BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3154
         (101 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
 pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
 pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
 pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
 pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
 pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
 pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
 pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
 pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
 pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
 pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
 pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
 pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
 pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
          Length = 93

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 51/86 (59%)

Query: 10 SVKEPLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVLGXXXXXXXXXXXXXXXXX 69
          +V EPLDL+RLSLDE V+VK+R +R L G+LHAYD+HLN VLG                 
Sbjct: 6  AVAEPLDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNXVLGDAEEIVTIFDDEETDKD 65

Query: 70 XXXXXXXRSIPMLFVRGDGVILVSPP 95
                 +    LFVRGD VIL++PP
Sbjct: 66 KALKTIRKHYEXLFVRGDSVILIAPP 91


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 11 VKEPLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVLGXXXXXXXXXXXXXXXXXX 70
          ++ PLDL++L+LDERV++K+R  R L G L A+D H N+VL                   
Sbjct: 8  METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLS------DAVETIYQLNNE 61

Query: 71 XXXXXXRSIPMLFVRGDGVILVSPPN 96
                R   M+F+RGD V L+S P+
Sbjct: 62 ELSESERRCEMVFIRGDTVTLISTPS 87


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 9  ISVKEPLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVLGXXXXXXXXXXXXXXXX 68
          ++V+ PLD +  SL+  V +K++ +R  RG L ++D H+N+VL                 
Sbjct: 11 VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLN-------------DAE 57

Query: 69 XXXXXXXXRSIPMLFVRGDGVILVSP 94
                  R +  + +RGD ++ +SP
Sbjct: 58 ELEDGEVTRRLGTVLIRGDNIVYISP 83


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 13/74 (17%)

Query: 21 SLDERVHVKMRNERVLRGKLHAYDQHLNMVLGXXXXXXXXXXXXXXXXXXXXXXXXRSIP 80
          SL+  V VK++  + +RG L +YDQH+N+VL                         + + 
Sbjct: 17 SLNNLVLVKLKGNKEVRGMLRSYDQHMNLVL-------------SDSEEIQSDGSGKKLG 63

Query: 81 MLFVRGDGVILVSP 94
           + +RGD VIL+SP
Sbjct: 64 TIVIRGDNVILISP 77


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query: 14 PLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVLGXXXXXXXXXXXXXXXXXXXXX 73
          PLD++  SL   V V+++  R  RG L  YD H+N+VL                      
Sbjct: 5  PLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVL-------------LDAEEIQNG 51

Query: 74 XXXRSIPMLFVRGDGVILVSP 94
             R +  + +RGD V+ VSP
Sbjct: 52 EVVRKVGSVVIRGDTVVFVSP 72


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%)

Query: 1  MEDEQIPTISVKEPLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          M D     ++V+ PLD +  SL+  V +K++ +R  RG L ++D H+N+VL
Sbjct: 1  MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 51


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%)

Query: 1  MEDEQIPTISVKEPLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          M D     ++V+ PLD +  SL+  V +K++ +R  RG L ++D H+N+VL
Sbjct: 1  MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 51


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%)

Query: 1  MEDEQIPTISVKEPLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          M D     ++V+ PLD +  SL+  V +K++ +R  RG L ++D H+N+VL
Sbjct: 1  MIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVL 51


>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
          Length = 77

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%)

Query: 14 PLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVLG 52
          PLD+I  SLD+ V V ++     RG+L  YD HLN+VL 
Sbjct: 7  PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLA 45


>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
          Length = 75

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%)

Query: 14 PLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVLG 52
          PLD+I  SLD+ V V ++     RG+L  YD HLN+VL 
Sbjct: 5  PLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLA 43


>pdb|1B34|B Chain B, Crystal Structure Of The D1d2 Sub-Complex From The Human
           Snrnp Core Domain
 pdb|3CW1|C Chain C, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|P Chain P, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Q Chain Q, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|R Chain R, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|Y Chain Y, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|V Chain V, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|B Chain B, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
           Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|B Chain B, Macromolecular Machine 6
 pdb|4F7U|D Chain D, Macromolecular Machine 6
 pdb|1VU2|B Chain B, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|J Chain J, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|R Chain R, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|Z Chain Z, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|HH Chain h, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|PP Chain p, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|XX Chain x, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|B Chain B, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|J Chain J, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|R Chain R, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|Z Chain Z, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|HH Chain h, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|PP Chain p, The 8s Snrnp Assembly Intermediate
 pdb|4F77|J Chain J, The 8s Snrnp Assembly Intermediate
 pdb|4F77|B Chain B, The 8s Snrnp Assembly Intermediate
 pdb|4F77|R Chain R, The 8s Snrnp Assembly Intermediate
 pdb|4F77|Z Chain Z, The 8s Snrnp Assembly Intermediate
 pdb|4F77|HH Chain h, The 8s Snrnp Assembly Intermediate
 pdb|4F77|PP Chain p, The 8s Snrnp Assembly Intermediate
 pdb|4F77|XX Chain x, The 8s Snrnp Assembly Intermediate
          Length = 118

 Score = 35.8 bits (81), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 14  PLDLIRLSL--DERVHVKMRNERVLRGKLHAYDQHLNMVL-GXXXXXXXXXXXXXXXXXX 70
           PL ++  S+  + +V +  RN + L G++ A+D+H NMVL                    
Sbjct: 28  PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKS 87

Query: 71  XXXXXXRSIPMLFVRGDGVILV 92
                 R I  +F+RGD VI+V
Sbjct: 88  KPVNKDRYISKMFLRGDSVIVV 109


>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
          Associated Sm-Like Protein Lsm5
 pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
 pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
          Snrna-Associated Sm- Like Protein Lsm5
          Length = 121

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 14 PLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          PL LI   +  R++V M+ ++   G L  +D+++NMVL
Sbjct: 29 PLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVL 66


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 32.3 bits (72), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 24/31 (77%)

Query: 21 SLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          S+ ++V VK+R+   +RG L ++DQH+N++L
Sbjct: 19 SIGKQVLVKLRDSHEIRGILRSFDQHVNLLL 49


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 32.3 bits (72), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 14 PLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          PL+LI   +   + V M++ER   G L  +D ++N+VL
Sbjct: 9  PLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVL 46


>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
          Length = 94

 Score = 30.4 bits (67), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 14 PLDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          PL+LI   +   + V  ++ER   G L  +D ++N+VL
Sbjct: 21 PLELIDKCIGSNLWVIXKSEREFAGTLVGFDDYVNIVL 58


>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
          Length = 231

 Score = 29.3 bits (64), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 20/30 (66%)

Query: 22 LDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          +D R+   +++ R+  G   A+D+H+N++L
Sbjct: 13 IDYRMRCILQDGRIFIGTFKAFDKHMNLIL 42


>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 174

 Score = 29.3 bits (64), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 20/30 (66%)

Query: 22 LDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          +D R+   +++ R+  G   A+D+H+N++L
Sbjct: 13 IDYRMRCILQDGRIFIGTFKAFDKHMNLIL 42


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 28.5 bits (62), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 15 LDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          LDL R   D+R+       R + G L  +DQ +N+VL
Sbjct: 30 LDLSRYQ-DQRIQATFTGGRQITGILKGFDQLMNLVL 65


>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 95

 Score = 28.5 bits (62), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 20/30 (66%)

Query: 22 LDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          +D R+   +++ R+  G   A+D+H+N++L
Sbjct: 13 IDYRMRCILQDGRIFIGTFKAFDKHMNLIL 42


>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 91

 Score = 28.5 bits (62), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 20/30 (66%)

Query: 22 LDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          +D R+   +++ R+  G   A+D+H+N++L
Sbjct: 13 IDYRMRCILQDGRIFIGTFKAFDKHMNLIL 42


>pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|B Chain B, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|C Chain C, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|D Chain D, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|E Chain E, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|F Chain F, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|G Chain G, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|H Chain H, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|I Chain I, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|J Chain J, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|K Chain K, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|L Chain L, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|M Chain M, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|N Chain N, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|O Chain O, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|P Chain P, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Q Chain Q, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|R Chain R, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|S Chain S, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|T Chain T, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|U Chain U, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|V Chain V, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|W Chain W, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|X Chain X, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Y Chain Y, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|Z Chain Z, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|1 Chain 1, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
 pdb|1M5Q|2 Chain 2, Crystal Structure Of A Novel Sm-Like Archaeal Protein
          From Pyrobaculum Aerophilum
          Length = 130

 Score = 28.1 bits (61), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 22 LDERVHVKMRNERVLRGKLHAYDQHLNMVLG 52
          L   V V + N  V +G LHA D  LN+VL 
Sbjct: 9  LGREVQVVLSNGEVYKGVLHAVDNQLNIVLA 39


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 27.3 bits (59), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 15 LDLIRLSLDERVHVKMRNERVLRGKLHAYDQHLNMVL 51
          LDL R   D+R+       R + G L  +DQ  N+VL
Sbjct: 26 LDLSRYQ-DQRIQATFTGGRQITGILKGFDQLXNLVL 61


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.141    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,159,390
Number of Sequences: 62578
Number of extensions: 48599
Number of successful extensions: 121
Number of sequences better than 100.0: 26
Number of HSP's better than 100.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 93
Number of HSP's gapped (non-prelim): 26
length of query: 101
length of database: 14,973,337
effective HSP length: 67
effective length of query: 34
effective length of database: 10,780,611
effective search space: 366540774
effective search space used: 366540774
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)