Diaphorina citri psyllid: psy3118

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------

MELRVGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQGGVGIPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQLSITAPGIIDQEQKSVMVVGTNISTGEEVAIKLECIKTRHPQLHIESKIYKLMQGGVGIPQIKWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQLFLYNTRLCFS

ccCEEccCEEEEEEEccccccEEEEEEEcccccEEEEEEEEccccccccHHHHHHHHHHcccccccCEEEEcccccEEEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHcccccECcccccccEEEcccccccEEEEccccccccccccccHHHHHHHHcccccccCEEEEcccccEEEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHcccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Casein kinase I isoform epsilon	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates DVL1. Central component of the circadian clock. May act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. Retains PER1 in the cytoplasm.	very confident	Q5ZLL1
Casein kinase I isoform delta-A	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Central component of the circadian clock. May act as a negative regulator of circadian rhythmicity by phosphorylating per1 and per2, which may lead to their degradation. Participates in wnt signaling.	very confident	Q7T2E3
Casein kinase I isoform epsilon	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates DVL1. Central component of the circadian clock. May act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. Retains PER1 in the cytoplasm. Inhibits cytokine-induced granuloytic differentiation.	very confident	P49674

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006468 [BP]	protein phosphorylation	confident	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0050794 [BP]	regulation of cellular process	confident	GO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0004674 [MF]	protein serine/threonine kinase activity	confident	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005813 [CC]	centrosome	confident	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]	nucleus	confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0034613 [BP]	cellular protein localization	confident	GO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0030529 [CC]	ribonucleoprotein complex	confident	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005886 [CC]	plasma membrane	confident	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008062 [BP]	eclosion rhythm	probable	GO:0071684, GO:0032502, GO:0032501, GO:0007623, GO:0007622, GO:0044707, GO:0044708, GO:0050896, GO:0007562, GO:0048511, GO:0048512, GO:0008150, GO:0007610, GO:0007275, GO:0044699
GO:0032436 [BP]	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0004712 [MF]	protein serine/threonine/tyrosine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0006281 [BP]	DNA repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007446 [BP]	imaginal disc growth	probable	GO:0032502, GO:0032501, GO:0048589, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0035265, GO:0048731, GO:0007275, GO:0044699, GO:0040007
GO:0051781 [BP]	positive regulation of cell division	probable	GO:0050794, GO:0051302, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0090263 [BP]	positive regulation of canonical Wnt receptor signaling pathway	probable	GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0051225 [BP]	spindle assembly	probable	GO:0006996, GO:0022607, GO:0007010, GO:0071822, GO:0070271, GO:0043933, GO:0071840, GO:0006461, GO:0044763, GO:0016043, GO:0065003, GO:0007051, GO:0044085, GO:0000226, GO:0044699, GO:0008150, GO:0022402, GO:0009987, GO:0070925, GO:0007049, GO:0007017
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005876 [CC]	spindle microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0000086 [BP]	G2/M transition of mitotic cell cycle	probable	GO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001948 [MF]	glycoprotein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0030178 [BP]	negative regulation of Wnt receptor signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0001737 [BP]	establishment of imaginal disc-derived wing hair orientation	probable	GO:0048563, GO:0030030, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0007164, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0002009, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0035317, GO:0048569, GO:0048513, GO:0071840, GO:0048729, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0060429, GO:0009888, GO:0035114, GO:0001738, GO:0008150, GO:0048731, GO:0022008, GO:0001736, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0044763, GO:0009987, GO:0048736, GO:0048737
GO:0032153 [CC]	cell division site	probable	GO:0005575, GO:0044464, GO:0005623
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042306 [BP]	regulation of protein import into nucleus	probable	GO:1900180, GO:0070201, GO:0032879, GO:0060341, GO:0033157, GO:0051049, GO:0032386, GO:0050794, GO:0008150, GO:0046822, GO:0065007, GO:0051223, GO:0050789, GO:0032880
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0042277 [MF]	peptide binding	probable	GO:0033218, GO:0003674, GO:0005488
GO:0007555 [BP]	regulation of ecdysteroid secretion	probable	GO:0032879, GO:0044060, GO:0051046, GO:0032368, GO:0051049, GO:0060341, GO:0050794, GO:0008150, GO:0046883, GO:0044057, GO:0051239, GO:0023051, GO:2000831, GO:0065007, GO:0010646, GO:0050789
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051219 [MF]	phosphoprotein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0042067 [BP]	establishment of ommatidial planar polarity	probable	GO:0032502, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0001745, GO:0048513, GO:0048729, GO:0032501, GO:0048749, GO:0009887, GO:0009987, GO:0048592, GO:0060429, GO:0009888, GO:0044767, GO:0001738, GO:0008150, GO:0048731, GO:0001736, GO:0044707, GO:0007423, GO:0048856, GO:0044763, GO:0001654
GO:0005847 [CC]	mRNA cleavage and polyadenylation specificity factor complex	probable	GO:0005849, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001934 [BP]	positive regulation of protein phosphorylation	probable	GO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522
GO:0006282 [BP]	regulation of DNA repair	probable	GO:0051052, GO:0019222, GO:0060255, GO:0048583, GO:0080134, GO:0080135, GO:0031323, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:2001020, GO:0050789, GO:0080090
GO:0007291 [BP]	sperm individualization	probable	GO:0048610, GO:0048232, GO:0007286, GO:0048468, GO:0019953, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0000003, GO:0048869, GO:0007349, GO:0007276, GO:0030855, GO:0002064, GO:0048515, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0008150, GO:0022412, GO:0007281, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0048646, GO:0044763, GO:0009987
GO:0048364 [BP]	root development	probable	GO:0022622, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0010171 [BP]	body morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0009826 [BP]	unidimensional cell growth	probable	GO:0032502, GO:0060560, GO:0016049, GO:0000902, GO:0048589, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699, GO:0040007
GO:0044765 [BP]	single-organism transport	probable	GO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0040018 [BP]	positive regulation of multicellular organism growth	probable	GO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0009850 [BP]	auxin metabolic process	probable	GO:0042445, GO:0009987, GO:0044237, GO:0010817, GO:0008150, GO:0008152, GO:0065007, GO:0065008
GO:0051519 [BP]	activation of bipolar cell growth	probable	GO:0048639, GO:0048638, GO:0045927, GO:0022603, GO:0030307, GO:0051128, GO:0022604, GO:0050789, GO:0040008, GO:0065007, GO:0048518, GO:0051130, GO:0050793, GO:0050794, GO:0001558, GO:0008150, GO:0051518, GO:0051094, GO:0051512, GO:0051510, GO:0051516, GO:0048522
GO:0051704 [BP]	multi-organism process	probable	GO:0008150
GO:0006897 [BP]	endocytosis	probable	GO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0050321 [MF]	tau-protein kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0060069 [BP]	Wnt receptor signaling pathway, regulating spindle positioning	probable	GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0044699, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0035567
GO:0005816 [CC]	spindle pole body	probable	GO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0045475 [BP]	locomotor rhythm	probable	GO:0007626, GO:0007623, GO:0007622, GO:0044708, GO:0050896, GO:0007610, GO:0048511, GO:0048512, GO:0008150, GO:0044699
GO:0009741 [BP]	response to brassinosteroid stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033, GO:0014070
GO:0032922 [BP]	circadian regulation of gene expression	probable	GO:0032501, GO:0007623, GO:0019222, GO:0044707, GO:0060255, GO:0050789, GO:0048511, GO:0008150, GO:0065007, GO:0010468, GO:0044699
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042752 [BP]	regulation of circadian rhythm	probable	GO:0008150, GO:0065007, GO:0050789
GO:0033551 [CC]	monopolin complex	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0000793, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000779, GO:0043229, GO:0043228, GO:0044422, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0000776, GO:0000777
GO:0055028 [CC]	cortical microtubule	probable	GO:0030981, GO:0043229, GO:0071944, GO:0005874, GO:0043226, GO:0005737, GO:0005575, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0005938, GO:0043234, GO:0032991, GO:0043232, GO:0030863, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0043228, GO:0044422, GO:0044424, GO:0044448
GO:0005935 [CC]	cellular bud neck	probable	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005937 [CC]	mating projection	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0007052 [BP]	mitotic spindle organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0000329 [CC]	fungal-type vacuole membrane	probable	GO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005934 [CC]	cellular bud tip	probable	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0060627 [BP]	regulation of vesicle-mediated transport	probable	GO:0051049, GO:0050794, GO:0008150, GO:0065007, GO:0032879, GO:0050789
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0051455 [BP]	attachment of spindle microtubules to kinetochore involved in homologous chromosome segregation	probable	GO:0033036, GO:0048610, GO:0008608, GO:0008104, GO:0000226, GO:0051651, GO:0044699, GO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0070727, GO:0071840, GO:0045132, GO:0016043, GO:0065007, GO:0007049, GO:0065008, GO:0034453, GO:0009987, GO:0032507, GO:0034613, GO:0045185, GO:0008150, GO:0007059, GO:0051235, GO:0045143, GO:0051179, GO:0051316, GO:0051641, GO:0006996, GO:0007017, GO:0007010, GO:0022402, GO:0044763
GO:0030431 [BP]	sleep	probable	GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007507 [BP]	heart development	probable	GO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007067 [BP]	mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SV0, chain A
Confidence level:very confident
Coverage over the Query: 2-200
View the alignment between query and template
View the model in PyMOL

Template: 3SV0, chain A
Confidence level:very confident
Coverage over the Query: 128-224
View the alignment between query and template
View the model in PyMOL