II PAKs,
          also called non-conventional PAKs, include PAK4, PAK5,
          and PAK6. Group II PAKs contain PBD (p21-binding
          domain) and catalytic domains, but lack other motifs
          found in group I PAKs, such as an AID (autoinhibitory
          domain) and SH3 binding sites. Since group II PAKs do
          not contain an obvious AID, they may be regulated
          differently from group I PAKs. While group I PAKs
          interact with the SH3 containing proteins Nck, Grb2 and
          PIX, no such binding has been demonstrated for group II
          PAKs. Some known substrates of group II PAKs are also
          substrates of group I PAKs such as Raf, BAD, LIMK and
          GEFH1. Unique group II substrates include MARK/Par-1
          and PDZ-RhoGEF. Group II PAKs play important roles in
          filopodia formation, neuron extension, cytoskeletal
          organization, and cell survival.
          Length = 285

 Score = 31.3 bits (71), Expect = 0.39
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 8  KYRLGR--KIGSGSFGDIYLGTNISTGEEVAIK 38
          +  L    KIG GS G + + T+ STG +VA+K
Sbjct: 18 RSYLDNFVKIGEGSTGIVCIATDKSTGRQVAVK 50


>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase,
           Csk homologous kinase.  Protein Tyrosine Kinase (PTK)
           family; Csk homologous kinase (Chk); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Csk
           subfamily kinases are cytoplasmic (or nonreceptor) tyr
           kinases containing the Src homology domains, SH3 and
           SH2, N-terminal to the catalytic tyr kinase domain. They
           negatively regulate the activity of Src kinases that are
           anchored to the plasma membrane. Chk is also referred to
           as megakaryocyte-associated tyrosine kinase (Matk). To
           inhibit Src kinases, Chk is translocated to the membrane
           via binding to specific transmembrane proteins,
           G-proteins, or adaptor proteins near the membrane. Chk
           inhibit Src kinases using a noncatalytic mechanism by
           simply binding to them. As a negative regulator of Src
           kinases, Chk may play important roles in cell
           proliferation, survival, and differentiation, and
           consequently, in cancer development and progression. Chk
           is expressed in brain and hematopoietic cells. Studies
           in mice reveal that Chk is not functionally redundant
           with Csk and that it plays an important role as a
           regulator of immune responses. Chk also plays a role in
           neural differentiation in a manner independent of Src by
           enhancing Mapk activation via Ras-mediated signaling.
          Length = 254

 Score = 31.1 bits (70), Expect = 0.39
 Identities = 42/143 (29%), Positives = 66/143 (46%), Gaps = 14/143 (9%)

Query: 8   KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK-LECIKTRHPQLHIESKIYKLMQGGVGIP 66
           K  LG  IG G FG +  G    TG++VA+K ++C  T    L   + + KL    + + 
Sbjct: 7   KLTLGEIIGEGEFGAVLQGE--YTGQKVAVKNIKCDVTAQAFLEETAVMTKLHHKNL-VR 63

Query: 67  QIKWCGSEGDYNVMVMELLGPSLEDLFNFC-SR-RFSLKTVLLLADQLSITAPGIIDQEQ 124
            +      G Y  +VMEL+  S  +L NF  +R R  +  + LL   L + A G+   E 
Sbjct: 64  LLGVILHNGLY--IVMELM--SKGNLVNFLRTRGRALVSVIQLLQFSLDV-AEGMEYLES 118

Query: 125 KSVM---VVGTNISTGEEVAIKL 144
           K ++   +   NI   E+   K+
Sbjct: 119 KKLVHRDLAARNILVSEDGVAKV 141


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
          dual-specificity MAP kinase kinases and similar
          proteins.  Protein kinases (PKs), MAP kinase kinase
          (MAPKK) subfamily, Plant MAPKKs and similar proteins,
          catalytic (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MAPKK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include MAPKKs from plants, kinetoplastids,
          alveolates, and mycetozoa. The MAPKK, LmxPK4, from
          Leishmania mexicana, is important in differentiation
          and virulence. Dictyostelium discoideum MEK1 is
          required for proper chemotaxis. MEK1 null mutants
          display severe defects in cell polarization and
          directional movement. Plants contain multiple MAPKKs
          like other eukaryotes. The Arabidopsis genome encodes
          for 10 MAPKKs while poplar and rice contain 13 MAPKKs
          each. The functions of these proteins have not been
          fully elucidated. There is evidence to suggest that
          MAPK cascades are involved in plant stress responses.
          In Arabidopsis, MKK3 plays a role in pathogen
          signaling, MKK2 is involved in cold and salt stress
          signaling, MKK4/MKK5 participates in innate immunity,
          and MKK7 regulates basal and systemic acquired
          resistance.
          Length = 264

 Score = 30.6 bits (70), Expect = 0.46
 Identities = 9/29 (31%), Positives = 15/29 (51%)

Query: 10 RLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
             + +G GS G +Y   +  TG+  A+K
Sbjct: 4  ERVKVLGQGSSGVVYKVRHKPTGKIYALK 32


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
          Protein Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Microtubule-associated serine/threonine
          (MAST) kinase subfamily, fungal Rim15-like kinases,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAST kinase
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this group
          include Saccharomyces cerevisiae Rim15,
          Schizosaccharomyces pombe cek1, and similar fungal
          proteins. They contain a central catalytic domain,
          which contains an insert relative to MAST kinases. In
          addition, Rim15 contains a C-terminal signal receiver
          (REC) domain while cek1 contains an N-terminal PAS
          domain. Rim15 (or Rim15p) functions as a regulator of
          meiosis. It acts as a downstream effector of PKA and
          regulates entry into stationary phase (G0). Thus, it
          plays a crucial role in regulating yeast proliferation,
          differentiation, and aging. Cek1 may facilitate
          progression of mitotic anaphase.
          Length = 260

 Score = 30.9 bits (70), Expect = 0.47
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIKL-----ECIKTRHPQLHIESKIYKLMQGGVGIPQ 67
          + I  G+FG +YL    STG+  AIK+        K +   +  E  I  +      + +
Sbjct: 2  KPISKGAFGSVYLAKKRSTGDYFAIKVLKKSDMIAKNQVTNVKAERAIMMIQGESPYVAK 61

Query: 68 IKWCGSEGDYNVMVMELL 85
          + +     DY  +VME L
Sbjct: 62 LYYSFQSKDYLYLVMEYL 79


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 1 (CDKL1) and CDKL4 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL1 and CDKL4
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL1, also called p42 KKIALRE, is a glial
          protein that is upregulated in gliosis. It is present
          in neuroblastoma and A431 human carcinoma cells, and
          may be implicated in neoplastic transformation. The
          function of CDKL4 is unknown.
          Length = 286

 Score = 30.8 bits (70), Expect = 0.51
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          KY    KIG GS+G ++   N  TG+ VAIK
Sbjct: 2  KYEKLSKIGEGSYGVVFKCRNRETGQIVAIK 32


>gnl|CDD|240167 cd05144, RIO2_C, RIO kinase family; RIO2, C-terminal catalytic
          domain. The RIO kinase catalytic domain family is part
          of a larger superfamily, that includes the catalytic
          domains of other kinases such as the typical
          serine/threonine/tyrosine protein kinases (PKs),
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). RIO kinases are
          atypical protein serine kinases containing a kinase
          catalytic signature, but otherwise show very little
          sequence similarity to typical PKs. Serine kinases
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine residues in protein substrates. The
          RIO catalytic domain is truncated compared to the
          catalytic domains of typical PKs, with deletions of the
          loops responsible for substrate binding. RIO2 is
          present in archaea and eukaryotes. It contains an
          N-terminal winged helix (wHTH) domain and a C-terminal
          RIO kinase catalytic domain. The wHTH domain is
          primarily seen in DNA-binding proteins, although some
          wHTH domains may be involved in RNA recognition. RIO2
          is essential for survival and is necessary for rRNA
          cleavage during 40S ribosomal subunit maturation. The
          biological substrates of RIO2 are still unknown.
          Length = 198

 Score = 30.6 bits (70), Expect = 0.52
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
            LG +IG G   D+YL  +   G  VA+K 
Sbjct: 17 ESLGNQIGVGKESDVYLALD-PDGNPVALKF 46


>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase 2 and 3.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK2/3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK2 is regulated by cyclin E or cyclin A.
          Upon activation by cyclin E, it phosphorylates the
          retinoblastoma (pRb) protein which activates E2F
          mediated transcription and allows cells to move into S
          phase. The CDK2/cyclin A complex plays a role in
          regulating DNA replication. CDK2, together with CDK4,
          also regulates embryonic cell proliferation. Despite
          these important roles, mice deleted for the cdk2 gene
          are viable and normal except for being sterile. This
          may be due to compensation provided by CDK1 (also
          called Cdc2), which can also bind cyclin E and drive
          the G1 to S phase transition. CDK3 is regulated by
          cyclin C and it phosphorylates pRB specifically during
          the G0/G1 transition. This phosphorylation is required
          for cells to exit G0 efficiently and enter the G1
          phase.
          Length = 284

 Score = 30.5 bits (69), Expect = 0.54
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIK 38
          KIG G++G +Y   N  TGE VA+K
Sbjct: 7  KIGEGTYGVVYKARNKLTGEVVALK 31


>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine
          Kinases, Srm and Brk.  Protein Tyrosine Kinase (PTK)
          family; Src-related kinase lacking C-terminal
          regulatory tyrosine and N-terminal myristylation sites
          (Srm) and breast tumor kinase (Brk, also called protein
          tyrosine kinase 6); catalytic (c) domains. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Srm and
          Brk are a member of the Src subfamily of proteins,
          which are cytoplasmic (or non-receptor) tyr kinases.
          Src kinases in general contain an N-terminal SH4 domain
          with a myristoylation site, followed by SH3 and SH2
          domains, a tyr kinase domain, and a regulatory
          C-terminal region containing a conserved tyr; they are
          activated by autophosphorylation at the tyr kinase
          domain, but are negatively regulated by phosphorylation
          at the C-terminal tyr by Csk (C-terminal Src Kinase).
          Srm and Brk however, lack the N-terminal myristylation
          sites. Src proteins are involved in signaling pathways
          that regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Brk has been found to be
          overexpressed in a majority of breast tumors.
          Length = 261

 Score = 30.5 bits (69), Expect = 0.55
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          + L RK+GSG FG+++ G        VAIK+
Sbjct: 8  FTLERKLGSGYFGEVWEGL-WKNRVRVAIKI 37


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
          Serine/Threonine Kinases, TDY Mitogen-Activated Protein
          Kinases from Plants.  Serine/Threonine Kinases (STKs),
          Plant TDY Mitogen-Activated Protein Kinase (MAPK)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          TDY MAPK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. In plants, MAPKs are associated with
          physiological, developmental, hormonal, and stress
          responses. Some plants show numerous gene duplications
          of MAPKs. Arabidopsis thaliana harbors at least 20
          MAPKs, named AtMPK1-20. Oryza sativa contains at least
          17 MAPKs. There are two subtypes of plant MAPKs based
          on the conserved phosphorylation motif present in the
          activation loop, TEY and TDY. Arabidopsis thaliana
          contains more TEY-type MAPKs than TDY-type, whereas the
          reverse is true for Oryza sativa. This subfamily
          represents the TDY subtype and is composed of Group D
          plant MAPKs including Arabidopsis thaliana MPK18
          (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
          (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
          Zea mays MPK6, and the Medicago sativa TDY1 gene
          product. OsBWMK1 enhances resistance to pathogenic
          infections. It mediates stress-activated defense
          responses by activating a transcription factor that
          affects the expression of stress-related genes. AtMPK18
          is involved in microtubule-related functions.
          Length = 338

 Score = 30.5 bits (69), Expect = 0.56
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +Y++   IG GS+G +    +  TGE+VAIK
Sbjct: 1  RYKIQEVIGKGSYGVVCSAIDTHTGEKVAIK 31


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine
          Kinase, p38 Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), p38 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The p38 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They function in the regulation
          of the cell cycle, cell development, cell
          differentiation, senescence, tumorigenesis, apoptosis,
          pain development and pain progression, and immune
          responses. p38 kinases are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. p38 substrates include other protein kinases
          and factors that regulate transcription, nuclear
          export, mRNA stability and translation. p38 kinases are
          drug targets for the inflammatory diseases psoriasis,
          rheumatoid arthritis, and chronic pulmonary disease.
          Vertebrates contain four isoforms of p38, named alpha,
          beta, gamma, and delta, which show varying substrate
          specificity and expression patterns. p38alpha and
          p38beta are ubiquitously expressed, p38gamma is
          predominantly found in skeletal muscle, and p38delta is
          found in the heart, lung, testis, pancreas, and small
          intestine.
          Length = 343

 Score = 30.7 bits (70), Expect = 0.57
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 5  VGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          V ++Y+    +GSG++G +    +  TG +VAIK
Sbjct: 13 VPDRYQNLSPVGSGAYGQVCSAFDTKTGRKVAIK 46


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 5.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek5 subfamily is one of a family of 11 different Neks
          (Nek1-11). The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Neks are
          involved in the regulation of downstream processes
          following the activation of Cdc2, and many of their
          functions are cell cycle-related. They play critical
          roles in microtubule dynamics during ciliogenesis and
          mitosis. The specific function of Nek5 is unknown.
          Length = 257

 Score = 30.3 bits (68), Expect = 0.70
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +Y + +KIG GSFG IYL    S  E   IK
Sbjct: 1  RYEIIKKIGEGSFGKIYLAKAKSDSEHCVIK 31


>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed.
          Length = 932

 Score = 30.5 bits (69), Expect = 0.74
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +Y + R IG G  G++YL  +      VA+K
Sbjct: 3  RYDIIRLIGKGGMGEVYLAYDPVCSRRVALK 33


>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Serum- and
          Glucocorticoid-induced Kinase.  Serine/Threonine
          Kinases (STKs), Serum- and Glucocorticoid-induced
          Kinase (SGK) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The SGK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. There are three
          isoforms of SGK, named SGK1, SGK2, and SGK3 (also
          called cytokine-independent survival kinase CISK). SGKs
          are activated by insulin and growth factors via
          phosphoinositide 3-kinase and PDK1. They activate ion
          channels, ion carriers, and the Na-K-ATPase, as well as
          regulate the activity of enzymes and transcription
          factors. SGKs play important roles in transport,
          hormone release, neuroexcitability, cell proliferation,
          and apoptosis.
          Length = 323

 Score = 30.1 bits (68), Expect = 0.75
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 15 IGSGSFGDIYLGTNISTGEEVAIKL---ECIKTRHPQLHI 51
          IG GSFG + L  + + G+  A+K+   + I  +  Q HI
Sbjct: 3  IGKGSFGKVLLAKHKADGKFYAVKVLQKKAILKKKEQKHI 42


>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
          Serine/Threonine Kinases, Mitogen-Activated Protein
          Kinase Kinase Kinase Kinase 4 and 6.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and
          MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAP4K4/MAP4K6 subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Members of this
          subfamily contain an N-terminal catalytic domain and a
          C-terminal citron homology (CNH) regulatory domain.
          MAP4Ks (or MAPKKKKs) are involved in MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K4 is also called Nck Interacting
          kinase (NIK). It facilitates the activation of the
          MAPKs, extracellular signal-regulated kinase (ERK) 1,
          ERK2, and c-Jun N-terminal kinase (JNK), by
          phosphorylating and activating MEKK1. MAP4K4 plays a
          role in tumor necrosis factor (TNF) alpha-induced
          insulin resistance. MAP4K4 silencing in skeletal muscle
          cells from type II diabetic patients restores
          insulin-mediated glucose uptake. MAP4K4, through JNK,
          also plays a broad role in cell motility, which impacts
          inflammation, homeostasis, as well as the invasion and
          spread of cancer. MAP4K4 is found to be highly
          expressed in most tumor cell lines relative to normal
          tissue. MAP4K6 (also called MINK for
          Misshapen/NIKs-related kinase) is activated after Ras
          induction and mediates activation of p38 MAPK. MAP4K6
          plays a role in cell cycle arrest, cytoskeleton
          organization, cell adhesion, and cell motility.
          Length = 282

 Score = 30.0 bits (67), Expect = 0.81
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          + L   +G+G++G +Y G ++ TG+  AIK+
Sbjct: 18 FELVEVVGNGTYGQVYKGRHVKTGQLAAIKV 48


>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Traf2- and Nck-interacting
          kinase.  Serine/threonine kinases (STKs), Traf2- and
          Nck-interacting kinase (TNIK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The TNIK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          mitogen-activated protein kinase (MAPK), kinase kinase
          kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in
          some MAPK signaling pathways by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an
          effector of Rap2, a small GTP-binding protein from the
          Ras family. TNIK specifically activates the c-Jun
          N-terminal kinase (JNK) pathway and plays a role in
          regulating the actin cytoskeleton.
          Length = 272

 Score = 30.1 bits (67), Expect = 0.89
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          + L   +G+G++G +Y G ++ TG+  AIK+
Sbjct: 8  FELVELVGNGTYGQVYKGRHVKTGQLAAIKV 38


>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
          Provisional.
          Length = 329

 Score = 29.8 bits (67), Expect = 1.0
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTR 45
          + +G  +G+GSFG + +  +  TGE  AIK  C+K R
Sbjct: 20 FEMGETLGTGSFGRVRIAKHKGTGEYYAIK--CLKKR 54


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein
          Serine/Threonine Kinase, cAMP-dependent protein kinase.
           Serine/Threonine Kinases (STKs), cAMP-dependent
          protein kinase (PKA) subfamily, catalytic (c) subunit.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The PKA subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          subfamily is composed of the cAMP-dependent proteins
          kinases, PKA and PRKX. The inactive PKA holoenzyme is a
          heterotetramer composed of two phosphorylated and
          active catalytic (C) subunits with a dimer of
          regulatory (R) subunits. Activation is achieved through
          the binding of the important second messenger cAMP to
          the R subunits, which leads to the dissociation of PKA
          into the R dimer and two active C subunits. PKA is
          present ubiquitously in cells and interacts with many
          different downstream targets. It plays a role in the
          regulation of diverse processes such as growth,
          development, memory, metabolism, gene expression,
          immunity, and lipolysis.
          Length = 290

 Score = 29.8 bits (68), Expect = 1.0
 Identities = 9/30 (30%), Positives = 18/30 (60%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +   + +G+GSFG + L  +  +G+  A+K
Sbjct: 3  FEFIKTLGTGSFGRVMLVRHKGSGKYYALK 32


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mammalian Ste20-like protein
          kinase 3.  Serine/threonine kinases (STKs), mammalian
          Ste20-like protein kinase 3 (MST3) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MST3 phosphorylates the STK
          NDR and may play a role in cell cycle progression and
          cell morphology. It may also regulate paxillin and
          consequently, cell migration. MST3 is present in human
          placenta, where it plays an essential role in the
          oxidative stress-induced apoptosis of trophoblasts in
          normal spontaneous delivery. Dysregulation of
          trophoblast apoptosis may result in pregnancy
          complications such as preeclampsia and intrauterine
          growth retardation.
          Length = 277

 Score = 29.7 bits (66), Expect = 1.3
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIKL 39
          KIG GSFG+++ G +  T + VAIK+
Sbjct: 11 KIGKGSFGEVFKGIDNRTQKVVAIKI 36


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 1-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK1 from
          higher eukaryotes, plants, and yeasts, as well as CDK2
          and CDK3. CDK1 is also called Cell division control
          protein 2 (Cdc2) or p34 protein kinase, and is
          regulated by cyclins A, B, and E. The CDK1/cyclin A
          complex controls G2 phase entry and progression while
          the CDK1/cyclin B complex is critical for G2 to M phase
          transition. CDK2 is regulated by cyclin E or cyclin A.
          Upon activation by cyclin E, it phosphorylates the
          retinoblastoma (pRb) protein which activates E2F
          mediated transcription and allows cells to move into S
          phase. The CDK2/cyclin A complex plays a role in
          regulating DNA replication. Studies in knockout mice
          revealed that CDK1 can compensate for the loss of the
          cdk2 gene as it can also bind cyclin E and drive G1 to
          S phase transition. CDK3 is regulated by cyclin C and
          it phosphorylates pRB specifically during the G0/G1
          transition. This phosphorylation is required for cells
          to exit G0 efficiently and enter the G1 phase.
          Length = 283

 Score = 29.6 bits (67), Expect = 1.3
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIK 38
          KIG G++G +Y   +  TGE VA+K
Sbjct: 6  KIGEGTYGVVYKARDKLTGEIVALK 30


>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
          Serine/Threonine Kinase, p38delta Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38delta subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38delta subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38delta, also
          called MAPK13, is found in skeletal muscle, heart,
          lung, testis, pancreas, and small intestine. It
          regulates microtubule function by phosphorylating Tau.
          It activates the c-jun promoter and plays a role in G2
          cell cycle arrest. It also controls the degration of
          c-Myb, which is associated with myeloid leukemia and
          poor prognosis in colorectal cancer. p38delta is the
          main isoform involved in regulating the differentiation
          and apoptosis of keratinocytes.
          Length = 342

 Score = 29.5 bits (66), Expect = 1.3
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +Y   +++GSG++G +    +  TGE+VAIK
Sbjct: 16 RYTSLKQVGSGAYGSVCSAIDKRTGEKVAIK 46


>gnl|CDD|223554 COG0478, COG0478, RIO-like serine/threonine protein kinase fused to
           N-terminal HTH domain [Signal transduction mechanisms].
          Length = 304

 Score = 29.6 bits (67), Expect = 1.4
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 9   YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
             +G KIG G   D+Y+  +   G +VA+K 
Sbjct: 93  EAIGTKIGVGKESDVYVAID-PKGRKVAVKF 122


>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; Human Fyn-related kinase (Frk) and
          similar proteins; catalytic (c) domain. The PTKc family
          is part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Frk and
          Srk are members of the Src subfamily of proteins, which
          are cytoplasmic (or non-receptor) tyr kinases. Src
          kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Frk, also known as Rak, is
          specifically expressed in liver, lung, kidney,
          intestine, mammary glands, and the islets of
          Langerhans. Rodent homologs were previously referred to
          as GTK (gastrointestinal tyr kinase), BSK (beta-cell
          Src-like kinase), or IYK (intestinal tyr kinase).
          Studies in mice reveal that Frk is not essential for
          viability. It plays a role in the signaling that leads
          to cytokine-induced beta-cell death in Type I diabetes.
          It also regulates beta-cell number during embryogenesis
          and early in life.
          Length = 261

 Score = 29.3 bits (66), Expect = 1.4
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 10 RLGRKIGSGSFGDIYLGT-NISTGEEVAIK 38
          +L RK+G+G FG+++ G  N +T   VA+K
Sbjct: 9  QLLRKLGAGQFGEVWEGLWNNTT--PVAVK 36


>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 1.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK1 is preferentially expressed in the liver,
           lung, spleen, testes, and kidney. It mediates signaling
           from Rho to the actin cytoskeleton. It is implicated in
           the development of cardiac fibrosis, cardiomyocyte
           apoptosis, and hyperglycemia. Mice deficient with ROCK1
           display eyelids open at birth (EOB) and omphalocele
           phenotypes due to the disorganization of actin filaments
           in the eyelids and the umbilical ring.
          Length = 371

 Score = 29.6 bits (66), Expect = 1.4
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 16/129 (12%)

Query: 9   YRLGRKIGSGSFGDIYLGTNISTGEEVAIKL----ECIKTRHPQLHIESKIYKLMQGGVG 64
           Y + + IG G+FG++ L  + ST +  A+KL    E IK        E +          
Sbjct: 45  YEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPW 104

Query: 65  IPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSR--------RFSLKTVLLLADQLSITA 116
           + Q+ +   +  Y  MVME +     DL N  S         RF    V+L  D  +I +
Sbjct: 105 VVQLFYAFQDDRYLYMVMEYMPGG--DLVNLMSNYDVPEKWARFYTAEVVLALD--AIHS 160

Query: 117 PGIIDQEQK 125
            G I ++ K
Sbjct: 161 MGFIHRDVK 169


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 4 and 6-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase 4 (CDK4) and CDK6-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK4/6-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK4 and CDK6 partner with D-type cyclins to
          regulate the early G1 phase of the cell cycle. They are
          the first kinase activated by mitogenic signals to
          release cells from the G0 arrested state. CDK4 and CDK6
          are both expressed ubiquitously, associate with all
          three D cyclins (D1, D2 and D3), and phosphorylate the
          retinoblastoma (pRb) protein. They are also regulated
          by the INK4 family of inhibitors which associate with
          either the CDK alone or the CDK/cyclin complex. CDK4
          and CDK6 show differences in subcellular localization,
          sensitivity to some inhibitors, timing in activation,
          tumor selectivity, and possibly substrate profiles.
          Although CDK4 and CDK6 seem to show some redundancy,
          they also have discrete, nonoverlapping functions. CDK6
          plays an important role in cell differentiation.
          Length = 287

 Score = 29.1 bits (66), Expect = 1.5
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          Y    +IG G++G +Y   +++TG  VA+K
Sbjct: 1  YEELAEIGEGAYGTVYKARDLNTGRFVALK 30


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 29.0 bits (65), Expect = 1.9
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 1  MELRVGNKYR-LGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          M   +  +Y   G  +G G++G +    +  TG+ VAIK
Sbjct: 2  MSFSISERYIQKGAHLGEGTYGKVEKAYDTLTGKIVAIK 40


>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth
          Factor Receptor-like Protein Tyrosine Kinases.  Protein
          Tyrosine Kinase (PTK) family; Epidermal Growth Factor
          Receptor (EGFR) subfamily; catalytic (c) domain. EGFR
          (HER, ErbB) subfamily members include EGFR (HER1,
          ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. The EGFR proteins are receptor tyr kinases
          (RTKs) containing an extracellular EGF-related
          ligand-binding region, a transmembrane helix, and a
          cytoplasmic region with a tyr kinase domain and a
          regulatory C-terminal tail. Unlike other tyr kinases,
          phosphorylation of the activation loop of EGFR proteins
          is not critical to their activation. Instead, they are
          activated by ligand-induced dimerization, resulting in
          the phosphorylation of tyr residues in the C-terminal
          tail, which serve as binding sites for downstream
          signaling molecules. Collectively, they can recognize a
          variety of ligands including EGF, TGFalpha, and
          neuregulins, among others. All four subfamily members
          can form homo- or heterodimers. HER3 contains an
          impaired kinase domain and depends on its
          heterodimerization partner for activation. EGFR
          subfamily members are involved in signaling pathways
          leading to a broad range of cellular responses
          including cell proliferation, differentiation,
          migration, growth inhibition, and apoptosis. Gain of
          function alterations, through their overexpression,
          deletions, or point mutations in their kinase domains,
          have been implicated in various cancers. These
          receptors are targets of many small molecule inhibitors
          and monoclonal antibodies used in cancer therapy.
          Length = 279

 Score = 28.9 bits (65), Expect = 2.0
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 10 RLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKT 44
             + +GSG+FG +Y G  I  GE+V I +  IK 
Sbjct: 10 EKIKVLGSGAFGTVYKGVWIPEGEKVKIPV-AIKV 43


>gnl|CDD|240158 cd05119, RIO, RIO kinase family, catalytic domain. The RIO kinase
          catalytic domain family is part of a larger
          superfamily, that includes the catalytic domains of
          other kinases such as the typical
          serine/threonine/tyrosine protein kinases (PKs),
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). RIO kinases are
          atypical protein serine kinases present in archaea,
          bacteria and eukaryotes. Serine kinases catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine residues in protein substrates. RIO kinases
          contain a kinase catalytic signature, but otherwise
          show very little sequence similarity to typical PKs.
          The RIO catalytic domain is truncated compared to the
          catalytic domains of typical PKs, with deletions of the
          loops responsible for substrate binding. Most organisms
          contain at least two RIO kinases, RIO1 and RIO2. A
          third protein, RIO3, is present in multicellular
          eukaryotes. In yeast, RIO1 and RIO2 are essential for
          survival. They function as non-ribosomal factors
          necessary for late 18S rRNA processing. RIO1 is also
          required for proper cell cycle progression and
          chromosome maintenance. The biological substrates for
          RIO kinases are still unknown.
          Length = 187

 Score = 28.6 bits (65), Expect = 2.1
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 11 LGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          +G  IG+G   D+YL  +   GE VA+K+
Sbjct: 1  VGGPIGTGKEADVYLALD-GDGEPVAVKI 28


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
          Dbf2p-like Protein Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), ROCK- and NDR-like
          subfamily, fungal Sid2p- and Dbf2p-like proteins,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Sid2p- and
          Dbf2p-like group is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This group contains fungal
          kinases including Schizosaccharomyces pombe Sid2p and
          Saccharomyces cerevisiae Dbf2p. Group members show
          similarity to NDR kinases in that they contain an
          N-terminal regulatory (NTR) domain and an insert within
          the catalytic domain that contains an auto-inhibitory
          sequence. Sid2p plays a crucial role in the septum
          initiation network (SIN) and in the initiation of
          cytokinesis. Dbf2p is important in regulating the
          mitotic exit network (MEN) and in cytokinesis.
          Length = 333

 Score = 28.9 bits (65), Expect = 2.4
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIK 38
          ++G G +G ++L     TGE VA+K
Sbjct: 8  QVGQGGYGQVFLAKKKDTGEIVALK 32


>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine
          Kinase, C-terminal Src kinase.  Protein Tyrosine Kinase
          (PTK) family; C-terminal Src kinase (Csk); catalytic
          (c) domain. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. The Csk subfamily kinases are cytoplasmic
          (or nonreceptor) tyr kinases containing the Src
          homology domains, SH3 and SH2, N-terminal to the
          catalytic tyr kinase domain. They negatively regulate
          the activity of Src kinases that are anchored to the
          plasma membrane. To inhibit Src kinases, Csk is
          translocated to the membrane via binding to specific
          transmembrane proteins, G-proteins, or adaptor proteins
          near the membrane. Csk catalyzes the tyr
          phosphorylation of the regulatory C-terminal tail of
          Src kinases, resulting in their inactivation. Csk is
          expressed in a wide variety of tissues. As a negative
          regulator of Src, Csk plays a role in cell
          proliferation, survival, and differentiation, and
          consequently, in cancer development and progression. In
          addition, Csk also shows Src-independent functions. It
          is a critical component in G-protein signaling, and
          plays a role in cytoskeletal reorganization and cell
          migration.
          Length = 256

 Score = 28.8 bits (64), Expect = 2.4
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 4/34 (11%)

Query: 10 RLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIK 43
          +L + IG G FGD+ LG     G +VA+K  CIK
Sbjct: 9  KLLQTIGKGEFGDVMLGDY--RGNKVAVK--CIK 38


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinases, Never In Mitosis gene
          A-related kinase 6 and 7.  Serine/Threonine Kinases
          (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
          (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The Nek6/7 subfamily is part of a family of
          11 different Neks (Nek1-11) that are involved in cell
          cycle control. The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Nek6 and Nek7
          are the shortest Neks, consisting only of the catalytic
          domain and a very short N-terminal extension. They show
          distinct expression patterns and both appear to be
          downstream substrates of Nek9. They are required for
          mitotic spindle formation and cytokinesis. They may
          also be regulators of the p70 ribosomal S6 kinase.
          Length = 267

 Score = 28.6 bits (64), Expect = 2.4
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
            +++ +KIG G F  +Y    +  G  VA+K
Sbjct: 2  GNFKIEKKIGKGQFSVVYKAICLLDGRVVALK 33


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 28.9 bits (64), Expect = 2.6
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEV---AIKLECIKTRH-PQLHIESKIYKLMQ 60
          N+Y + +KIG+G FG+++L  +  T E     AI    +K R   QL IE  + + ++
Sbjct: 13 NEYEVIKKIGNGRFGEVFLVKHKRTQEFFCWKAISYRGLKEREKSQLVIEVNVMRELK 70


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
          Serine/Threonine Kinases (STKs), Pho85 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Pho85 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Pho85 is a multifunctional
          Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs
          belong to a large family of STKs that are regulated by
          their cognate cyclins. Together, they are involved in
          the control of cell-cycle progression, transcription,
          and neuronal function. Pho85 is regulated by 10
          different cyclins (Pcls) and plays a role in G1
          progression, cell polarity, phosphate and glycogen
          metabolism, gene expression, and in signaling changes
          in the environment. It is not essential for yeast
          viability and is the functional homolog of mammalian
          CDK5, which plays a role in central nervous system
          development.
          Length = 284

 Score = 28.6 bits (64), Expect = 2.8
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIK 38
          K+G G++  +Y G N +TGE VA+K
Sbjct: 7  KLGEGTYATVYKGRNRTTGEIVALK 31


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mammalian Ste20-like protein
          kinase 4.  Serine/threonine kinases (STKs), mammalian
          Ste20-like protein kinase 4 (MST4) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST4 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MST4 is sometimes referred
          to as MASK (MST3 and SOK1-related kinase). It plays a
          role in mitogen-activated protein kinase (MAPK)
          signaling during cytoskeletal rearrangement,
          morphogenesis, and apoptosis. It influences cell growth
          and transformation by modulating the extracellular
          signal-regulated kinase (ERK) pathway. MST4 may also
          play a role in tumor formation and progression. It
          localizes in the Golgi apparatus by interacting with
          the Golgi matrix protein GM130 and may play a role in
          cell migration.
          Length = 277

 Score = 28.5 bits (63), Expect = 2.8
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 14 KIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLH-IESKIYKLMQGGVGIPQI-KWC 71
          +IG GSFG+++ G +  T + VAIK+  ++    ++  I+ +I  L Q     P + K+ 
Sbjct: 11 RIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQ--CDSPYVTKYY 68

Query: 72 GS--EGDYNVMVMELLG 86
          GS  +G    ++ME LG
Sbjct: 69 GSYLKGTKLWIIMEYLG 85


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
          Kinase Like Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Cyclin-dependent protein kinase like
          (CDKL) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CDKL subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDKL1-5 and
          similar proteins. Some CDKLs, like CDKL1 and CDKL3, may
          be implicated in transformation and others, like CDKL3
          and CDKL5, are associated with mental retardation when
          impaired. CDKL2 plays a role in learning and memory.
          Length = 288

 Score = 28.4 bits (64), Expect = 2.9
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          NKY +   +G G++G +    N +TGE VAIK
Sbjct: 1  NKYEVLGVVGEGAYGVVLKCRNKATGEIVAIK 32


>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 12.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 12 (CDK12) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK12 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK12 is also called Cdc2-related protein
          kinase 7 (CRK7) or Cdc2-related kinase
          arginine/serine-rich (CrkRS). It is a unique CDK that
          contains an arginine/serine-rich (RS) domain, which is
          predominantly found in splicing factors. CDK12 is
          widely expressed in tissues. It interacts with cyclins
          L1 and L2, and plays roles in regulating transcription
          and alternative splicing.
          Length = 302

 Score = 28.2 bits (63), Expect = 3.2
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +K+ +  +IG G++G +Y   +  TGE VA+K
Sbjct: 7  DKFDIIGQIGEGTYGQVYKARDKDTGELVALK 38


>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine
          Kinase, Yes.  Protein Tyrosine Kinase (PTK) family; Yes
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Yes (or
          c-Yes) is a member of the Src subfamily of proteins,
          which are cytoplasmic (or non-receptor) tyr kinases.
          Src kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. c-Yes kinase is the cellular
          homolog of the oncogenic protein (v-Yes) encoded by the
          Yamaguchi 73 and Esh sarcoma viruses. It displays
          functional overlap with other Src subfamily members,
          particularly Src. It also shows some unique functions
          such as binding to occludins, transmembrane proteins
          that regulate extracellular interactions in tight
          junctions. Yes also associates with a number of
          proteins in different cell types that Src does not
          interact with, like JAK2 and gp130 in pre-adipocytes,
          and Pyk2 in treated pulmonary vein endothelial cells.
          Although the biological function of Yes remains
          unclear, it appears to have a role in regulating
          cell-cell interactions and vesicle trafficking in
          polarized cells.
          Length = 260

 Score = 28.1 bits (62), Expect = 3.3
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 10 RLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHI-ESKIYKLMQGGVGIPQI 68
          RL  K+G G FG++++GT   T  +VAIK     T  P+  + E++I K ++    +P  
Sbjct: 9  RLDVKLGQGCFGEVWMGTWNGT-TKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLY 67

Query: 69 KWCGSEGDYNVMVMELLG 86
               E  Y  +V E +G
Sbjct: 68 AVVSEEPIY--IVTEFMG 83


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
          Serine/Threonine Kinase, cGMP-dependent protein kinase.
           Serine/Threonine Kinases (STKs), cGMP-dependent
          protein kinase (cGK or PKG) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The cGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Mammals have two cGK
          isoforms from different genes, cGKI and cGKII. cGKI
          exists as two splice variants, cGKI-alpha and
          cGKI-beta. cGK consists of an N-terminal regulatory
          domain containing a dimerization and an autoinhibitory
          pseudosubstrate region, two cGMP-binding domains, and a
          C-terminal catalytic domain. Binding of cGMP to both
          binding sites releases the inhibition of the catalytic
          center by the pseudosubstrate region, allowing
          autophosphorylation and activation of the kinase. cGKI
          is a  soluble protein expressed in all smooth muscles,
          platelets, cerebellum, and kidney. It is also expressed
          at lower concentrations in other tissues. cGKII is a
          membrane-bound protein that is most abundantly
          expressed in the intestine. It is also present in the
          brain nuclei, adrenal cortex, kidney, lung, and
          prostate. cGKI is involved in the regulation of smooth
          muscle tone, smooth cell proliferation, and platelet
          activation. cGKII plays a role in the regulation of
          secretion, such as renin secretion by the kidney and
          aldosterone secretion by the adrenal. It also regulates
          bone growth and the circadian rhythm.
          Length = 262

 Score = 28.0 bits (63), Expect = 3.5
 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%)

Query: 15 IGSGSFGDIYLGTNISTGEEVAIKLECIKTRH 46
          +G G FG + L    S     A+K  C+K RH
Sbjct: 1  LGVGGFGRVELVKVKSKNRTFALK--CVKKRH 30


>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 10.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein Kinase 10 (CDK10) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK10 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK10, also called PISSLRE, is essential for
          cell growth and proliferation, and acts through the
          G2/M phase of the cell cycle. CDK10 has also been
          identified as an important factor in endocrine therapy
          resistance in breast cancer. CDK10 silencing increases
          the transcription of c-RAF and the activation of the
          p42/p44 MAPK pathway, which leads to antiestrogen
          resistance. Patients who express low levels of CDK10
          relapse early on tamoxifen.
          Length = 309

 Score = 28.1 bits (63), Expect = 3.6
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 10 RLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +L R IG G++G +Y   + ++GE VA+K
Sbjct: 11 KLNR-IGEGTYGIVYRARDTTSGEIVALK 38


>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine
          Kinase, Colony-Stimulating Factor-1 Receptor.  Protein
          Tyrosine Kinase (PTK) family; Colony-Stimulating
          Factor-1 Receptor (CSF-1R); catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. CSF-1R,
          also called c-Fms, is a member of the Platelet Derived
          Growth Factor Receptor (PDGFR) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular ligand-binding region with five
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. The binding of
          CSF-1R to its ligand, CSF-1, leads to receptor
          dimerization, trans phosphorylation and activation, and
          intracellular signaling. CSF-1R signaling is critical
          in the regulation of macrophages and osteoclasts. It
          leads to increases in gene transcription and protein
          translation, and induces cytoskeletal remodeling.
          CSF-1R signaling leads to a variety of cellular
          responses including survival, proliferation, and
          differentiation of target cells. It plays an important
          role in innate immunity, tissue development and
          function, and the pathogenesis of some diseases
          including atherosclerosis and cancer. CSF-1R signaling
          is also implicated in mammary gland development during
          pregnancy and lactation. Aberrant CSF-1/CSF-1R
          expression correlates with tumor cell invasiveness,
          poor clinical prognosis, and bone metastasis in breast
          cancer. Although the structure of the human CSF-1R
          catalytic domain is known, it is excluded from this
          specific alignment model because it contains a deletion
          in its sequence.
          Length = 374

 Score = 27.9 bits (62), Expect = 4.2
 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEE-----VAIKL 39
          +  + G+ +G+G+FG +   T    G+E     VA+K+
Sbjct: 38 DNLQFGKTLGAGAFGKVVEATAFGLGKEDNVLRVAVKM 75


>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 11.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 11
          (Nek11) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek11 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek11 is involved, through
          direct phosphorylation, in regulating the degradation
          of Cdc25A (Cell Division Cycle 25 homolog A), which
          plays a role in cell cycle progression and in
          activating cyclin dependent kinases. Nek11 is activated
          by CHK1 (CHeckpoint Kinase 1) and may be involved in
          the G2/M checkpoint. Nek11 may also play a role in the
          S-phase checkpoint as well as in DNA replication and
          genotoxic stress responses.
          Length = 260

 Score = 28.0 bits (62), Expect = 4.3
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKL 39
          +Y L +++G GSFG +YL  +     E  +K+
Sbjct: 1  RYILQQRLGKGSFGTVYLVKDKKAVAEERLKV 32


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
          Serine/Threonine Kinases, Oxidative stress response
          kinase and Ste20-related proline alanine-rich kinase.
          Serine/threonine kinases (STKs), oxidative stress
          response kinase (OSR1) and Ste20-related proline
          alanine-rich kinase (SPAK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The OSR1 and SPAK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. SPAK is also referred to as
          STK39 or PASK (proline-alanine-rich STE20-related
          kinase). OSR1 and SPAK regulate the activity of
          cation-chloride cotransporters through direct
          interaction and phosphorylation. They are also
          implicated in cytoskeletal rearrangement, cell
          differentiation, transformation and proliferation. OSR1
          and SPAK contain a conserved C-terminal (CCT) domain,
          which recognizes a unique motif ([RK]FX[VI]) present in
          their activating kinases (WNK1/WNK4) and their
          substrates.
          Length = 267

 Score = 27.7 bits (62), Expect = 4.4
 Identities = 11/32 (34%), Positives = 16/32 (50%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          + Y L   IG G+   +Y    +   E+VAIK
Sbjct: 1  DDYELIEVIGVGATAVVYAAICLPNNEKVAIK 32


>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
           Kinase, Cell Division Cycle 2-like 1.  Serine/Threonine
           Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDC2L1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDC2L1, also
           called PITSLRE, exists in different isoforms which are
           named using the alias CDK11(p). The CDC2L1 gene produces
           two protein products, CDK11(p110) and CDK11(p58). CDC2L1
           is also represented by the caspase-processed CDK11(p46).
           CDK11(p110), the major isoform, associates with cyclin L
           and is expressed throughout the cell cycle. It is
           involved in RNA processing and the regulation of
           transcription. CDK11(p58) associates with cyclin D3 and
           is expressed during the G2/M phase of the cell cycle. It
           plays roles in spindle morphogenesis, centrosome
           maturation, sister chromatid cohesion, and the
           completion of mitosis. CDK11(p46) is formed from the
           larger isoforms by caspases during TNFalpha- and
           Fas-induced apoptosis. It functions as a downstream
           effector kinase in apoptotic signaling pathways and
           interacts with eukaryotic initiation factor 3f (eIF3f), 
           p21-activated kinase (PAK1), and Ran-binding protein
           (RanBPM).
          Length = 293

 Score = 28.0 bits (63), Expect = 4.6
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 25/114 (21%)

Query: 14  KIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESK-----------IYKLMQGG 62
           +I  G++G +Y   +  TGE VA+K         +L +E +           I  L++  
Sbjct: 12  RIEEGTYGVVYRARDKKTGEIVALK---------KLKMEKEKEGFPITSLREINILLKLQ 62

Query: 63  ----VGIPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQL 112
               V + ++   GS  D   MVME +   L+ L     + F    V  L  QL
Sbjct: 63  HPNIVTVKEVV-VGSNLDKIYMVMEYVEHDLKSLMETMKQPFLQSEVKCLMLQL 115


>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine
          Kinase, HER2.  Protein Tyrosine Kinase (PTK) family;
          HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. HER2 is
          a member of the EGFR (HER, ErbB) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular EGF-related ligand-binding region, a
          transmembrane helix, and a cytoplasmic region with a
          tyr kinase domain and a regulatory C-terminal tail.
          Unlike other tyr kinases, phosphorylation of the
          activation loop of EGFR proteins is not critical to
          their activation. Instead, they are activated by
          ligand-induced dimerization, leading to the
          phosphorylation of tyr residues in the C-terminal tail,
          which serve as binding sites for downstream signaling
          molecules. HER2 does not bind to any known EGFR
          subfamily ligands, but contributes to the kinase
          activity of all possible heterodimers. It acts as the
          preferred partner with other ligand-bound EGFR proteins
          and functions as a signal amplifier, with the HER2-HER3
          heterodimer being the most potent pair in mitogenic
          signaling. HER2 plays an important role in cell
          development, proliferation, survival and motility.
          Overexpression of HER2 results in its activation and
          downstream signaling, even in the absence of ligand.
          HER2 overexpression, mainly due to gene amplification,
          has been shown in a variety of human cancers. Its role
          in breast cancer is especially well-documented. HER2 is
          up-regulated in about 25% of breast tumors and is
          associated with increases in tumor aggressiveness,
          recurrence and mortality. HER2 is a target for
          monoclonal antibodies and small molecule inhibitors,
          which are being developed as treatments for cancer. The
          first humanized antibody approved for clinical use is
          Trastuzumab (Herceptin), which is being used in
          combination with other therapies to improve the
          survival rates of patients with HER2-overexpressing
          breast cancer.
          Length = 279

 Score = 27.7 bits (61), Expect = 5.5
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRH---PQLHIESKIYKLMQGGVGIPQI 68
          + +GSG+FG +Y G  I  GE V I +     R    P+ + E      +  GVG P +
Sbjct: 13 KVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYV 71


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
          Serine/Threonine Kinase, p38gamma Mitogen-Activated
          Protein Kinase.  Serine/Threonine Kinases (STKs),
          p38gamma subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          p38gamma subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. p38 kinases are
          mitogen-activated protein kinases (MAPKs), serving as
          important mediators of cellular responses to
          extracellular signals. They are activated by the MAPK
          kinases MKK3 and MKK6, which in turn are activated by
          upstream MAPK kinase kinases including TAK1, ASK1, and
          MLK3, in response to cellular stresses or inflammatory
          cytokines. Vertebrates contain four isoforms of p38,
          named alpha, beta, gamma, and delta. p38gamma, also
          called MAPK12, is predominantly expressed in skeletal
          muscle. Unlike p38alpha and p38beta, p38gamma is
          insensitive to pyridinylimidazoles. It displays an
          antagonizing function compared to p38alpha. p38gamma
          inhibits, while p38alpha stimulates, c-Jun
          phosphorylation and AP-1 mediated transcription.
          p38gamma also plays a role in the signaling between Ras
          and the estrogen receptor and has been implicated to
          increase cell invasion and breast cancer progression.
          In Xenopus, p38gamma is critical in the meiotic
          maturation of oocytes.
          Length = 343

 Score = 27.6 bits (61), Expect = 5.7
 Identities = 13/34 (38%), Positives = 23/34 (67%)

Query: 5  VGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          V ++YR  +++GSG++G +    +  TG +VAIK
Sbjct: 13 VPDRYRDLKQVGSGAYGTVCSALDRRTGAKVAIK 46


>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 1.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek1 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek1 is associated with
          centrosomes throughout the cell cycle. It is involved
          in the formation of primary cilium and in the
          maintenance of centrosomes. It cycles through the
          nucleus and may be capable of relaying signals between
          the cilium and the nucleus. Nek1 is implicated in the
          development of polycystic kidney disease, which is
          characterized by benign polycystic tumors formed by
          abnormal overgrowth of renal epithelial cells. It
          appears also to be involved in DNA damage response, and
          may be important for both correct DNA damage checkpoint
          activation and DNA repair.
          Length = 256

 Score = 27.5 bits (61), Expect = 6.2
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 8  KYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESK 54
          KY   +KIG GSFG   L  +   G++  IK   I    P+   ES+
Sbjct: 1  KYVKVKKIGEGSFGKAILVKSKEDGKQYVIKEINISKMSPKEREESR 47


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 7.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek7 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek7 is required for mitotic
          spindle formation and cytokinesis. It is enriched in
          the centrosome and is critical for microtubule
          nucleation. Nek7 is activated by Nek9 during mitosis,
          and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 27.3 bits (60), Expect = 6.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 9  YRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          +R+ +KIG G F ++Y  T +  G  VA+K
Sbjct: 4  FRIEKKIGRGQFSEVYRATCLLDGVPVALK 33


>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine
          Kinase, Epidermal Growth Factor Receptor.  Protein
          Tyrosine Kinase (PTK) family; Epidermal Growth Factor
          Receptor (EGFR); catalytic (c) domain. The PTKc family
          is part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EGFR
          (HER1, ErbB1) is a member of the EGFR (HER, ErbB)
          subfamily of proteins, which are receptor tyr kinases
          (RTKs) containing an extracellular EGF-related
          ligand-binding region, a transmembrane helix, and a
          cytoplasmic region with a tyr kinase domain and a
          regulatory C-terminal tail. Unlike other tyr kinases,
          phosphorylation of the activation loop of EGFR proteins
          is not critical to their activation. Instead, they are
          activated by ligand-induced dimerization, leading to
          the phosphorylation of tyr residues in the C-terminal
          tail, which serve as binding sites for downstream
          signaling molecules. Ligands for EGFR include EGF,
          heparin binding EGF-like growth factor (HBEGF),
          epiregulin, amphiregulin, TGFalpha, and betacellulin.
          Upon ligand binding, EGFR can form homo- or
          heterodimers with other EGFR subfamily members. The
          EGFR signaling pathway is one of the most important
          pathways regulating cell proliferation,
          differentiation, survival, and growth. Overexpression
          and mutation in the kinase domain of EGFR have been
          implicated in the development and progression of a
          variety of cancers. A number of monoclonal antibodies
          and small molecule inhibitors have been developed that
          target EGFR, including the antibodies Cetuximab and
          Panitumumab, which are used in combination with other
          therapies for the treatment of colorectal cancer and
          non-small cell lung carcinoma (NSCLC). The small
          molecule inhibitors Gefitinib (Iressa) and Erlotinib
          (Tarceva), already used for NSCLC, are undergoing
          clinical trials for other types of cancer including
          gastrointestinal, breast, head and neck, and bladder.
          Length = 316

 Score = 27.3 bits (60), Expect = 7.1
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 13 RKIGSGSFGDIYLGTNISTGEEVAI 37
          + +GSG+FG +Y G  I  GE+V I
Sbjct: 13 KVLGSGAFGTVYKGLWIPEGEKVKI 37


>gnl|CDD|188873 cd09213, Luminal_IRE1_like, The Luminal domain, a dimerization
           domain, of Inositol-requiring protein 1-like proteins.
           The Luminal domain is a dimerization domain present in
           Inositol-requiring protein 1 (IRE1), eukaryotic
           translation Initiation Factor 2-Alpha Kinase 3
           (EIF2AK3), and similar proteins. IRE1 and EIF2AK3 are
           serine/threonine protein kinases (STKs) and are type I
           transmembrane proteins that are localized in the
           endoplasmic reticulum (ER). They are kinase receptors
           that are activated through the release of BiP, a
           chaperone bound to their luminal domains under
           unstressed conditions. This results in dimerization
           through their luminal domains, allowing
           trans-autophosphorylation of their kinase domains and
           activation. They play roles in the signaling of the
           unfolded protein response (UPR), which is activated when
           protein misfolding is detected in the ER in order to
           decrease the synthesis of new proteins and increase the
           capacity of the ER to cope with the stress. IRE1, also
           called Endoplasmic reticulum (ER)-to-nucleus signaling
           protein (or ERN), contains an endoribonuclease domain in
           its cytoplasmic side and acts as an ER stress sensor. It
           is the oldest and most conserved component of the UPR in
           eukaryotes. Its activation results in the cleavage of
           its mRNA substrate, HAC1 in yeast and Xbp1 in metazoans,
           promoting a splicing event that enables translation into
           a transcription factor which activates the UPR. EIF2AK3,
           also called PKR-like Endoplasmic Reticulum Kinase
           (PERK), phosphorylates the alpha subunit of eIF-2,
           resulting in the downregulation of protein synthesis. It
           functions as the central regulator of translational
           control during the UPR pathway. In addition to the eIF-2
           alpha subunit, EIF2AK3 also phosphorylates Nrf2, a
           leucine zipper transcription factor which regulates
           cellular redox status and promotes cell survival during
           the UPR.
          Length = 312

 Score = 27.1 bits (60), Expect = 8.0
 Identities = 11/46 (23%), Positives = 23/46 (50%)

Query: 91  DLFNFCSRRFSLKTVLLLADQLSITAPGIIDQEQKSVMVVGTNIST 136
           +L+       SL+ + L  + L   +P + D  +  V+VVG+  ++
Sbjct: 59  NLYQHDKGHGSLQRLPLTIEDLVEASPLVSDTNEDDVVVVGSKRTS 104


>gnl|CDD|233096 TIGR00704, NaPi_cotrn_rel, Na/Pi-cotransporter.  This model
           describes essentially the full length of an
           uncharacterized protein from Bacillus subtilis and
           correponding lengths of longer proteins from E. coli and
           Treponema pallidum. PSI-BLAST analysis converges to
           demonstrate homology to one other group of proteins,
           type II sodium/phosphate (Na/Pi) cotransporters. A
           well-conserved repeated domain in this family,
           approximately 60 residues in length, is also repeated in
           the Na/Pi cotransporters, although with greater spacing
           between the repeats. The two families share additional
           homology in the region after the first repeat, share the
           properly of having extensive hydrophobic regions, and
           may be similar in function [Transport and binding
           proteins, Cations and iron carrying compounds].
          Length = 307

 Score = 27.1 bits (60), Expect = 8.3
 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 101 SLKTVLLLADQLSITAPGIIDQEQKSVMVVGTNISTGEEVAI 142
           S   VL+     ++TA GII       +V+G+N+ +G    +
Sbjct: 187 SSAAVLIT---ATLTAAGIIGFPVALCLVLGSNLGSGILAML 225


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
          Serine/Threonine Kinase, Yeast Sps1/Ste20-related
          kinase 4.  Serine/threonine kinases (STKs), yeast
          Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The YSK4 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. YSK4 is a putative MAPKKK,
          whose mammalian gene has been isolated. MAPKKKs (MKKKs
          or MAP3Ks) phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals.
          Length = 265

 Score = 26.8 bits (59), Expect = 8.8
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 12 GRKIGSGSFGDIYLGTNISTGEEVAIK 38
          G  +G G++G +Y G   + G+ +A+K
Sbjct: 5  GEVLGKGAYGTVYCGL-TNQGQLIAVK 30


>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
          Length = 294

 Score = 27.1 bits (60), Expect = 9.0
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 7  NKYRLGRKIGSGSFGDIYLGTNISTGEEVAIK 38
          ++Y    KIG G++G +Y   +  T E +A+K
Sbjct: 2  DQYEKVEKIGEGTYGVVYKARDRVTNETIALK 33


>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Ephrin Receptor (EphR) subfamily; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). They can be classified into two classes (EphA
          and EphB), according to their extracellular sequences,
          which largely correspond to binding preferences for
          either GPI-anchored ephrin-A ligands or transmembrane
          ephrin-B ligands. Vertebrates have ten EphA and six
          EhpB receptors, which display promiscuous ligand
          interactions within each class. EphRs contain an ephrin
          binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. This allows
          ephrin/EphR dimers to form, leading to the activation
          of the intracellular tyr kinase domain. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling). The main
          effect of ephrin/EphR interaction is cell-cell
          repulsion or adhesion. Ephrin/EphR signaling is
          important in neural development and plasticity, cell
          morphogenesis and proliferation, cell-fate
          determination, embryonic development, tissue
          patterning, and angiogenesis.
          Length = 266

 Score = 26.9 bits (60), Expect = 9.3
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 15 IGSGSFGDIYLGTNISTGEE---VAIK 38
          IG G FG++  G     G++   VAIK
Sbjct: 12 IGGGEFGEVCRGRLKLPGKKEIDVAIK 38


>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine
          Kinase, HER4.  Protein Tyrosine Kinase (PTK) family;
          HER4 (ErbB4); catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. HER4 is
          a member of the EGFR (HER, ErbB) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular EGF-related ligand-binding region, a
          transmembrane helix, and a cytoplasmic region with a
          tyr kinase domain and a regulatory C-terminal tail.
          Unlike other tyr kinases, phosphorylation of the
          activation loop of EGFR proteins is not critical to
          their activation. Instead, they are activated by
          ligand-induced dimerization, leading to the
          phosphorylation of tyr residues in the C-terminal tail,
          which serve as binding sites for downstream signaling
          molecules. Ligands that bind HER4 fall into two groups,
          the neuregulins (or heregulins) and some EGFR (HER1)
          ligands including betacellulin, HBEGF, and epiregulin.
          All four neuregulins (NRG1-4) interact with HER4. Upon
          ligand binding, HER4 forms homo- or heterodimers with
          other HER proteins. HER4 is essential in embryonic
          development. It is implicated in mammary gland,
          cardiac, and neural development. As a postsynaptic
          receptor of NRG1, HER4 plays an important role in
          synaptic plasticity and maturation. The impairment of
          NRG1/HER4 signaling may contribute to schizophrenia.
          Length = 303

 Score = 27.0 bits (59), Expect = 9.8
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 3  LRVGNKYRLGRK--IGSGSFGDIYLGTNISTGEEVAI 37
          LR+  +  L R   +GSG+FG +Y G  +  GE V I
Sbjct: 1  LRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKI 37


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.141    0.418 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 11,310,730
Number of extensions: 1049651
Number of successful extensions: 1045
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1039
Number of HSP's successfully gapped: 139
Length of query: 227
Length of database: 10,937,602
Length adjustment: 93
Effective length of query: 134
Effective length of database: 6,812,680
Effective search space: 912899120
Effective search space used: 912899120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 57 (25.6 bits)