Query         psy3162
Match_columns 91
No_of_seqs    140 out of 823
Neff          6.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:58:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3162.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3162hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0944|consensus               99.9 1.6E-22 3.4E-27  161.6   5.0   86    5-91    470-562 (763)
  2 cd02668 Peptidase_C19L A subfa  99.7 1.3E-17 2.9E-22  123.3   7.1   73    7-79    155-239 (324)
  3 cd02667 Peptidase_C19K A subfa  99.7 2.6E-17 5.6E-22  119.7   6.3   71    5-78    108-189 (279)
  4 cd02660 Peptidase_C19D A subfa  99.7 3.9E-17 8.4E-22  119.9   7.1   74    5-78    173-256 (328)
  5 cd02663 Peptidase_C19G A subfa  99.7 9.3E-17   2E-21  117.7   7.2   70    7-76    146-227 (300)
  6 KOG1865|consensus               99.7 3.5E-17 7.6E-22  128.9   3.6   65   15-85    284-348 (545)
  7 cd02664 Peptidase_C19H A subfa  99.7 1.1E-16 2.4E-21  118.8   5.3   61   16-76    153-214 (327)
  8 COG5560 UBP12 Ubiquitin C-term  99.6 1.3E-17 2.9E-22  133.4  -0.4   73    5-78    672-756 (823)
  9 cd02671 Peptidase_C19O A subfa  99.6 5.2E-16 1.1E-20  116.4   6.5   71    7-77    179-265 (332)
 10 cd02659 peptidase_C19C A subfa  99.6 3.1E-15 6.8E-20  110.0   7.4   74    7-80    150-235 (334)
 11 cd02669 Peptidase_C19M A subfa  99.6   2E-15 4.4E-20  116.6   4.4   70    7-78    302-372 (440)
 12 cd02657 Peptidase_C19A A subfa  99.6   7E-15 1.5E-19  107.2   6.2   71    7-77    159-236 (305)
 13 cd02658 Peptidase_C19B A subfa  99.5 1.4E-14   3E-19  106.0   6.8   70    6-75    176-252 (311)
 14 KOG1866|consensus               99.5 4.9E-16 1.1E-20  126.0  -2.3   67   15-81    264-331 (944)
 15 KOG1870|consensus               99.5 2.4E-15 5.2E-20  124.1   0.9   76    4-80    692-779 (842)
 16 cd02674 Peptidase_C19R A subfa  99.5 2.6E-14 5.7E-19   99.9   5.5   70    6-76     82-163 (230)
 17 cd02661 Peptidase_C19E A subfa  99.5 3.2E-14 6.8E-19  102.5   5.8   69    8-79    162-241 (304)
 18 cd02662 Peptidase_C19F A subfa  99.4 6.4E-13 1.4E-17   95.0   6.1   56    7-70     95-158 (240)
 19 KOG4598|consensus               99.4 1.1E-13 2.4E-18  112.5   1.0   69   15-83    232-301 (1203)
 20 cd02672 Peptidase_C19P A subfa  99.4 1.2E-12 2.6E-17   95.9   5.6   72    6-77    115-204 (268)
 21 cd02670 Peptidase_C19N A subfa  99.3 9.4E-13   2E-17   95.6   4.4   61    6-79     78-138 (241)
 22 COG5207 UBP14 Isopeptidase T [  99.2 2.8E-12 6.1E-17  101.6   2.6   74   16-90    476-551 (749)
 23 cd02257 Peptidase_C19 Peptidas  99.2 2.4E-11 5.2E-16   82.9   6.9   72    6-77     97-178 (255)
 24 COG5533 UBP5 Ubiquitin C-termi  99.2 1.6E-11 3.4E-16   92.7   4.4   49   15-64    282-330 (415)
 25 cd02665 Peptidase_C19I A subfa  99.1 1.1E-10 2.4E-15   84.2   3.4   67    8-75     93-164 (228)
 26 KOG1868|consensus               99.0 7.5E-11 1.6E-15   95.5  -0.4   69    7-76    496-578 (653)
 27 KOG1867|consensus               98.9 5.9E-10 1.3E-14   88.0   3.2   71    8-78    334-415 (492)
 28 PF00443 UCH:  Ubiquitin carbox  98.9 7.5E-10 1.6E-14   76.9   3.0   62   15-81    140-203 (269)
 29 cd02673 Peptidase_C19Q A subfa  98.9 1.3E-09 2.9E-14   78.9   3.9   44    8-52    110-160 (245)
 30 PF13423 UCH_1:  Ubiquitin carb  98.7 2.9E-08 6.4E-13   72.7   5.3   79    2-81    157-243 (295)
 31 KOG1864|consensus               98.6 1.6E-08 3.4E-13   81.4   2.2   68   15-82    439-507 (587)
 32 KOG1873|consensus               98.6 2.5E-09 5.4E-14   87.5  -2.9   70    7-76    677-784 (877)
 33 COG5077 Ubiquitin carboxyl-ter  98.5 2.3E-08   5E-13   82.5  -0.2   64   16-80    357-421 (1089)
 34 KOG1863|consensus               98.4   8E-08 1.7E-12   81.7   1.3   61   18-78    338-399 (1093)
 35 KOG2026|consensus               97.5 6.8E-05 1.5E-09   58.2   2.8   46   31-77    327-373 (442)
 36 KOG1871|consensus               97.1 3.8E-05 8.3E-10   59.5  -2.5   59   16-74    280-338 (420)
 37 KOG1872|consensus               96.4 0.00033 7.1E-09   55.3  -2.4   62   20-81    287-349 (473)
 38 COG3478 Predicted nucleic-acid  92.3    0.18 3.8E-06   30.2   2.8   36   16-51      3-40  (68)
 39 PF09855 DUF2082:  Nucleic-acid  88.2     0.6 1.3E-05   27.7   2.7   34   18-51      1-36  (64)
 40 cd02666 Peptidase_C19J A subfa  83.8    0.16 3.4E-06   38.7  -1.8   45    6-75    187-231 (343)
 41 PF15499 Peptidase_C98:  Ubiqui  80.5     0.6 1.3E-05   34.9   0.3   26   19-45    172-197 (275)
 42 TIGR00373 conserved hypothetic  77.3     1.5 3.3E-05   29.9   1.5   24    3-26    114-137 (158)
 43 KOG2463|consensus               72.4     5.5 0.00012   30.9   3.5   37   15-52    255-292 (376)
 44 PF14690 zf-ISL3:  zinc-finger   71.4     7.4 0.00016   20.6   3.1   34   18-51      3-44  (47)
 45 KOG1275|consensus               70.5     1.7 3.6E-05   37.7   0.5   59   18-76    702-763 (1118)
 46 PRK06266 transcription initiat  69.4     3.3 7.1E-05   28.9   1.7   23    5-27    124-146 (178)
 47 TIGR00310 ZPR1_znf ZPR1 zinc f  67.9     5.8 0.00013   28.1   2.7   63   10-74     23-87  (192)
 48 PF14205 Cys_rich_KTR:  Cystein  67.5     3.6 7.7E-05   23.8   1.3   24   18-41      5-30  (55)
 49 PF07754 DUF1610:  Domain of un  66.5     2.8 6.2E-05   20.2   0.6   11   15-25     14-24  (24)
 50 TIGR00340 zpr1_rel ZPR1-relate  60.6       8 0.00017   26.7   2.2   62   10-73     21-84  (163)
 51 PF08772 NOB1_Zn_bind:  Nin one  60.0     6.7 0.00015   23.7   1.6   33   15-48     22-54  (73)
 52 COG1675 TFA1 Transcription ini  53.7     8.9 0.00019   26.9   1.6   24    5-28    120-143 (176)
 53 COG1379 PHP family phosphoeste  48.7     8.6 0.00019   30.0   0.9   19    8-26    256-274 (403)
 54 cd00730 rubredoxin Rubredoxin;  47.6     8.8 0.00019   21.5   0.6   15   14-28     31-45  (50)
 55 PF10146 zf-C4H2:  Zinc finger-  45.9      13 0.00029   27.0   1.6   27    3-29    190-220 (230)
 56 cd00350 rubredoxin_like Rubred  45.1      10 0.00023   19.0   0.6   14   16-29     16-29  (33)
 57 PF09723 Zn-ribbon_8:  Zinc rib  44.5      15 0.00032   19.5   1.2   14   17-30      5-18  (42)
 58 smart00440 ZnF_C2C2 C2C2 Zinc   44.4      26 0.00057   18.4   2.2   18   18-35      1-18  (40)
 59 PF14353 CpXC:  CpXC protein     44.4      17 0.00037   23.4   1.7   15   15-29     36-50  (128)
 60 COG5533 UBP5 Ubiquitin C-termi  43.1      38 0.00082   26.5   3.6   64   15-78    233-334 (415)
 61 PF12760 Zn_Tnp_IS1595:  Transp  42.7      21 0.00046   19.1   1.7   12   15-26     16-27  (46)
 62 PF00301 Rubredoxin:  Rubredoxi  40.5      17 0.00036   20.1   1.1   14   14-27     31-44  (47)
 63 PF12171 zf-C2H2_jaz:  Zinc-fin  40.1      14  0.0003   17.4   0.6   10   17-26      1-10  (27)
 64 PF04606 Ogr_Delta:  Ogr/Delta-  37.9      20 0.00044   19.4   1.1   18   19-36      1-18  (47)
 65 PF03367 zf-ZPR1:  ZPR1 zinc-fi  37.7      51  0.0011   22.5   3.3   20   13-32     26-45  (161)
 66 PF13894 zf-C2H2_4:  C2H2-type   37.6      15 0.00031   15.9   0.4   10   18-27      1-10  (24)
 67 TIGR00155 pqiA_fam integral me  37.3      19 0.00041   28.2   1.2   29    1-29      1-45  (403)
 68 PF00096 zf-C2H2:  Zinc finger,  37.1      11 0.00024   16.7  -0.1    9   18-26      1-9   (23)
 69 PRK14890 putative Zn-ribbon RN  37.0      18 0.00038   21.2   0.8   12   15-26     46-57  (59)
 70 cd04476 RPA1_DBD_C RPA1_DBD_C:  36.0      24 0.00051   23.6   1.5   12   16-27     50-61  (166)
 71 PF13240 zinc_ribbon_2:  zinc-r  35.1      19 0.00041   16.8   0.6   11   19-29      1-11  (23)
 72 PF01096 TFIIS_C:  Transcriptio  33.9      41  0.0009   17.5   1.9   16   18-33      1-16  (39)
 73 COG2888 Predicted Zn-ribbon RN  33.5      21 0.00046   21.0   0.8   12   15-26     48-59  (61)
 74 PF01780 Ribosomal_L37ae:  Ribo  33.5      21 0.00047   22.5   0.9   22   15-36     33-54  (90)
 75 TIGR03831 YgiT_finger YgiT-typ  33.0      20 0.00044   18.5   0.6   13   15-27     30-42  (46)
 76 TIGR00280 L37a ribosomal prote  31.5      46   0.001   21.0   2.1   23   15-37     33-55  (91)
 77 PF08271 TF_Zn_Ribbon:  TFIIB z  31.3      24 0.00052   18.6   0.7   10   18-27      1-10  (43)
 78 PRK03976 rpl37ae 50S ribosomal  31.0      49  0.0011   20.8   2.2   24   15-38     34-57  (90)
 79 PF08646 Rep_fac-A_C:  Replicat  31.0      23 0.00051   23.2   0.8   12   16-27     36-47  (146)
 80 smart00834 CxxC_CXXC_SSSS Puta  30.6      34 0.00074   17.3   1.2   15   17-31      5-19  (41)
 81 PF06397 Desulfoferrod_N:  Desu  30.5      32 0.00069   18.0   1.1   16   16-31      5-20  (36)
 82 PF04828 GFA:  Glutathione-depe  30.0      54  0.0012   19.0   2.2   33   15-51     46-78  (92)
 83 TIGR03071 couple_hipA HipA N-t  29.9      17 0.00037   22.3  -0.0   41   48-90     23-66  (101)
 84 smart00709 Zpr1 Duplicated dom  29.6      95   0.002   21.3   3.6   23   10-32     22-44  (160)
 85 PF09297 zf-NADH-PPase:  NADH p  29.4      31 0.00067   17.0   0.9   13   17-29      3-15  (32)
 86 PTZ00255 60S ribosomal protein  29.3      52  0.0011   20.7   2.1   23   15-37     34-56  (90)
 87 smart00531 TFIIE Transcription  28.7      35 0.00076   22.7   1.3   11   17-27     99-109 (147)
 88 PRK00398 rpoP DNA-directed RNA  28.4      34 0.00074   18.2   1.0   11   17-27      3-13  (46)
 89 COG4830 RPS26B Ribosomal prote  28.3      47   0.001   21.5   1.8   21   18-38     21-44  (108)
 90 KOG0402|consensus               27.4      17 0.00037   22.9  -0.4   23   15-37     34-56  (92)
 91 PRK12366 replication factor A;  27.4      37 0.00079   28.1   1.5   11   16-26    547-557 (637)
 92 TIGR02605 CxxC_CxxC_SSSS putat  26.5      42 0.00091   18.0   1.2   12   17-28      5-16  (52)
 93 PF05605 zf-Di19:  Drought indu  26.5      37  0.0008   18.6   0.9   10   16-25      1-10  (54)
 94 PF04795 PAPA-1:  PAPA-1-like c  26.2      53  0.0011   20.3   1.7   19   54-72     70-88  (89)
 95 COG1997 RPL43A Ribosomal prote  25.8      53  0.0011   20.7   1.6   13   14-26     32-44  (89)
 96 PRK08270 anaerobic ribonucleos  25.6      54  0.0012   27.4   2.1   25    8-32    624-654 (656)
 97 PF13465 zf-H2C2_2:  Zinc-finge  25.5      23 0.00049   16.7  -0.0   11   16-26     13-23  (26)
 98 PF13248 zf-ribbon_3:  zinc-rib  25.2      29 0.00064   16.4   0.3   11   16-26     15-25  (26)
 99 TIGR00416 sms DNA repair prote  24.9      40 0.00087   26.7   1.2   29    1-29      1-33  (454)
100 smart00547 ZnF_RBZ Zinc finger  24.8      41 0.00088   15.5   0.8   13   16-28      1-13  (26)
101 PRK11823 DNA repair protein Ra  24.5      43 0.00093   26.4   1.3   31    1-31      1-35  (446)
102 cd00974 DSRD Desulforedoxin (D  23.9      58  0.0013   16.2   1.4   15   16-30      3-17  (34)
103 PF10825 DUF2752:  Protein of u  23.6      30 0.00065   19.2   0.2   13   16-28      8-20  (52)
104 PHA02768 hypothetical protein;  23.6      34 0.00074   19.6   0.4   12   16-27      4-15  (55)
105 PF08792 A2L_zn_ribbon:  A2L zi  23.4      47   0.001   16.9   0.9   14   16-29      2-15  (33)
106 COG5257 GCD11 Translation init  23.1      81  0.0018   24.9   2.5   26   15-40     70-95  (415)
107 TIGR00319 desulf_FeS4 desulfof  23.0      62  0.0013   16.1   1.3   15   16-30      6-20  (34)
108 PF04438 zf-HIT:  HIT zinc fing  22.2      38 0.00082   16.8   0.4   11   16-26     12-22  (30)
109 PF03811 Zn_Tnp_IS1:  InsA N-te  21.9      59  0.0013   16.9   1.1   15   17-31      5-19  (36)
110 PF10609 ParA:  ParA/MinD ATPas  21.3      35 0.00076   20.9   0.2   13   15-27     63-75  (81)
111 KOG2324|consensus               21.1 1.1E+02  0.0024   24.4   2.9   49   18-76    248-300 (457)
112 PHA00616 hypothetical protein   20.8      31 0.00067   18.9  -0.1    9   18-26      2-10  (44)
113 smart00355 ZnF_C2H2 zinc finge  20.8      51  0.0011   14.0   0.7    9   18-26      1-9   (26)
114 TIGR00622 ssl1 transcription f  20.7      52  0.0011   21.5   0.9   35   17-51      1-36  (112)
115 PF03604 DNA_RNApol_7kD:  DNA d  20.5      49  0.0011   16.7   0.6   11   18-28      1-11  (32)
116 PF08209 Sgf11:  Sgf11 (transcr  20.2      42 0.00091   17.2   0.3   13   17-29      4-16  (33)
117 TIGR03830 CxxCG_CxxCG_HTH puta  20.0      48   0.001   20.8   0.7   12   15-26     29-40  (127)

No 1  
>KOG0944|consensus
Probab=99.86  E-value=1.6e-22  Score=161.65  Aligned_cols=86  Identities=38%  Similarity=0.674  Sum_probs=82.0

Q ss_pred             CCCCchhhhh-------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCCC
Q psy3162           5 QPTKSFLGLY-------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRG   77 (91)
Q Consensus         5 ~~~~sl~~cl-------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~~   77 (91)
                      |..|++..|+       .++|.|.+||+|..|+|+++|++||+|||||++||.+ .+|.++|++++|++|++|||+.|++
T Consensus       470 ~~~v~~~~cleaff~pq~~df~s~ac~~K~~a~kt~~~ksfP~yLiiqv~rf~~-~dw~pkKld~~iempe~ldls~~rs  548 (763)
T KOG0944|consen  470 REKVPISACLEAFFEPQVDDFWSTACGEKKGATKTTRFKSFPDYLIIQVGRFTL-QDWVPKKLDVSIEMPEELDLSSYRS  548 (763)
T ss_pred             cccCCHHHHHHHhcCCcchhhhhHhhcCccccccccccccCCceEEEEeeEEEe-cCceeeeeccceecchhhchhhhhh
Confidence            5678899999       4699999999999999999999999999999999999 8999999999999999999999999


Q ss_pred             CCCCCCCccCCCCC
Q psy3162          78 SGPQPGEEMLPEVA   91 (91)
Q Consensus        78 ~g~q~ge~~lpe~~   91 (91)
                      .|+||||++||+++
T Consensus       549 ~g~~p~ee~lpde~  562 (763)
T KOG0944|consen  549 KGLQPGEEALPDEA  562 (763)
T ss_pred             cCCCCcccccCCcC
Confidence            99999999999975


No 2  
>cd02668 Peptidase_C19L A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.72  E-value=1.3e-17  Score=123.25  Aligned_cols=73  Identities=18%  Similarity=0.296  Sum_probs=65.3

Q ss_pred             CCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCC
Q psy3162           7 TKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTP   74 (91)
Q Consensus         7 ~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~   74 (91)
                      ..||++|+           .+.|.|++|++++.|.|+..|.++|++|+||||||.++. .+...|+++.|+||+.|||++
T Consensus       155 ~~sl~~~L~~~~~~e~l~g~~~~~C~~C~~~~~a~k~~~i~~lP~iLii~LkRf~~d~~~~~~~Ki~~~v~fp~~Ldl~~  234 (324)
T cd02668         155 HKTLEECIDEFLKEEQLTGDNQYFCESCNSKTDATRRIRLTTLPPTLNFQLLRFVFDRKTGAKKKLNASISFPEILDMGE  234 (324)
T ss_pred             cCCHHHHHHHhhCceecCCCccccCCCCCceeeeEEEEEecCCCCeEEEEEEcceeecccCcceeCCcEEECCCeEechh
Confidence            46889998           245999999999999999999999999999999999974 477899999999999999999


Q ss_pred             CCCCC
Q psy3162          75 LRGSG   79 (91)
Q Consensus        75 ~~~~g   79 (91)
                      |+..+
T Consensus       235 ~~~~~  239 (324)
T cd02668         235 YLAES  239 (324)
T ss_pred             hcccc
Confidence            97543


No 3  
>cd02667 Peptidase_C19K A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.70  E-value=2.6e-17  Score=119.70  Aligned_cols=71  Identities=21%  Similarity=0.318  Sum_probs=64.5

Q ss_pred             CCCCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCC
Q psy3162           5 QPTKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLT   73 (91)
Q Consensus         5 ~~~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls   73 (91)
                      ...+||++|+           .+.|.|++|++   |+|+..|.++|++|+||||||.++.+|...|+++.|+||+.|||+
T Consensus       108 ~~~~sL~~~L~~~~~~E~l~~~~~~~C~~C~~---a~k~~~i~~~P~~Lii~LkRF~~~~~~~~~Ki~~~v~fP~~Ldl~  184 (279)
T cd02667         108 KSECSIESCLKQFTEVEILEGNNKFACENCTK---AKKQYLISKLPPVLVIHLKRFQQPRSANLRKVSRHVSFPEILDLA  184 (279)
T ss_pred             CCCCCHHHHHHhhcCeeEecCCCcccCCccCc---eeeEeEhhhCCCeEEEEEeccccCcccCceecCceEeCCCccchh
Confidence            4568999999           25699999998   899999999999999999999997777889999999999999999


Q ss_pred             CCCCC
Q psy3162          74 PLRGS   78 (91)
Q Consensus        74 ~~~~~   78 (91)
                      +|+..
T Consensus       185 ~~~~~  189 (279)
T cd02667         185 PFCDP  189 (279)
T ss_pred             hccCc
Confidence            99865


No 4  
>cd02660 Peptidase_C19D A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.70  E-value=3.9e-17  Score=119.87  Aligned_cols=74  Identities=20%  Similarity=0.248  Sum_probs=66.4

Q ss_pred             CCCCchhhhh--------c--CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCC
Q psy3162           5 QPTKSFLGLY--------C--GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTP   74 (91)
Q Consensus         5 ~~~~sl~~cl--------~--~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~   74 (91)
                      .+..||++|+        +  +.|+|++|+.++.+.|++.|.++|++|+||||||.++..|...|++..|.||.+|||++
T Consensus       173 ~~~~sl~~~L~~~~~~e~~~~~~~~C~~C~~~~~~~~~~~i~~lP~~Lii~lkRf~~~~~~~~~K~~~~v~fp~~Ldl~~  252 (328)
T cd02660         173 SGTPTLSDCLDRFTRPEKLGDFAYKCSGCGSTQEATKQLSIKKLPPVLCFQLKRFEHSLNKTSRKIDTYVQFPLELNMTP  252 (328)
T ss_pred             CCCCCHHHHHHHhcCccccCCCCccCCCCCCccceEEEEEecCCCceeEEEEEeEEecCCCCCcCCCcEEeCCCEechhh
Confidence            3458999998        1  23899999999999999999999999999999999965588899999999999999999


Q ss_pred             CCCC
Q psy3162          75 LRGS   78 (91)
Q Consensus        75 ~~~~   78 (91)
                      |+..
T Consensus       253 ~~~~  256 (328)
T cd02660         253 YTSS  256 (328)
T ss_pred             hccc
Confidence            9875


No 5  
>cd02663 Peptidase_C19G A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.68  E-value=9.3e-17  Score=117.67  Aligned_cols=70  Identities=20%  Similarity=0.220  Sum_probs=62.9

Q ss_pred             CCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCC-CeeeecceEEecCCCCCCCC
Q psy3162           7 TKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKED-WTLAKLDVEVEMPDTIDLTP   74 (91)
Q Consensus         7 ~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~-~~~~Kl~~~V~~P~~LDls~   74 (91)
                      ..||++|+           .+.|+|++|+.++.|+|++.|.++|++|+||||||.++.. +...|++..|.||.+|||..
T Consensus       146 ~~sl~~~L~~~~~~E~l~~~~~~~C~~C~~~~~a~k~~~i~~lP~vLii~LkRF~~~~~~~~~~Ki~~~v~fp~~L~~~~  225 (300)
T cd02663         146 NTSITSCLRQFSATETLCGRNKFYCDECCSLQEAEKRMKIKKLPKILALHLKRFKYDEQLNRYIKLFYRVVFPLELRLFN  225 (300)
T ss_pred             cCCHHHHHHHhhcccccCCCCcEECCCCCCceeEEEEEEeccCCceeEEEEEeEEeecccCCceecCceEecCcEEeccc
Confidence            56899998           2579999999999999999999999999999999999754 36789999999999999988


Q ss_pred             CC
Q psy3162          75 LR   76 (91)
Q Consensus        75 ~~   76 (91)
                      +.
T Consensus       226 ~~  227 (300)
T cd02663         226 TT  227 (300)
T ss_pred             cc
Confidence            74


No 6  
>KOG1865|consensus
Probab=99.66  E-value=3.5e-17  Score=128.86  Aligned_cols=65  Identities=26%  Similarity=0.358  Sum_probs=59.8

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCCCCCCCCCCc
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSGPQPGEE   85 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~~~g~q~ge~   85 (91)
                      .|.|+|++|++++.|.|+++|.+.|.||+||||||+.   ++..||+..|.||+.|||.+|++   |++|.
T Consensus       284 en~Y~C~~Ck~~v~A~K~lti~raPnVLTi~LKRF~~---~~~gKI~K~I~fPE~LDl~PyMS---~~~e~  348 (545)
T KOG1865|consen  284 ENAYHCGRCKQKVPASKQLTIHRAPNVLTLHLKRFSN---GTGGKISKPVSFPETLDLQPYMS---QPNEG  348 (545)
T ss_pred             ccccccchhhhhCcccceeeeecCCceEEEeeehhcc---CcccccccccCCccccccccccc---CCCCC
Confidence            5899999999999999999999999999999999997   45679999999999999999998   45554


No 7  
>cd02664 Peptidase_C19H A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.66  E-value=1.1e-16  Score=118.83  Aligned_cols=61  Identities=13%  Similarity=0.250  Sum_probs=56.5

Q ss_pred             CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCC-CeeeecceEEecCCCCCCCCCC
Q psy3162          16 GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKED-WTLAKLDVEVEMPDTIDLTPLR   76 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~-~~~~Kl~~~V~~P~~LDls~~~   76 (91)
                      +.|+|++|++++.|.|++.|.++|+||+||||||.++.. +...|++..|.||..|||..|.
T Consensus       153 n~~~C~~C~~~~~a~k~~~i~~lP~vLii~LkRF~~~~~~~~~~Ki~~~v~fp~~ldl~~~~  214 (327)
T cd02664         153 NQYYCEKCASLQDAEKEMKVTGAPEYLILTLLRFSYDQKTHVREKIMDNVSINEVLSLPVRV  214 (327)
T ss_pred             CceeCCccCCccceeEEEEcccCChhhEEEeeeeEEccccCcceecCceEecCCEEecCccc
Confidence            459999999999999999999999999999999999754 6778999999999999999886


No 8  
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=99.65  E-value=1.3e-17  Score=133.43  Aligned_cols=73  Identities=22%  Similarity=0.226  Sum_probs=67.6

Q ss_pred             CCCCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecC-CCCCC
Q psy3162           5 QPTKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMP-DTIDL   72 (91)
Q Consensus         5 ~~~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P-~~LDl   72 (91)
                      ..++||.+|+           .+.|+|+.|++++.|+|++.|+++|.+||||||||.. .+..+.|+++-|.|| ++|||
T Consensus       672 ~rtiTL~dCl~eFskpEqLgl~DswyCpgCkefrqasKqmelwrlP~iLiihLkRFss-~rsfrdKiddlVeyPiddldL  750 (823)
T COG5560         672 ERTITLQDCLNEFSKPEQLGLSDSWYCPGCKEFRQASKQMELWRLPMILIIHLKRFSS-VRSFRDKIDDLVEYPIDDLDL  750 (823)
T ss_pred             cCCCcHHHHHHHhccHhhcCCcccccCCchHhhhhhhhhhhhhcCChheeeehhhhhh-cccchhhhhhhhccccccccc
Confidence            3689999999           5899999999999999999999999999999999998 677889999999999 99999


Q ss_pred             CCCCCC
Q psy3162          73 TPLRGS   78 (91)
Q Consensus        73 s~~~~~   78 (91)
                      +.+.+.
T Consensus       751 s~~~~~  756 (823)
T COG5560         751 SGVEYM  756 (823)
T ss_pred             cceEEe
Confidence            987654


No 9  
>cd02671 Peptidase_C19O A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.63  E-value=5.2e-16  Score=116.37  Aligned_cols=71  Identities=17%  Similarity=0.191  Sum_probs=62.3

Q ss_pred             CCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCC-----CeeeecceEEecCCCC
Q psy3162           7 TKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKED-----WTLAKLDVEVEMPDTI   70 (91)
Q Consensus         7 ~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~-----~~~~Kl~~~V~~P~~L   70 (91)
                      ..||++|+           .|+|+|++|+.++.|+|++.|.++|++|+||||||.++..     +...|++..|.||..|
T Consensus       179 ~~tL~~~L~~f~~~E~l~g~n~y~C~~C~~~~~a~k~~~~~~~P~vL~i~LkRF~~~~~~~~~~~~~~Ki~~~v~fp~~L  258 (332)
T cd02671         179 MKTLKWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKLPEVITIHLKCFAANGSEFDCYGGLSKVNTPLLTPLKL  258 (332)
T ss_pred             cCCHHHHHHHhCCcceecCCCCeeCCCCCCceeEEEEEEEecCCCEEEEEeeeeccccccccccCCceecCccccCcccc
Confidence            36899998           2579999999999999999999999999999999998532     2468999999999999


Q ss_pred             CCCCCCC
Q psy3162          71 DLTPLRG   77 (91)
Q Consensus        71 Dls~~~~   77 (91)
                      ||.++..
T Consensus       259 ~~~~~~~  265 (332)
T cd02671         259 SLEEWST  265 (332)
T ss_pred             ccccccC
Confidence            9998764


No 10 
>cd02659 peptidase_C19C A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.59  E-value=3.1e-15  Score=110.00  Aligned_cols=74  Identities=18%  Similarity=0.243  Sum_probs=64.7

Q ss_pred             CCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCC
Q psy3162           7 TKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTP   74 (91)
Q Consensus         7 ~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~   74 (91)
                      ..++++|+           .+.|+|++|++++.|.|+..|.++|++|+|||+||.++. .+...|++..|+||..|||++
T Consensus       150 ~~~l~~~l~~~~~~e~l~~~~~~~C~~C~~~~~~~k~~~i~~lP~vLii~l~Rf~~~~~~~~~~K~~~~v~fp~~Ldl~~  229 (334)
T cd02659         150 KKNLEESLDAYVQGETLEGDNKYFCEKCGKKVDAEKGVCFKKLPPVLTLQLKRFEFDFETMMRIKINDRFEFPLELDMEP  229 (334)
T ss_pred             CCCHHHHHHHhcCeeEecCCccEecCcCCCcccEEEEEEeecCCCEEEEEeeeeEEccccCcceeCCceEeCCceecCcc
Confidence            45677887           245999999999999999999999999999999999963 366789999999999999999


Q ss_pred             CCCCCC
Q psy3162          75 LRGSGP   80 (91)
Q Consensus        75 ~~~~g~   80 (91)
                      |+..+.
T Consensus       230 ~~~~~~  235 (334)
T cd02659         230 YTEKGL  235 (334)
T ss_pred             cccccc
Confidence            987654


No 11 
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.57  E-value=2e-15  Score=116.58  Aligned_cols=70  Identities=21%  Similarity=0.312  Sum_probs=63.1

Q ss_pred             CCchhhhhcCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCC-CCCCCCCCC
Q psy3162           7 TKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDT-IDLTPLRGS   78 (91)
Q Consensus         7 ~~sl~~cl~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~-LDls~~~~~   78 (91)
                      .+++++|+ ++|.|+.|.....|+|+++|+++|+||+||||||.++ .+...|+++.|+||.. |||++|...
T Consensus       302 ~~~l~e~L-~ky~~~~c~~~~~a~k~~~I~~LP~vLiihLKRF~~~-~~~~~K~~t~V~FP~~~LDm~~y~~~  372 (440)
T cd02669         302 QVPLKQLL-KKYDGKTETELKDSLKRYLISRLPKYLIFHIKRFSKN-NFFKEKNPTIVNFPIKNLDLSDYVHF  372 (440)
T ss_pred             cccHHHHH-HhcCCccceecccceEEEEEeeCCcEEEEEEecccCC-CCccccCCCEEECCCCccchhhhhCc
Confidence            47888887 5899999999999999999999999999999999995 4677899999999975 899999863


No 12 
>cd02657 Peptidase_C19A A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.56  E-value=7e-15  Score=107.15  Aligned_cols=71  Identities=23%  Similarity=0.221  Sum_probs=62.0

Q ss_pred             CCchhhhhc------CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCC-CeeeecceEEecCCCCCCCCCCC
Q psy3162           7 TKSFLGLYC------GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKED-WTLAKLDVEVEMPDTIDLTPLRG   77 (91)
Q Consensus         7 ~~sl~~cl~------~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~-~~~~Kl~~~V~~P~~LDls~~~~   77 (91)
                      ..+|++|+.      ....|+.|+....++|+..|.++|++|+||||||.++.. +...|+++.|.||.+|||++|+.
T Consensus       159 ~~~l~~~L~~~~~~~~~~~~~~~~~~~~~~k~~~i~~lP~vLii~LkRF~~~~~~~~~~Ki~~~v~fP~~Ldl~~~~~  236 (305)
T cd02657         159 VNYLQDGLKKGLEEEIEKHSPTLGRDAIYTKTSRISRLPKYLTVQFVRFFWKRDIQKKAKILRKVKFPFELDLYELCT  236 (305)
T ss_pred             cccHHHHHHHhhhhhhhhcCcccCCCceEEEEEEeccCCcEEEEEEECCccccccCceeecCcEEECCceEecccccC
Confidence            457888883      345799999999999999999999999999999999644 45789999999999999999874


No 13 
>cd02658 Peptidase_C19B A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.54  E-value=1.4e-14  Score=105.98  Aligned_cols=70  Identities=23%  Similarity=0.440  Sum_probs=61.6

Q ss_pred             CCCchhhhh-------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCC
Q psy3162           6 PTKSFLGLY-------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPL   75 (91)
Q Consensus         6 ~~~sl~~cl-------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~   75 (91)
                      +.+||++|+       .-.++|+.|++++.|+|+.+|.++|++|+|||+||.++.+|.+.|++..|.||..|.-..|
T Consensus       176 ~~~sl~~~L~~~~~~e~i~~~C~~C~~~~~a~k~~~i~~lP~vLii~LkRF~~~~~~~~~Ki~~~v~~p~~l~~~~Y  252 (311)
T cd02658         176 EPVPLEDCLKAYFAPETIEDFCSTCKEKTTATKTTGFKTFPDYLVINMKRFQLLENWVPKKLDVPIDVPEELGPGKY  252 (311)
T ss_pred             CCCCHHHHHHHHcCcccccccccCCCCcccEEEEEEeecCCceEEEEeEEEEecCCCceEeeccccccCCcCCCCcE
Confidence            467999999       2357899999999999999999999999999999999778999999999999987744444


No 14 
>KOG1866|consensus
Probab=99.52  E-value=4.9e-16  Score=125.95  Aligned_cols=67  Identities=22%  Similarity=0.319  Sum_probs=62.8

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEEC-CCCeeeecceEEecCCCCCCCCCCCCCCC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMK-EDWTLAKLDVEVEMPDTIDLTPLRGSGPQ   81 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~-~~~~~~Kl~~~V~~P~~LDls~~~~~g~q   81 (91)
                      .|.|+|++|++|+...|++.|++||.||+||||||.|| ++....|.|..+.||.+|||++|..+|..
T Consensus       264 ~nAYhCeKCdeK~~TvkRt~ik~LPsvl~IqLkRF~yD~e~~~~iK~n~~frFP~~ldMePYtvsg~a  331 (944)
T KOG1866|consen  264 ANAYHCEKCDEKVDTVKRTCIKKLPSVLAIQLKRFDYDWERECAIKFNDYFRFPRELDMEPYTVSGVA  331 (944)
T ss_pred             cchhhhhhhhhhhHhHHHHHHhhCChhheehhhhccchhhhccccccchhcccchhhcCCceeehhhh
Confidence            59999999999999999999999999999999999997 56678899999999999999999988865


No 15 
>KOG1870|consensus
Probab=99.51  E-value=2.4e-15  Score=124.08  Aligned_cols=76  Identities=18%  Similarity=0.271  Sum_probs=68.9

Q ss_pred             CCCCCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecC-CCCC
Q psy3162           4 PQPTKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMP-DTID   71 (91)
Q Consensus         4 ~~~~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P-~~LD   71 (91)
                      ..+.+||+.|+           .+.|+|+.|++++.|+|++.++++|++||||||||.+ .++...|+++.|+|| ..||
T Consensus       692 ~~~~~sL~~cl~~F~~~E~L~~~~~w~C~~Cke~~~A~Kk~~lwrlPeiLiihLKrF~~-~r~~~~k~~~~v~fPi~~ld  770 (842)
T KOG1870|consen  692 SPAPNSLESCLELFSEPETLGKDDRWYCPQCKELRQATKKLDLWRLPEILIIHLKRFQY-SRESSSKVKTKVEFPLGSLD  770 (842)
T ss_pred             CCCcccHHHHHHhhcchhcCCccccccChHHHHHHHHhhhhhhhhCCceEEEEeeccee-echhhhhhCccccCCCcCCC
Confidence            44589999999           4899999999999999999999999999999999999 555569999999999 8999


Q ss_pred             CCCCCCCCC
Q psy3162          72 LTPLRGSGP   80 (91)
Q Consensus        72 ls~~~~~g~   80 (91)
                      +++|...+-
T Consensus       771 ~s~~~~~~~  779 (842)
T KOG1870|consen  771 LSEFVVNKE  779 (842)
T ss_pred             cchhhccCc
Confidence            999987653


No 16 
>cd02674 Peptidase_C19R A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.51  E-value=2.6e-14  Score=99.85  Aligned_cols=70  Identities=21%  Similarity=0.328  Sum_probs=63.0

Q ss_pred             CCCchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecC-CCCCCC
Q psy3162           6 PTKSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMP-DTIDLT   73 (91)
Q Consensus         6 ~~~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P-~~LDls   73 (91)
                      +..||.+|+           .+.+.|++|+.++.+.++..|.++|++|+|||+||.++ ++...|++..|.|| +.|||+
T Consensus        82 ~~~sl~~~L~~~~~~e~~~~~~~~~C~~C~~~~~~~~~~~i~~lP~iLii~l~R~~~~-~~~~~K~~~~v~~~~~~l~l~  160 (230)
T cd02674          82 PKVTLEDCLRLFTKEETLDGDNAWKCPKCKKKRKATKKLTISRLPKVLIIHLKRFSFS-RGSTRKLTTPVTFPLNDLDLT  160 (230)
T ss_pred             CCCCHHHHHHHhcCccccCCCCceeCCCCCCccceEEEEEEecCChhhEeEhhheecC-CCCcccCCceEeccccccccc
Confidence            568999998           24699999999999999999999999999999999994 47788999999999 679999


Q ss_pred             CCC
Q psy3162          74 PLR   76 (91)
Q Consensus        74 ~~~   76 (91)
                      +|.
T Consensus       161 ~~~  163 (230)
T cd02674         161 PYV  163 (230)
T ss_pred             ccc
Confidence            884


No 17 
>cd02661 Peptidase_C19E A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.50  E-value=3.2e-14  Score=102.55  Aligned_cols=69  Identities=20%  Similarity=0.297  Sum_probs=61.1

Q ss_pred             Cchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCC
Q psy3162           8 KSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLR   76 (91)
Q Consensus         8 ~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~   76 (91)
                      .+|.+|+           .+.|+|++|++++.+.++..|.++|++|+|||+||.++   ...|++..|.||++|||++|.
T Consensus       162 ~~l~~~l~~~~~~e~~~~~~~~~C~~C~~~~~~~~~~~i~~~P~iL~i~l~Rf~~~---~~~Ki~~~v~f~~~L~l~~~~  238 (304)
T cd02661         162 DSLEDALEQFTKPEQLDGENKYKCERCKKKVKASKQLTIHRAPNVLTIHLKRFSNF---RGGKINKQISFPETLDLSPYM  238 (304)
T ss_pred             CcHHHHHHHhcCceeeCCCCCeeCCCCCCccceEEEEEEecCCcEEEEEEeccccC---CccccCCeEecCCeechhhcc
Confidence            4677777           23489999999999999999999999999999999994   567999999999999999988


Q ss_pred             CCC
Q psy3162          77 GSG   79 (91)
Q Consensus        77 ~~g   79 (91)
                      ..+
T Consensus       239 ~~~  241 (304)
T cd02661         239 SQP  241 (304)
T ss_pred             ccC
Confidence            653


No 18 
>cd02662 Peptidase_C19F A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.39  E-value=6.4e-13  Score=95.04  Aligned_cols=56  Identities=16%  Similarity=0.197  Sum_probs=50.8

Q ss_pred             CCchhhhh--------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCC
Q psy3162           7 TKSFLGLY--------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTI   70 (91)
Q Consensus         7 ~~sl~~cl--------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~L   70 (91)
                      ..|+++|+        +++|.|++|        +..|.++|++|+||||||.++..|...|+++.|.||+.|
T Consensus        95 ~~sl~~~L~~~~~~E~l~~~~C~~C--------~~~i~~lP~vLii~LkRF~~~~~~~~~K~~~~v~fp~~l  158 (240)
T cd02662          95 GTTLEHCLDDFLSTEIIDDYKCDRC--------QTVIVRLPQILCIHLSRSVFDGRGTSTKNSCKVSFPERL  158 (240)
T ss_pred             CCCHHHHHHHhcCcccccCcCCCCC--------eEEeecCCcEEEEEEEEEEEcCCCceeeeccEEECCCcc
Confidence            67899999        468999999        678999999999999999997558999999999999988


No 19 
>KOG4598|consensus
Probab=99.37  E-value=1.1e-13  Score=112.50  Aligned_cols=69  Identities=19%  Similarity=0.304  Sum_probs=61.9

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCCCCCCCCCCC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTPLRGSGPQPG   83 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~~~~~g~q~g   83 (91)
                      .|+|.|++|+++..|.|-++|++||-+|.||||||.+|- .....|||..++||+.|||..|....-..|
T Consensus       232 ~nqy~ce~ck~k~dahkgl~~~~fpy~lt~~lkrfdfdy~tmhriklnd~~tfp~~l~ln~~in~~~~s~  301 (1203)
T KOG4598|consen  232 SNQYMCENCKSKQDAHKGLRITQFPYLLTIQLKRFDFDYNTMHRIKLNDKMTFPDVLDLNDYVNKEKRST  301 (1203)
T ss_pred             ccHHHHhhhhhhhhhhcCceeeccceeeEEeeecccccchheeeeeecccccCcccccHHHhhhhccCCc
Confidence            589999999999999999999999999999999999973 488999999999999999999985443333


No 20 
>cd02672 Peptidase_C19P A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.35  E-value=1.2e-12  Score=95.93  Aligned_cols=72  Identities=17%  Similarity=0.074  Sum_probs=60.8

Q ss_pred             CCCchhhhh--------cCCcccCCCCCcceeEEEeecccCCC----eeEEEeeceEECCC------CeeeecceEEecC
Q psy3162           6 PTKSFLGLY--------CGKVLTYALDFVLSTLRTTRLASFPD----YLMFHLKKFTMKED------WTLAKLDVEVEMP   67 (91)
Q Consensus         6 ~~~sl~~cl--------~~~~~C~~C~~~~~a~k~~~~~~lP~----vLiihlkRF~~~~~------~~~~Kl~~~V~~P   67 (91)
                      +.+||.+|+        .++|.|++|++++.|+|+++|++||+    ||+||||||.....      ....|++..|.+|
T Consensus       115 ~~~sl~~cL~~~~~~E~~~~~~C~~C~~~~~a~k~~~i~~lP~~L~~VL~i~lkrf~~~~~~~~~~~~~~~~~~~~v~f~  194 (268)
T cd02672         115 KESTFLQLLKRSLDLEKVTKAWCDTCCKYQPLEQTTSIRHLPDILLLVLVINLSVTNGEFDDINVVLPSGKVMQNKVSPK  194 (268)
T ss_pred             cCCCHHHHHHHHhhhhhcccccccccCcccccEEEEEeecCCCcccceEEEEEeccChhhcccCcceeEEEecCCeeccc
Confidence            568999999        57899999999999999999999999    99999999997311      1346888999999


Q ss_pred             CCCCCCCCCC
Q psy3162          68 DTIDLTPLRG   77 (91)
Q Consensus        68 ~~LDls~~~~   77 (91)
                      ..+|+..+..
T Consensus       195 ~~~~~~~~~~  204 (268)
T cd02672         195 AIDHDKLVKN  204 (268)
T ss_pred             ccccchhhhc
Confidence            8887766543


No 21 
>cd02670 Peptidase_C19N A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.34  E-value=9.4e-13  Score=95.61  Aligned_cols=61  Identities=18%  Similarity=0.209  Sum_probs=51.3

Q ss_pred             CCCchhhhhcCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCCCCC
Q psy3162           6 PTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLRGSG   79 (91)
Q Consensus         6 ~~~sl~~cl~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~~~g   79 (91)
                      ..+||++|+..-+.-+.            |+++|++|+||||||.++. |...|+++.|.||..|||++|....
T Consensus        78 ~~~tLedcLe~~~~~e~------------i~~lP~vLiIhLKRF~~~~-~~~~Kl~~~I~fP~~Ldl~~~~~~~  138 (241)
T cd02670          78 GGITLEQCLEQYFNNSV------------FAKAPSCLIICLKRYGKTE-GKAQKMFKKILIPDEIDIPDFVADD  138 (241)
T ss_pred             CcCCHHHHHHHHhchhh------------hhhCCCeEEEEEEccccCC-CcceeCCcEECCCCcCCchhhcccc
Confidence            57999999943332222            9999999999999999965 7889999999999999999998654


No 22 
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=99.25  E-value=2.8e-12  Score=101.58  Aligned_cols=74  Identities=20%  Similarity=0.331  Sum_probs=68.5

Q ss_pred             CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecC--CCCCCCCCCCCCCCCCCccCCCC
Q psy3162          16 GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMP--DTIDLTPLRGSGPQPGEEMLPEV   90 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P--~~LDls~~~~~g~q~ge~~lpe~   90 (91)
                      -.|.|++|+.+..|+++..|++||+|||+|..||.+ .+|...||..+|.+-  +-+|+++|++.-....|..|||+
T Consensus       476 iE~~CenCk~K~~a~~k~~~kslPk~LIlq~~R~~l-qny~v~kls~pi~~~~D~m~~~~s~msk~~PqtEn~LPde  551 (749)
T COG5207         476 IEWSCENCKGKKKASRKPFIKSLPKYLILQVGRYSL-QNYKVEKLSDPIEMRSDDMIKLGSFMSKFDPQTENLLPDE  551 (749)
T ss_pred             eeeehhhhcCcccccccchhhccCceeEEecceeec-cceeehhccCceEEccccccchhhHhhccCCcccccCCcc
Confidence            489999999999999999999999999999999999 799999999999997  45999999999666699999986


No 23 
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.25  E-value=2.4e-11  Score=82.88  Aligned_cols=72  Identities=26%  Similarity=0.413  Sum_probs=64.2

Q ss_pred             CCCchhhhh--------cCCcccCCCC--CcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCC
Q psy3162           6 PTKSFLGLY--------CGKVLTYALD--FVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPL   75 (91)
Q Consensus         6 ~~~sl~~cl--------~~~~~C~~C~--~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~   75 (91)
                      ...+|.+|+        .....|..|+  +.+.+.++..|.++|++|+||++||.++..|...|++..|.+|++|++..+
T Consensus        97 ~~~~l~~~l~~~~~~e~~~~~~~~~c~~~~~~~~~~~~~i~~lP~~L~i~l~R~~~~~~~~~~k~~~~v~~~~~l~~~~~  176 (255)
T cd02257          97 PQVSLEDCLEKFFKEEILEGDNCYKCEKKKKQEATKRLKIKKLPPVLIIHLKRFSFNEDGTKEKLNTKVSFPLELDLSPY  176 (255)
T ss_pred             CCCcHHHHHHHhhhhhccCCCCcccCCCCcccceeEEEecccCCceeEEEeeceeeccccccccCCCeEeCCCcccCccc
Confidence            367899998        4778899998  688899999999999999999999999544889999999999999999888


Q ss_pred             CC
Q psy3162          76 RG   77 (91)
Q Consensus        76 ~~   77 (91)
                      ..
T Consensus       177 ~~  178 (255)
T cd02257         177 LS  178 (255)
T ss_pred             cc
Confidence            64


No 24 
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=99.20  E-value=1.6e-11  Score=92.72  Aligned_cols=49  Identities=16%  Similarity=0.186  Sum_probs=40.9

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEE
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEV   64 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V   64 (91)
                      .++|+|++|+.+..++|++.|.++|++||||++||.... ..++|+|++-
T Consensus       282 ~d~W~CpkC~~k~ss~K~~~I~~lP~~LII~i~RF~i~V-~~~~kiD~p~  330 (415)
T COG5533         282 KDAWRCPKCGRKESSRKRMEILVLPDVLIIHISRFHISV-MGRKKIDTPQ  330 (415)
T ss_pred             cccccCchhcccccchheEEEEecCceEEEEeeeeeEEe-ecccccCCCc
Confidence            489999999999999999999999999999999999632 2345555543


No 25 
>cd02665 Peptidase_C19I A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.06  E-value=1.1e-10  Score=84.21  Aligned_cols=67  Identities=19%  Similarity=0.326  Sum_probs=50.0

Q ss_pred             Cchhhhhc-----CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCC
Q psy3162           8 KSFLGLYC-----GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPL   75 (91)
Q Consensus         8 ~sl~~cl~-----~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~   75 (91)
                      -+|++|+.     +.-....|.....+.|+..|.++|+||+||||||.++. ....|+++.|+||..|+-..|
T Consensus        93 ~~L~e~L~~~~~ee~l~~~~~~~~~~~~~~~~i~~lP~vL~i~LkRF~~~~-~~~~Ki~~~v~FP~~l~~~~Y  164 (228)
T cd02665          93 GNLHECLEAAMFEGEVELLPSDHSVKSGQERWFTELPPVLTFELSRFEFNQ-GRPEKIHDKLEFPQIIQQVPY  164 (228)
T ss_pred             CCHHHHHHHhhhhcccccccccchhhhhhhhhhhhCChhhEEEeEeeEEcC-CccEECCEEEEeeCccCCcee
Confidence            57888881     11122344445567788899999999999999999954 678899999999988744334


No 26 
>KOG1868|consensus
Probab=98.97  E-value=7.5e-11  Score=95.52  Aligned_cols=69  Identities=23%  Similarity=0.308  Sum_probs=59.5

Q ss_pred             CCchhhhh-----------cCCcccCCCCCcceeE--EEeecccCCCeeEEEeeceEECCCCeeeecceEEecC-CCCCC
Q psy3162           7 TKSFLGLY-----------CGKVLTYALDFVLSTL--RTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMP-DTIDL   72 (91)
Q Consensus         7 ~~sl~~cl-----------~~~~~C~~C~~~~~a~--k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P-~~LDl   72 (91)
                      .++|.+|+           .+.|.|++|+++..+.  |++.|.+||++|+|||+||..+.+| ..|+...|+|| ..+|+
T Consensus       496 ~~~L~~C~~~ft~~ekle~~~~w~Cp~c~~~~~~~~lK~~~i~~lp~iLiihL~Rf~~~~~~-~~k~~~~v~~~~~~~~~  574 (653)
T KOG1868|consen  496 KVSLEDCLSLFTKEEKLEGDEAWLCPRCKHKESSKTLKKLTILRLPKILIIHLKRFSSDGNS-FNKLSTGVDFPLREADL  574 (653)
T ss_pred             ccchHhhhccccchhhcccccccCCccccCcccccccceeeeecCCHHHHHHHHHhccCccc-ccccceeeccchHhhhh
Confidence            47799999           3679999999999885  9999999999999999999996555 56999999999 67777


Q ss_pred             CCCC
Q psy3162          73 TPLR   76 (91)
Q Consensus        73 s~~~   76 (91)
                      .++.
T Consensus       575 ~~~~  578 (653)
T KOG1868|consen  575 SPRF  578 (653)
T ss_pred             chhc
Confidence            7644


No 27 
>KOG1867|consensus
Probab=98.93  E-value=5.9e-10  Score=87.99  Aligned_cols=71  Identities=20%  Similarity=0.271  Sum_probs=63.2

Q ss_pred             Cchhhhh-----------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCCC
Q psy3162           8 KSFLGLY-----------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPLR   76 (91)
Q Consensus         8 ~sl~~cl-----------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~~   76 (91)
                      -++.+|+           ..++.|..|+.++.++|++.+..+|.+|.+|+|||.+.......|+++.|.||..|+|.+|+
T Consensus       334 ~~~~~cl~~~~~~~~~~~~~~~~c~~c~~~~~~~kql~~~~lP~~l~~~lkRfe~~~~~~~~ki~~~v~fp~~l~m~p~~  413 (492)
T KOG1867|consen  334 LTLLDCLDRFTRSEQLGKDSKYKCSSCKSKQESTKQLTIRKLPAVLCLHLKRFEHSATGAREKIDSYVSFPVLLNMKPYC  413 (492)
T ss_pred             hhhhhhhhhhhhhhhcCcccccccCCcccccccccccccccCCceeeeeeccccccccccccccCcccccchhhcCCccc
Confidence            4467777           47899999999999999999999999999999999996554445999999999999999999


Q ss_pred             CC
Q psy3162          77 GS   78 (91)
Q Consensus        77 ~~   78 (91)
                      +.
T Consensus       414 ~~  415 (492)
T KOG1867|consen  414 SS  415 (492)
T ss_pred             cc
Confidence            86


No 28 
>PF00443 UCH:  Ubiquitin carboxyl-terminal hydrolase;  InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C19 (ubiquitin-specific protease family, clan CA). Families within the CA clan are loosely termed papain-like as protein fold of the peptidase unit resembles that of papain, the type example for clan CA. Predicted active site residues for members of this family and family C1 occur in the same order in the sequence: N/Q, C, H. The type example is human ubiquitin-specific protease 14. Ubiquitin is highly conserved, commonly found conjugated to proteins in eukaryotic cells, where it may act as a marker for rapid degradation, or it may have a chaperone function in protein assembly []. The ubiquitin is released by cleavage from the bound protein by a protease []. A number of deubiquitinising proteases are known: all are activated by thiol compounds [, ], and inhibited by thiol-blocking agents and ubiquitin aldehyde [, ], and as such have the properties of cysteine proteases []. The deubiquitinsing proteases can be split into 2 size ranges (20-30 kDa, IPR001578 from INTERPRO, and 100-200 kDa) []: this family are the 100-200 kDa peptides which includes the Ubp1 ubiquitin peptidase from yeast. Only one conserved cysteine can be identified, along with two conserved histidines. The spacing between the cysteine and the second histidine is thought to be more representative of the cysteine/histidine spacing of a cysteine protease catalytic dyad [].; GO: 0004221 ubiquitin thiolesterase activity, 0006511 ubiquitin-dependent protein catabolic process; PDB: 2LBC_A 3MHH_A 3MHS_A 3M99_A 2Y6E_D 2VHF_A 2HD5_A 3NHE_A 2IBI_A 1NBF_B ....
Probab=98.92  E-value=7.5e-10  Score=76.85  Aligned_cols=62  Identities=21%  Similarity=0.388  Sum_probs=49.0

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecC-CCCCCCCCCCCCCC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMP-DTIDLTPLRGSGPQ   81 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P-~~LDls~~~~~g~q   81 (91)
                      .+...|..|+..     +..|.++|++|+||++||.++. .+...|+...|.|| ++|||++|...+..
T Consensus       140 ~~~~~c~~c~~~-----~~~~~~~P~~L~i~l~R~~~~~~~~~~~K~~~~v~~~~~~l~l~~~~~~~~~  203 (269)
T PF00443_consen  140 ESSIKCSSCKNS-----QSSISSLPPILIIQLKRFEFDQETGRSKKINNPVEFPLEELDLSPYLEKNNS  203 (269)
T ss_dssp             EEEEEETTTTCE-----EEEEEEBBSEEEEEEE-EEEESTSSEEEE--CEEB--SSEEEGGGGBSSCCC
T ss_pred             cccccccccccc-----ccccccccceeeeccccceeccccccccccccccccCchhhhhhhhhccccc
Confidence            467899999988     6678999999999999998763 47799999999999 89999999876654


No 29 
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=98.90  E-value=1.3e-09  Score=78.94  Aligned_cols=44  Identities=18%  Similarity=0.233  Sum_probs=37.1

Q ss_pred             Cchhhhh-------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEEC
Q psy3162           8 KSFLGLY-------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMK   52 (91)
Q Consensus         8 ~sl~~cl-------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~   52 (91)
                      .++++|+       ..+|+|++|+.+ .|.|+.+|.++|++|+||||||.+.
T Consensus       110 ~~le~l~~~~~~~~~~e~~C~~C~~~-~a~k~~~i~~~P~vL~i~lkRf~~~  160 (245)
T cd02673         110 DIDELLISNFKTWSPIEKDCSSCKCE-SAISSERIMTFPECLSINLKRYKLR  160 (245)
T ss_pred             chHHHHHHHhhcccccCccCCCCCCc-cceeechhhhCChhhEEeeEeeeec
Confidence            3455665       457899999986 7889999999999999999999874


No 30 
>PF13423 UCH_1:  Ubiquitin carboxyl-terminal hydrolase
Probab=98.69  E-value=2.9e-08  Score=72.68  Aligned_cols=79  Identities=18%  Similarity=0.283  Sum_probs=68.0

Q ss_pred             CCCCCCCchhhhh--------cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCC
Q psy3162           2 PKPQPTKSFLGLY--------CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLT   73 (91)
Q Consensus         2 ~~~~~~~sl~~cl--------~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls   73 (91)
                      |.....++|.+++        .....|++|++.+.+..+..|.++|+||.|.++|+..+..| ..|+...+.+|..+++.
T Consensus       157 p~~~~~~tf~~~Le~sl~~e~~~~a~C~~C~~~~~~~~~r~i~~LPpVL~In~~~~~~~~~w-~~~~~~~~~ip~~i~~~  235 (295)
T PF13423_consen  157 PPSNSNVTFSQVLEHSLNREQQTRAWCEKCNKYQPTEQRRTIRSLPPVLSINLNRYSEEEFW-PKKNWLKIWIPPSINLP  235 (295)
T ss_pred             CCCCccchHHHHHHHHHhhcccccccccccccccceeeeeeccCCCcEEEEEccCCCccccc-ccccCCceecceeeecc
Confidence            4445678999999        35689999999998888899999999999999999996568 88999999999999999


Q ss_pred             CCCCCCCC
Q psy3162          74 PLRGSGPQ   81 (91)
Q Consensus        74 ~~~~~g~q   81 (91)
                      .+.+...+
T Consensus       236 ~~~~~~~~  243 (295)
T PF13423_consen  236 HFIADDSQ  243 (295)
T ss_pred             cccccccc
Confidence            88766543


No 31 
>KOG1864|consensus
Probab=98.62  E-value=1.6e-08  Score=81.43  Aligned_cols=68  Identities=22%  Similarity=0.231  Sum_probs=59.3

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCCCCCCCCCC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTPLRGSGPQP   82 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~~~~~g~q~   82 (91)
                      -+.|+|++|...+.|.|++.++.+|.+|+||||||.++. .....|+...|.+|.+|++......+..+
T Consensus       439 ~nky~c~~c~s~qeae~~l~~k~lp~~L~l~Lkrfk~~~~~~~~~kl~~~v~~plel~l~~~~~~~~~~  507 (587)
T KOG1864|consen  439 ENKYSCENCCSLQEAERRLKIKKLPYVLTLHLKRFKYSEQQNRYTKLLYRVVFPLELRLKDTLKDDNNP  507 (587)
T ss_pred             CCcccccccCchhhHHHhccccCCcceeeeehhccccccccccccccccccccccceeeccccccccCc
Confidence            489999999999999999999999999999999999973 34567999999999999988766555543


No 32 
>KOG1873|consensus
Probab=98.60  E-value=2.5e-09  Score=87.50  Aligned_cols=70  Identities=20%  Similarity=0.118  Sum_probs=60.2

Q ss_pred             CCchhhhh-----------cCCcccCCCCC------c---------------------ceeEEEeecccCCCeeEEEeec
Q psy3162           7 TKSFLGLY-----------CGKVLTYALDF------V---------------------LSTLRTTRLASFPDYLMFHLKK   48 (91)
Q Consensus         7 ~~sl~~cl-----------~~~~~C~~C~~------~---------------------~~a~k~~~~~~lP~vLiihlkR   48 (91)
                      .+|+..||           .|.|.|+.|-+      .                     +.|.|++-|...|+||+|||||
T Consensus       677 p~Svq~CL~nFT~~E~Ls~~N~~~CEnCtk~~n~~~r~k~~~n~~~sk~s~~es~~~~t~akk~~li~~aPpVltihlKr  756 (877)
T KOG1873|consen  677 PCSVQRCLKNFTKVEILSGDNKWACENCTKNLNLQRREKRGLNEDNSKYSFNESEYRNTYAKKKVLINKAPPVLTIHLKR  756 (877)
T ss_pred             CccHHHHHHhhhhhhhcccccchhhhhhhccccccchhhccCCCCcccccccchhhhhhhhheeeecccCCceeeehHhh
Confidence            57899999           49999999977      1                     1257889999999999999999


Q ss_pred             eEECCCCeeeecceEEecCCCCCCCCCC
Q psy3162          49 FTMKEDWTLAKLDVEVEMPDTIDLTPLR   76 (91)
Q Consensus        49 F~~~~~~~~~Kl~~~V~~P~~LDls~~~   76 (91)
                      |..+..+...|++.+|+|++-+||..|+
T Consensus       757 f~q~~~~~~~k~~~h~~f~E~~dL~~~~  784 (877)
T KOG1873|consen  757 FFQDIRGRLSKLNKHVDFKEFEDLLDYM  784 (877)
T ss_pred             hhhhhhchhhcccccchHHHHHHHHHHh
Confidence            9997667789999999999888888876


No 33 
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=98.48  E-value=2.3e-08  Score=82.46  Aligned_cols=64  Identities=20%  Similarity=0.280  Sum_probs=54.4

Q ss_pred             CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCCCCCCCCCCCCCC
Q psy3162          16 GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPDTIDLTPLRGSGP   80 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~~LDls~~~~~g~   80 (91)
                      |.|.|+.=| -+.|.|-.-|.+||+||-+|||||.+|. .....|+|...+||+++||.+|.+..-
T Consensus       357 N~Y~ae~~G-lqdAkKGViFeSlPpVlhlqLKRFeyDfe~d~mvKINDryEFP~eiDl~pfld~da  421 (1089)
T COG5077         357 NRYNAEKHG-LQDAKKGVIFESLPPVLHLQLKRFEYDFERDMMVKINDRYEFPLEIDLLPFLDRDA  421 (1089)
T ss_pred             ccccccccc-chhhccceeeccCchHHHHHHHHhccccccCceeeecccccCcchhccccccCchh
Confidence            566666544 3579999999999999999999999984 467889999999999999999987643


No 34 
>KOG1863|consensus
Probab=98.41  E-value=8e-08  Score=81.72  Aligned_cols=61  Identities=16%  Similarity=0.205  Sum_probs=56.7

Q ss_pred             cccCCCCCcceeEEEeecccCCCeeEEEeeceEEC-CCCeeeecceEEecCCCCCCCCCCCC
Q psy3162          18 VLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMK-EDWTLAKLDVEVEMPDTIDLTPLRGS   78 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~-~~~~~~Kl~~~V~~P~~LDls~~~~~   78 (91)
                      -+|+.|...+.|.|.+.|.+||+||.|||+||.++ ......|++....||..|||.+|.+.
T Consensus       338 ~~~~~~~~~~~a~k~~~f~~lPpvl~~qL~Rf~~~~~~~~~~Ki~d~~~fp~~i~~d~~~~~  399 (1093)
T KOG1863|consen  338 KYDAECHGLQDAKKGVLFDSLPPVLFIQLMRFEYDFSTGQKIKINDKFEFPLIIDMDRYLSR  399 (1093)
T ss_pred             cccccccchhhhhcceeeccCCchhhhhhhheeeeccCCceeehhhccCCccccccchhccc
Confidence            38999999999999999999999999999999997 34789999999999999999999764


No 35 
>KOG2026|consensus
Probab=97.52  E-value=6.8e-05  Score=58.21  Aligned_cols=46  Identities=30%  Similarity=0.579  Sum_probs=41.7

Q ss_pred             EEeecccCCCeeEEEeeceEECCCCeeeecceEEecC-CCCCCCCCCC
Q psy3162          31 RTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMP-DTIDLTPLRG   77 (91)
Q Consensus        31 k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P-~~LDls~~~~   77 (91)
                      ++..+.++|++||+|++||.- .+|...|+-+.|+|| ..+|+.++..
T Consensus       327 ~rf~l~k~P~ylifh~~rF~k-Nn~f~ekNpTl~~f~~~~~~~~~~~~  373 (442)
T KOG2026|consen  327 MRFRLTKLPRYLIFHMKRFKK-NNFFKEKNPTLVEFPYSEVDILHVLD  373 (442)
T ss_pred             hheeeecCCceEEEEeeeccc-cCcccccCCceeeccCCccchhhhhh
Confidence            788999999999999999998 679999999999999 7888887653


No 36 
>KOG1871|consensus
Probab=97.11  E-value=3.8e-05  Score=59.50  Aligned_cols=59  Identities=22%  Similarity=0.289  Sum_probs=50.8

Q ss_pred             CCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCC
Q psy3162          16 GKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTP   74 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~   74 (91)
                      ..++..+-+..+.|.+++.+..||.+|++|+|||.|-..+...|+...|+||-.|.++.
T Consensus       280 lp~~st~s~~eV~~s~q~~leklp~vlilhlkrF~ye~tgg~~k~~K~i~~~~~l~i~~  338 (420)
T KOG1871|consen  280 LPGYSTKSGQEVEASSQTTLEKLPPVLILHLKRFVYEKTGGARKLGKKIEYPWTLKISK  338 (420)
T ss_pred             ccceecCCCCeechhhhhhHhhcchhhhhhhhHHHHHhccchhhhchhhhccceeeech
Confidence            44555557778889999999999999999999999944688999999999998888876


No 37 
>KOG1872|consensus
Probab=96.36  E-value=0.00033  Score=55.34  Aligned_cols=62  Identities=19%  Similarity=0.271  Sum_probs=51.1

Q ss_pred             cCCCCCcceeEEEeecccCCCeeEEEeeceEECCC-CeeeecceEEecCCCCCCCCCCCCCCC
Q psy3162          20 TYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKED-WTLAKLDVEVEMPDTIDLTPLRGSGPQ   81 (91)
Q Consensus        20 C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~-~~~~Kl~~~V~~P~~LDls~~~~~g~q   81 (91)
                      .+..|..-.-.|.+.|.+||++|.|+.-||.+... ....|+-..|.||..||.-.++++.++
T Consensus       287 s~~lgr~a~y~k~~~isrlP~ylTvq~vrf~~k~k~~~~akil~~V~fP~~ld~~d~ct~el~  349 (473)
T KOG1872|consen  287 SSILGRPAAYQKVMYISRLPEYLTVQEVRFFSKAKIMVVAKILNAVNFPKDLDQQDLCTPELK  349 (473)
T ss_pred             CcccCCChHHHHHhHhhcCcccceEEEEEEEeccccchHHHHHHhccChhhhhHHHhhCHHhh
Confidence            45556555567889999999999999999999643 666788889999999999999887654


No 38 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=92.34  E-value=0.18  Score=30.20  Aligned_cols=36  Identities=6%  Similarity=-0.049  Sum_probs=29.8

Q ss_pred             CCcccCCCCCcceeEEEeecc--cCCCeeEEEeeceEE
Q psy3162          16 GKVLTYALDFVLSTLRTTRLA--SFPDYLMFHLKKFTM   51 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~k~~~~~--~lP~vLiihlkRF~~   51 (91)
                      +.|.|++||...-..|.+...  .+-+++=||.++|..
T Consensus         3 ~~~kCpKCgn~~~~ekei~~tg~~lskifdvq~n~f~~   40 (68)
T COG3478           3 NAFKCPKCGNTNYEEKEIAATGGGLSKIFDVQNNKFIV   40 (68)
T ss_pred             ccccCCCcCCcchhhceeeccCCCcceeEEecccEEEE
Confidence            567899999988777777664  678999999999986


No 39 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=88.21  E-value=0.6  Score=27.65  Aligned_cols=34  Identities=15%  Similarity=-0.020  Sum_probs=24.6

Q ss_pred             cccCCCCCcceeEEEeecc--cCCCeeEEEeeceEE
Q psy3162          18 VLTYALDFVLSTLRTTRLA--SFPDYLMFHLKKFTM   51 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~~~~--~lP~vLiihlkRF~~   51 (91)
                      |.|++||...-..++++..  -+-.++=|+.+||..
T Consensus         1 y~C~KCg~~~~e~~~v~~tgg~~skiFdvq~~~f~~   36 (64)
T PF09855_consen    1 YKCPKCGNEEYESGEVRATGGGLSKIFDVQNKKFTT   36 (64)
T ss_pred             CCCCCCCCcceecceEEccCCeeEEEEEecCcEEEE
Confidence            7899999987555555443  345677888888886


No 40 
>cd02666 Peptidase_C19J A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=83.84  E-value=0.16  Score=38.73  Aligned_cols=45  Identities=9%  Similarity=0.013  Sum_probs=31.8

Q ss_pred             CCCchhhhhcCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceEEecCCCCCCCCC
Q psy3162           6 PTKSFLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVEVEMPDTIDLTPL   75 (91)
Q Consensus         6 ~~~sl~~cl~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~V~~P~~LDls~~   75 (91)
                      ...+|.+|+..-+.=+.            |.+||++|.||||             +.++.|++.++|.+|
T Consensus       187 ~~~~L~d~L~~~~~~e~------------~~~~P~vl~~qlq-------------~~~~~~~~~~~~dry  231 (343)
T cd02666         187 EPKDLYDALDRYFDYDS------------LTKLPQRSQVQAQ-------------LAQPLQRELISMDRY  231 (343)
T ss_pred             CCCCHHHHHHHhcChhh------------hccCCHHHHHHHh-------------hcccccchheeeccc
Confidence            35678888843332222            9999999999999             445566777777777


No 41 
>PF15499 Peptidase_C98:  Ubiquitin-specific peptidase-like, SUMO isopeptidase
Probab=80.50  E-value=0.6  Score=34.90  Aligned_cols=26  Identities=19%  Similarity=0.200  Sum_probs=23.0

Q ss_pred             ccCCCCCcceeEEEeecccCCCeeEEE
Q psy3162          19 LTYALDFVLSTLRTTRLASFPDYLMFH   45 (91)
Q Consensus        19 ~C~~C~~~~~a~k~~~~~~lP~vLiih   45 (91)
                      -|.+|+.+.. .++|.+.+.|+++.+|
T Consensus       172 pCn~C~~ksQ-~rkMvlekv~~vfmLH  197 (275)
T PF15499_consen  172 PCNSCNSKSQ-RRKMVLEKVPPVFMLH  197 (275)
T ss_pred             CCcccCChHH-hHhhhhhcCchhhhhh
Confidence            5889998875 5889999999999999


No 42 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.29  E-value=1.5  Score=29.86  Aligned_cols=24  Identities=4%  Similarity=-0.276  Sum_probs=19.2

Q ss_pred             CCCCCCchhhhhcCCcccCCCCCc
Q psy3162           3 KPQPTKSFLGLYCGKVLTYALDFV   26 (91)
Q Consensus         3 ~~~~~~sl~~cl~~~~~C~~C~~~   26 (91)
                      .-..+.||.+-+.++|.|+.||..
T Consensus       114 ~c~~r~tf~eA~~~~F~Cp~Cg~~  137 (158)
T TIGR00373       114 NMCVRFTFNEAMELNFTCPRCGAM  137 (158)
T ss_pred             CCCcEeeHHHHHHcCCcCCCCCCE
Confidence            345677888888889999999976


No 43 
>KOG2463|consensus
Probab=72.37  E-value=5.5  Score=30.94  Aligned_cols=37  Identities=14%  Similarity=-0.013  Sum_probs=25.4

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEee-ceEEC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLK-KFTMK   52 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlk-RF~~~   52 (91)
                      +..-+|++||.++-..-..++..= --+..|+| ||.++
T Consensus       255 m~k~FCp~CG~~TL~K~aVsv~~d-G~~~~h~k~r~~~n  292 (376)
T KOG2463|consen  255 MPKDFCPSCGHKTLTKCAVSVDED-GNGQTHFKKRFQWN  292 (376)
T ss_pred             cchhcccccCCCeeeEEEEEecCC-CceeEEeecccccc
Confidence            467899999999543333344433 45888998 98874


No 44 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=71.42  E-value=7.4  Score=20.57  Aligned_cols=34  Identities=12%  Similarity=0.115  Sum_probs=22.7

Q ss_pred             cccCCCCCcce--------eEEEeecccCCCeeEEEeeceEE
Q psy3162          18 VLTYALDFVLS--------TLRTTRLASFPDYLMFHLKKFTM   51 (91)
Q Consensus        18 ~~C~~C~~~~~--------a~k~~~~~~lP~vLiihlkRF~~   51 (91)
                      ..|+.||....        ..+.+.+...|-+|.|...||.-
T Consensus         3 ~~Cp~Cg~~~~~~~g~~~r~i~~l~~~~~~~~L~i~~~R~~C   44 (47)
T PF14690_consen    3 PRCPHCGSPSVHRHGYKTRRIRHLPIGGRPVYLRIRKRRYRC   44 (47)
T ss_pred             ccCCCcCCCceECCceEEEEEeecccCCEEEEEEEEeEEEEC
Confidence            46899997652        22334455667788888888864


No 45 
>KOG1275|consensus
Probab=70.46  E-value=1.7  Score=37.73  Aligned_cols=59  Identities=17%  Similarity=0.105  Sum_probs=44.4

Q ss_pred             cccCCCCCcceeEEEeecccCCCeeEEEeeceEEC-CCCeee--ecceEEecCCCCCCCCCC
Q psy3162          18 VLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMK-EDWTLA--KLDVEVEMPDTIDLTPLR   76 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~-~~~~~~--Kl~~~V~~P~~LDls~~~   76 (91)
                      -.|+.|++......+..++++|++|.|...-+... .+|...  |+-..|-+|..+-|..-.
T Consensus       702 ~~C~~C~k~ep~~q~~~vr~LPd~L~in~~~~~~~~~~~~a~q~~~~~~vWLP~~~~~~~~k  763 (1118)
T KOG1275|consen  702 AWCETCTKPEPTSQKKNVRSLPDCLSINTCLNVHELVDFWARQNKLLEDVWLPEWFHMIISK  763 (1118)
T ss_pred             cccccccCCCCcccccccccCcceeeeeeeccchhhhhhHHHhhccccccccchheeEEEec
Confidence            67999999999999999999999999998877763 344333  445566777766655433


No 46 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=69.39  E-value=3.3  Score=28.88  Aligned_cols=23  Identities=9%  Similarity=-0.233  Sum_probs=17.7

Q ss_pred             CCCCchhhhhcCCcccCCCCCcc
Q psy3162           5 QPTKSFLGLYCGKVLTYALDFVL   27 (91)
Q Consensus         5 ~~~~sl~~cl~~~~~C~~C~~~~   27 (91)
                      ..+.||.+-+..+|.|+.||..-
T Consensus       124 ~~rytf~eA~~~~F~Cp~Cg~~L  146 (178)
T PRK06266        124 HIRFTFDEAMEYGFRCPQCGEML  146 (178)
T ss_pred             CcEEeHHHHhhcCCcCCCCCCCC
Confidence            45677777778889999998753


No 47 
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=67.87  E-value=5.8  Score=28.11  Aligned_cols=63  Identities=10%  Similarity=0.202  Sum_probs=34.4

Q ss_pred             hhhhhcCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECCC-CeeeecceEEecC-CCCCCCC
Q psy3162          10 FLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKED-WTLAKLDVEVEMP-DTIDLTP   74 (91)
Q Consensus        10 l~~cl~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~-~~~~Kl~~~V~~P-~~LDls~   74 (91)
                      |-.+++-.+.|+.||-+..-++...-.. |.-+.+++.-=. |-+ ...+.-...|.+| .+|.|.+
T Consensus        23 F~evii~sf~C~~CGyr~~ev~~~g~~~-p~r~~l~V~~~~-DL~r~VvkS~tati~IPEl~lei~p   87 (192)
T TIGR00310        23 FGEVLETSTICEHCGYRSNDVKTLGAKE-PKRYILKIDDEA-DLNRRVVKSESATIRIPELGLDIEP   87 (192)
T ss_pred             cceEEEEEEECCCCCCccceeEECCCCC-CEEEEEEECChh-cccceEEEcCCcEEEccceEEEECC
Confidence            4555667888888888877666544322 333333322111 111 3344555677888 4566654


No 48 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=67.55  E-value=3.6  Score=23.75  Aligned_cols=24  Identities=25%  Similarity=0.224  Sum_probs=17.5

Q ss_pred             cccCCCCCcce--eEEEeecccCCCe
Q psy3162          18 VLTYALDFVLS--TLRTTRLASFPDY   41 (91)
Q Consensus        18 ~~C~~C~~~~~--a~k~~~~~~lP~v   41 (91)
                      ..|+.||.+++  ....+.+..||-+
T Consensus         5 i~CP~CgnKTR~kir~DT~LkNfPly   30 (55)
T PF14205_consen    5 ILCPICGNKTRLKIREDTVLKNFPLY   30 (55)
T ss_pred             EECCCCCCccceeeecCceecccccc
Confidence            37999998763  4566778888854


No 49 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=66.45  E-value=2.8  Score=20.19  Aligned_cols=11  Identities=9%  Similarity=-0.115  Sum_probs=9.2

Q ss_pred             cCCcccCCCCC
Q psy3162          15 CGKVLTYALDF   25 (91)
Q Consensus        15 ~~~~~C~~C~~   25 (91)
                      ...|.|++||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            46899999985


No 50 
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=60.61  E-value=8  Score=26.75  Aligned_cols=62  Identities=6%  Similarity=0.128  Sum_probs=33.2

Q ss_pred             hhhhhcCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEECC-CCeeeecceEEecCC-CCCCC
Q psy3162          10 FLGLYCGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKE-DWTLAKLDVEVEMPD-TIDLT   73 (91)
Q Consensus        10 l~~cl~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~-~~~~~Kl~~~V~~P~-~LDls   73 (91)
                      |.++++-.+.|+.||-+.+-++...-.. |.-+.+++.-=. |- ....+--...|.+|+ +|.|.
T Consensus        21 F~evii~sf~C~~CGyr~~ev~~~~~~~-p~r~~l~V~~~~-DL~r~VvkS~ta~i~IPEl~lei~   84 (163)
T TIGR00340        21 FGKIMLSTYICEKCGYRSTDVYQLEEKE-PVRYIIKIENED-DLFTLVYRSRSATIRIPELGIKIE   84 (163)
T ss_pred             cceEEEEEEECCCCCCchhheeEcCCcC-CEEEEEEECChh-hccceEEEcCCcEEEccceeEEec
Confidence            4455567889999998877666544322 233333322110 11 123445556788884 45554


No 51 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=59.97  E-value=6.7  Score=23.74  Aligned_cols=33  Identities=15%  Similarity=0.021  Sum_probs=8.8

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeec
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKK   48 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkR   48 (91)
                      +...+|++||..+--.-...+. ---.+.+|+++
T Consensus        22 ~~k~FCp~CGn~TL~rvsvsv~-~~G~~~~~~~~   54 (73)
T PF08772_consen   22 MTKQFCPKCGNATLKRVSVSVD-EDGKIKLHLKK   54 (73)
T ss_dssp             SS--S-SSS--S--EEEE-B---SS---B-----
T ss_pred             CCceeCcccCCCcceEEEEEEC-CCCCEEEEecC
Confidence            5789999999986432222333 22345566654


No 52 
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=53.72  E-value=8.9  Score=26.94  Aligned_cols=24  Identities=13%  Similarity=-0.237  Sum_probs=18.9

Q ss_pred             CCCCchhhhhcCCcccCCCCCcce
Q psy3162           5 QPTKSFLGLYCGKVLTYALDFVLS   28 (91)
Q Consensus         5 ~~~~sl~~cl~~~~~C~~C~~~~~   28 (91)
                      -..+||.+-...+|.|+.||+.-.
T Consensus       120 ~~r~sfdeA~~~~F~Cp~Cg~~L~  143 (176)
T COG1675         120 HVKYSFDEAMELGFTCPKCGEDLE  143 (176)
T ss_pred             CCcccHHHHHHhCCCCCCCCchhh
Confidence            456777777778899999998754


No 53 
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=48.72  E-value=8.6  Score=30.00  Aligned_cols=19  Identities=5%  Similarity=-0.408  Sum_probs=13.8

Q ss_pred             CchhhhhcCCcccCCCCCc
Q psy3162           8 KSFLGLYCGKVLTYALDFV   26 (91)
Q Consensus         8 ~sl~~cl~~~~~C~~C~~~   26 (91)
                      .||++-....|.|++||.+
T Consensus       256 y~le~A~~~~wrCpkCGg~  274 (403)
T COG1379         256 YSLEEAKSLRWRCPKCGGK  274 (403)
T ss_pred             cCcchhhhhcccCcccccc
Confidence            3444444688999999984


No 54 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=47.56  E-value=8.8  Score=21.49  Aligned_cols=15  Identities=0%  Similarity=-0.339  Sum_probs=12.3

Q ss_pred             hcCCcccCCCCCcce
Q psy3162          14 YCGKVLTYALDFVLS   28 (91)
Q Consensus        14 l~~~~~C~~C~~~~~   28 (91)
                      |-++|.|+.|+....
T Consensus        31 Lp~~w~CP~C~a~K~   45 (50)
T cd00730          31 LPDDWVCPVCGAGKD   45 (50)
T ss_pred             CCCCCCCCCCCCcHH
Confidence            568999999998654


No 55 
>PF10146 zf-C4H2:  Zinc finger-containing protein ;  InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a family of proteins which appears to have a highly conserved zinc finger domain at the C-terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members of this family are annotated as being tumour-associated antigen HCA127 in humans, but this could not be confirmed.
Probab=45.95  E-value=13  Score=26.97  Aligned_cols=27  Identities=11%  Similarity=0.041  Sum_probs=22.9

Q ss_pred             CCCCCCchhhhh----cCCcccCCCCCccee
Q psy3162           3 KPQPTKSFLGLY----CGKVLTYALDFVLST   29 (91)
Q Consensus         3 ~~~~~~sl~~cl----~~~~~C~~C~~~~~a   29 (91)
                      +++|+.+...|.    .|.--|+-|+.+++.
T Consensus       190 Q~PPMK~C~sC~qqIHRNAPiCPlCK~KsRS  220 (230)
T PF10146_consen  190 QPPPMKTCQSCHQQIHRNAPICPLCKAKSRS  220 (230)
T ss_pred             cCCCcchhHhHHHHHhcCCCCCccccccccc
Confidence            467888899998    699999999998764


No 56 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=45.10  E-value=10  Score=19.04  Aligned_cols=14  Identities=0%  Similarity=-0.268  Sum_probs=10.6

Q ss_pred             CCcccCCCCCccee
Q psy3162          16 GKVLTYALDFVLST   29 (91)
Q Consensus        16 ~~~~C~~C~~~~~a   29 (91)
                      ..|.|+.||.....
T Consensus        16 ~~~~CP~Cg~~~~~   29 (33)
T cd00350          16 APWVCPVCGAPKDK   29 (33)
T ss_pred             CCCcCcCCCCcHHH
Confidence            57899999986543


No 57 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=44.51  E-value=15  Score=19.49  Aligned_cols=14  Identities=7%  Similarity=-0.057  Sum_probs=9.8

Q ss_pred             CcccCCCCCcceeE
Q psy3162          17 KVLTYALDFVLSTL   30 (91)
Q Consensus        17 ~~~C~~C~~~~~a~   30 (91)
                      +|+|++||..-...
T Consensus         5 ey~C~~Cg~~fe~~   18 (42)
T PF09723_consen    5 EYRCEECGHEFEVL   18 (42)
T ss_pred             EEEeCCCCCEEEEE
Confidence            57888888765543


No 58 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=44.40  E-value=26  Score=18.40  Aligned_cols=18  Identities=6%  Similarity=-0.260  Sum_probs=11.7

Q ss_pred             cccCCCCCcceeEEEeec
Q psy3162          18 VLTYALDFVLSTLRTTRL   35 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~~~   35 (91)
                      +.|++||......-++..
T Consensus         1 ~~Cp~C~~~~a~~~q~Q~   18 (40)
T smart00440        1 APCPKCGNREATFFQLQT   18 (40)
T ss_pred             CcCCCCCCCeEEEEEEcc
Confidence            469999977665444433


No 59 
>PF14353 CpXC:  CpXC protein
Probab=44.39  E-value=17  Score=23.40  Aligned_cols=15  Identities=0%  Similarity=-0.286  Sum_probs=11.9

Q ss_pred             cCCcccCCCCCccee
Q psy3162          15 CGKVLTYALDFVLST   29 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a   29 (91)
                      .+.+.|++||.....
T Consensus        36 l~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   36 LFSFTCPSCGHKFRL   50 (128)
T ss_pred             cCEEECCCCCCceec
Confidence            478899999988754


No 60 
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=43.10  E-value=38  Score=26.49  Aligned_cols=64  Identities=17%  Similarity=0.272  Sum_probs=43.2

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEee------ceEE------CCCCee-------------------------
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLK------KFTM------KEDWTL-------------------------   57 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlk------RF~~------~~~~~~-------------------------   57 (91)
                      .....|+.|+..++.......-..|.+=++|+.      ||+-      ++.|+-                         
T Consensus       233 ~srlqC~~C~~TStT~a~fs~l~vp~~~v~~~~l~eC~~~f~~~e~L~g~d~W~CpkC~~k~ss~K~~~I~~lP~~LII~  312 (415)
T COG5533         233 KSRLQCEACNYTSTTIAMFSTLLVPPYEVVQLGLQECIDRFYEEEKLEGKDAWRCPKCGRKESSRKRMEILVLPDVLIIH  312 (415)
T ss_pred             hhhhhhhhcCCceeEEeccceeeeccchheeecHHHHHHHhhhHHhhcCcccccCchhcccccchheEEEEecCceEEEE
Confidence            456789999999887777777777877777755      6653      344751                         


Q ss_pred             -eecceEEecCCCCCCCCCCCC
Q psy3162          58 -AKLDVEVEMPDTIDLTPLRGS   78 (91)
Q Consensus        58 -~Kl~~~V~~P~~LDls~~~~~   78 (91)
                       +..++.|-.|..||+.++.+.
T Consensus       313 i~RF~i~V~~~~kiD~p~gw~~  334 (415)
T COG5533         313 ISRFHISVMGRKKIDTPQGWKN  334 (415)
T ss_pred             eeeeeEEeecccccCCCcchhc
Confidence             122345566778888877643


No 61 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=42.73  E-value=21  Score=19.09  Aligned_cols=12  Identities=0%  Similarity=-0.297  Sum_probs=10.5

Q ss_pred             cCCcccCCCCCc
Q psy3162          15 CGKVLTYALDFV   26 (91)
Q Consensus        15 ~~~~~C~~C~~~   26 (91)
                      -+++.|+.||..
T Consensus        16 ~~g~~CP~Cg~~   27 (46)
T PF12760_consen   16 PDGFVCPHCGST   27 (46)
T ss_pred             CCCCCCCCCCCe
Confidence            478999999987


No 62 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=40.53  E-value=17  Score=20.09  Aligned_cols=14  Identities=0%  Similarity=-0.339  Sum_probs=8.8

Q ss_pred             hcCCcccCCCCCcc
Q psy3162          14 YCGKVLTYALDFVL   27 (91)
Q Consensus        14 l~~~~~C~~C~~~~   27 (91)
                      |-++|.|+.|+...
T Consensus        31 Lp~~w~CP~C~a~K   44 (47)
T PF00301_consen   31 LPDDWVCPVCGAPK   44 (47)
T ss_dssp             S-TT-B-TTTSSBG
T ss_pred             CCCCCcCcCCCCcc
Confidence            46889999999764


No 63 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=40.10  E-value=14  Score=17.37  Aligned_cols=10  Identities=20%  Similarity=-0.014  Sum_probs=7.3

Q ss_pred             CcccCCCCCc
Q psy3162          17 KVLTYALDFV   26 (91)
Q Consensus        17 ~~~C~~C~~~   26 (91)
                      .|+|+.|++.
T Consensus         1 q~~C~~C~k~   10 (27)
T PF12171_consen    1 QFYCDACDKY   10 (27)
T ss_dssp             -CBBTTTTBB
T ss_pred             CCCcccCCCC
Confidence            4789999864


No 64 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=37.86  E-value=20  Score=19.36  Aligned_cols=18  Identities=6%  Similarity=-0.164  Sum_probs=12.8

Q ss_pred             ccCCCCCcceeEEEeecc
Q psy3162          19 LTYALDFVLSTLRTTRLA   36 (91)
Q Consensus        19 ~C~~C~~~~~a~k~~~~~   36 (91)
                      +|+.||.+-...++..+.
T Consensus         1 ~CP~Cg~~a~ir~S~~~s   18 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLS   18 (47)
T ss_pred             CcCCCCCeeEEEEchhhC
Confidence            599999987665554443


No 65 
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=37.68  E-value=51  Score=22.53  Aligned_cols=20  Identities=0%  Similarity=-0.069  Sum_probs=9.8

Q ss_pred             hhcCCcccCCCCCcceeEEE
Q psy3162          13 LYCGKVLTYALDFVLSTLRT   32 (91)
Q Consensus        13 cl~~~~~C~~C~~~~~a~k~   32 (91)
                      +++-.+.|++||-+..-.+.
T Consensus        26 vii~sf~C~~CGyk~~ev~~   45 (161)
T PF03367_consen   26 VIIMSFECEHCGYKNNEVKS   45 (161)
T ss_dssp             EEEEEEE-TTT--EEEEEEE
T ss_pred             EEEEEeECCCCCCEeeeEEE
Confidence            33456677777766655554


No 66 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=37.56  E-value=15  Score=15.89  Aligned_cols=10  Identities=0%  Similarity=-0.317  Sum_probs=5.8

Q ss_pred             cccCCCCCcc
Q psy3162          18 VLTYALDFVL   27 (91)
Q Consensus        18 ~~C~~C~~~~   27 (91)
                      |.|+.|+..-
T Consensus         1 ~~C~~C~~~~   10 (24)
T PF13894_consen    1 FQCPICGKSF   10 (24)
T ss_dssp             EE-SSTS-EE
T ss_pred             CCCcCCCCcC
Confidence            6788888753


No 67 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=37.29  E-value=19  Score=28.18  Aligned_cols=29  Identities=17%  Similarity=-0.067  Sum_probs=18.9

Q ss_pred             CCCCCC------CCchhhhh----------cCCcccCCCCCccee
Q psy3162           1 MPKPQP------TKSFLGLY----------CGKVLTYALDFVLST   29 (91)
Q Consensus         1 ~~~~~~------~~sl~~cl----------~~~~~C~~C~~~~~a   29 (91)
                      |||...      .+...+|-          .+..+|++||.+-..
T Consensus         1 ~~~~~~~~~~~~~~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~   45 (403)
T TIGR00155         1 MPKMCEHHPAAKHILCSQCDMLVALPRIESGQKAACPRCGTTLTV   45 (403)
T ss_pred             CccccccCCCCCeeeCCCCCCcccccCCCCCCeeECCCCCCCCcC
Confidence            788777      34455555          245679999987543


No 68 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=37.09  E-value=11  Score=16.74  Aligned_cols=9  Identities=0%  Similarity=-0.489  Sum_probs=6.6

Q ss_pred             cccCCCCCc
Q psy3162          18 VLTYALDFV   26 (91)
Q Consensus        18 ~~C~~C~~~   26 (91)
                      |.|+.|++.
T Consensus         1 y~C~~C~~~    9 (23)
T PF00096_consen    1 YKCPICGKS    9 (23)
T ss_dssp             EEETTTTEE
T ss_pred             CCCCCCCCc
Confidence            578888864


No 69 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=37.04  E-value=18  Score=21.17  Aligned_cols=12  Identities=8%  Similarity=-0.075  Sum_probs=9.5

Q ss_pred             cCCcccCCCCCc
Q psy3162          15 CGKVLTYALDFV   26 (91)
Q Consensus        15 ~~~~~C~~C~~~   26 (91)
                      .+.|.|++||-.
T Consensus        46 ~~~Y~CP~CGF~   57 (59)
T PRK14890         46 SNPYTCPKCGFE   57 (59)
T ss_pred             CCceECCCCCCc
Confidence            588899998854


No 70 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=36.01  E-value=24  Score=23.63  Aligned_cols=12  Identities=8%  Similarity=-0.053  Sum_probs=10.1

Q ss_pred             CCcccCCCCCcc
Q psy3162          16 GKVLTYALDFVL   27 (91)
Q Consensus        16 ~~~~C~~C~~~~   27 (91)
                      ..|+|++|+...
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            479999999875


No 71 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=35.09  E-value=19  Score=16.82  Aligned_cols=11  Identities=0%  Similarity=-0.194  Sum_probs=7.7

Q ss_pred             ccCCCCCccee
Q psy3162          19 LTYALDFVLST   29 (91)
Q Consensus        19 ~C~~C~~~~~a   29 (91)
                      +|++||.....
T Consensus         1 ~Cp~CG~~~~~   11 (23)
T PF13240_consen    1 YCPNCGAEIED   11 (23)
T ss_pred             CCcccCCCCCC
Confidence            58888877543


No 72 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=33.91  E-value=41  Score=17.49  Aligned_cols=16  Identities=0%  Similarity=-0.209  Sum_probs=8.6

Q ss_pred             cccCCCCCcceeEEEe
Q psy3162          18 VLTYALDFVLSTLRTT   33 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~   33 (91)
                      ..|++||......-+.
T Consensus         1 ~~Cp~Cg~~~a~~~~~   16 (39)
T PF01096_consen    1 IKCPKCGHNEAVFFQI   16 (39)
T ss_dssp             S--SSS-SSEEEEEEE
T ss_pred             CCCcCCCCCeEEEEEe
Confidence            3699999987654433


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=33.54  E-value=21  Score=20.97  Aligned_cols=12  Identities=8%  Similarity=-0.158  Sum_probs=9.5

Q ss_pred             cCCcccCCCCCc
Q psy3162          15 CGKVLTYALDFV   26 (91)
Q Consensus        15 ~~~~~C~~C~~~   26 (91)
                      .+-|.|++||-.
T Consensus        48 g~~Y~Cp~CGF~   59 (61)
T COG2888          48 GNPYRCPKCGFE   59 (61)
T ss_pred             CCceECCCcCcc
Confidence            588999999854


No 74 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=33.52  E-value=21  Score=22.47  Aligned_cols=22  Identities=9%  Similarity=-0.247  Sum_probs=13.4

Q ss_pred             cCCcccCCCCCcceeEEEeecc
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLA   36 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~   36 (91)
                      -..|.|+.|++..--.....||
T Consensus        33 ~~ky~Cp~Cgk~~vkR~a~GIW   54 (90)
T PF01780_consen   33 HAKYTCPFCGKTSVKRVATGIW   54 (90)
T ss_dssp             HS-BEESSSSSSEEEEEETTEE
T ss_pred             hCCCcCCCCCCceeEEeeeEEe
Confidence            3678999999887433333333


No 75 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=32.98  E-value=20  Score=18.46  Aligned_cols=13  Identities=0%  Similarity=-0.238  Sum_probs=10.0

Q ss_pred             cCCcccCCCCCcc
Q psy3162          15 CGKVLTYALDFVL   27 (91)
Q Consensus        15 ~~~~~C~~C~~~~   27 (91)
                      .-.|.|+.||+..
T Consensus        30 vp~~~C~~CGE~~   42 (46)
T TIGR03831        30 VPALVCPQCGEEY   42 (46)
T ss_pred             CCccccccCCCEe
Confidence            3578999999853


No 76 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=31.46  E-value=46  Score=21.01  Aligned_cols=23  Identities=9%  Similarity=-0.177  Sum_probs=14.9

Q ss_pred             cCCcccCCCCCcceeEEEeeccc
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLAS   37 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~   37 (91)
                      -..|.|+.|++..--.....||.
T Consensus        33 ~a~y~CpfCgk~~vkR~a~GIW~   55 (91)
T TIGR00280        33 KAKYVCPFCGKKTVKRGSTGIWT   55 (91)
T ss_pred             hcCccCCCCCCCceEEEeeEEEE
Confidence            46889999987654444444554


No 77 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=31.34  E-value=24  Score=18.56  Aligned_cols=10  Identities=0%  Similarity=-0.433  Sum_probs=7.6

Q ss_pred             cccCCCCCcc
Q psy3162          18 VLTYALDFVL   27 (91)
Q Consensus        18 ~~C~~C~~~~   27 (91)
                      |+|+.|+...
T Consensus         1 m~Cp~Cg~~~   10 (43)
T PF08271_consen    1 MKCPNCGSKE   10 (43)
T ss_dssp             ESBTTTSSSE
T ss_pred             CCCcCCcCCc
Confidence            5788888865


No 78 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=31.04  E-value=49  Score=20.83  Aligned_cols=24  Identities=8%  Similarity=-0.230  Sum_probs=15.9

Q ss_pred             cCCcccCCCCCcceeEEEeecccC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASF   38 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~l   38 (91)
                      -..|.|+.|++..--.....||.-
T Consensus        34 ~a~y~CpfCgk~~vkR~a~GIW~C   57 (90)
T PRK03976         34 RAKHVCPVCGRPKVKRVGTGIWEC   57 (90)
T ss_pred             hcCccCCCCCCCceEEEEEEEEEc
Confidence            468899999876554455555554


No 79 
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=31.00  E-value=23  Score=23.17  Aligned_cols=12  Identities=8%  Similarity=-0.025  Sum_probs=9.8

Q ss_pred             CCcccCCCCCcc
Q psy3162          16 GKVLTYALDFVL   27 (91)
Q Consensus        16 ~~~~C~~C~~~~   27 (91)
                      +.|.|++|++..
T Consensus        36 ~~y~C~~C~~~~   47 (146)
T PF08646_consen   36 GSYRCEKCNKTV   47 (146)
T ss_dssp             TEEEETTTTEEE
T ss_pred             cEEECCCCCCcC
Confidence            469999999875


No 80 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=30.58  E-value=34  Score=17.25  Aligned_cols=15  Identities=7%  Similarity=0.016  Sum_probs=9.7

Q ss_pred             CcccCCCCCcceeEE
Q psy3162          17 KVLTYALDFVLSTLR   31 (91)
Q Consensus        17 ~~~C~~C~~~~~a~k   31 (91)
                      .|+|..||..-....
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            467888887655443


No 81 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=30.55  E-value=32  Score=18.02  Aligned_cols=16  Identities=0%  Similarity=-0.170  Sum_probs=8.9

Q ss_pred             CCcccCCCCCcceeEE
Q psy3162          16 GKVLTYALDFVLSTLR   31 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~k   31 (91)
                      +-|+|..||.......
T Consensus         5 ~~YkC~~CGniVev~~   20 (36)
T PF06397_consen    5 EFYKCEHCGNIVEVVH   20 (36)
T ss_dssp             EEEE-TTT--EEEEEE
T ss_pred             cEEEccCCCCEEEEEE
Confidence            3589999998775443


No 82 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=29.96  E-value=54  Score=18.96  Aligned_cols=33  Identities=9%  Similarity=-0.061  Sum_probs=24.0

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCCeeEEEeeceEE
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTM   51 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~   51 (91)
                      ...++|..||...-+.    ....|+.+.|.+-=|.-
T Consensus        46 ~~r~FC~~CGs~l~~~----~~~~~~~~~V~~g~ld~   78 (92)
T PF04828_consen   46 VERYFCPTCGSPLFSE----DERDPDLVGVNAGTLDD   78 (92)
T ss_dssp             CEEEEETTT--EEEEE----ESSTTTEEEEEGGGBTT
T ss_pred             CcCcccCCCCCeeecc----cCCCCCEEEEEeEeeCC
Confidence            3568999999987654    67899999998876654


No 83 
>TIGR03071 couple_hipA HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.
Probab=29.95  E-value=17  Score=22.33  Aligned_cols=41  Identities=20%  Similarity=0.336  Sum_probs=20.8

Q ss_pred             ceEECCCCeeee--cceEEecCCCCCCCCCCCCCCCC-CCccCCCC
Q psy3162          48 KFTMKEDWTLAK--LDVEVEMPDTIDLTPLRGSGPQP-GEEMLPEV   90 (91)
Q Consensus        48 RF~~~~~~~~~K--l~~~V~~P~~LDls~~~~~g~q~-ge~~lpe~   90 (91)
                      +|.|+.+|....  ....+.+|.  +-..|.+.++.+ -+..|||.
T Consensus        23 ~F~Y~~~~l~~~~~~~lS~~lPl--~~~~~~~~~l~~~f~~lLPEg   66 (101)
T TIGR03071        23 SFRYDDDYLGSPSAPPLSLSLPL--QAEEFRSGVVPPFFDGLLPEG   66 (101)
T ss_pred             EEEEcHHHHhCCCCCceEeeccC--CCCCCCCccHHHHHhhcCCCH
Confidence            588977786543  233344442  223344333333 45666663


No 84 
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=29.58  E-value=95  Score=21.26  Aligned_cols=23  Identities=4%  Similarity=-0.006  Sum_probs=13.8

Q ss_pred             hhhhhcCCcccCCCCCcceeEEE
Q psy3162          10 FLGLYCGKVLTYALDFVLSTLRT   32 (91)
Q Consensus        10 l~~cl~~~~~C~~C~~~~~a~k~   32 (91)
                      |.++++-.+.|+.||-+..-.+.
T Consensus        22 F~evii~sf~C~~CGyk~~ev~~   44 (160)
T smart00709       22 FREVIIMSFECEHCGYRNNEVKS   44 (160)
T ss_pred             cceEEEEEEECCCCCCccceEEE
Confidence            33444556777777777655554


No 85 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=29.36  E-value=31  Score=17.01  Aligned_cols=13  Identities=0%  Similarity=-0.281  Sum_probs=6.9

Q ss_pred             CcccCCCCCccee
Q psy3162          17 KVLTYALDFVLST   29 (91)
Q Consensus        17 ~~~C~~C~~~~~a   29 (91)
                      .-+|++||..+..
T Consensus         3 ~rfC~~CG~~t~~   15 (32)
T PF09297_consen    3 HRFCGRCGAPTKP   15 (32)
T ss_dssp             TSB-TTT--BEEE
T ss_pred             CcccCcCCccccC
Confidence            4579999987653


No 86 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=29.25  E-value=52  Score=20.72  Aligned_cols=23  Identities=4%  Similarity=-0.193  Sum_probs=14.2

Q ss_pred             cCCcccCCCCCcceeEEEeeccc
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLAS   37 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~   37 (91)
                      -..|.|+.|++..--.....||.
T Consensus        34 ~a~y~CpfCgk~~vkR~a~GIW~   56 (90)
T PTZ00255         34 HAKYFCPFCGKHAVKRQAVGIWR   56 (90)
T ss_pred             hCCccCCCCCCCceeeeeeEEEE
Confidence            46889999986553333334443


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=28.70  E-value=35  Score=22.71  Aligned_cols=11  Identities=0%  Similarity=-0.429  Sum_probs=6.0

Q ss_pred             CcccCCCCCcc
Q psy3162          17 KVLTYALDFVL   27 (91)
Q Consensus        17 ~~~C~~C~~~~   27 (91)
                      .|.|+.|+.+-
T Consensus        99 ~Y~Cp~C~~~y  109 (147)
T smart00531       99 YYKCPNCQSKY  109 (147)
T ss_pred             EEECcCCCCEe
Confidence            45566665443


No 88 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=28.37  E-value=34  Score=18.18  Aligned_cols=11  Identities=0%  Similarity=-0.300  Sum_probs=6.3

Q ss_pred             CcccCCCCCcc
Q psy3162          17 KVLTYALDFVL   27 (91)
Q Consensus        17 ~~~C~~C~~~~   27 (91)
                      .|.|++||...
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            45666666544


No 89 
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=28.33  E-value=47  Score=21.51  Aligned_cols=21  Identities=14%  Similarity=0.055  Sum_probs=16.5

Q ss_pred             cccCCCCCcc---eeEEEeecccC
Q psy3162          18 VLTYALDFVL---STLRTTRLASF   38 (91)
Q Consensus        18 ~~C~~C~~~~---~a~k~~~~~~l   38 (91)
                      ..|.+||+..   .|.|++.+.++
T Consensus        21 v~CdnCg~~vPkdKAikr~~i~s~   44 (108)
T COG4830          21 VRCDNCGKAVPKDKAIKRTAIRSP   44 (108)
T ss_pred             eeeccccccCCccceeeEeeccCc
Confidence            5899999854   58888888765


No 90 
>KOG0402|consensus
Probab=27.45  E-value=17  Score=22.86  Aligned_cols=23  Identities=4%  Similarity=-0.198  Sum_probs=15.1

Q ss_pred             cCCcccCCCCCcceeEEEeeccc
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLAS   37 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~   37 (91)
                      -..|.|+.||+.+--.+-..||.
T Consensus        34 haky~CsfCGK~~vKR~AvGiW~   56 (92)
T KOG0402|consen   34 HAKYTCSFCGKKTVKRKAVGIWK   56 (92)
T ss_pred             hhhhhhhhcchhhhhhhceeEEe
Confidence            36789999998765444444443


No 91 
>PRK12366 replication factor A; Reviewed
Probab=27.42  E-value=37  Score=28.14  Aligned_cols=11  Identities=18%  Similarity=0.066  Sum_probs=9.1

Q ss_pred             CCcccCCCCCc
Q psy3162          16 GKVLTYALDFV   26 (91)
Q Consensus        16 ~~~~C~~C~~~   26 (91)
                      ..|+|++|++.
T Consensus       547 g~~~C~~c~~~  557 (637)
T PRK12366        547 GEYICEFCGEV  557 (637)
T ss_pred             CcEECCCCCCC
Confidence            46899999977


No 92 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=26.49  E-value=42  Score=18.04  Aligned_cols=12  Identities=8%  Similarity=-0.092  Sum_probs=6.8

Q ss_pred             CcccCCCCCcce
Q psy3162          17 KVLTYALDFVLS   28 (91)
Q Consensus        17 ~~~C~~C~~~~~   28 (91)
                      +|+|..||..-+
T Consensus         5 ey~C~~Cg~~fe   16 (52)
T TIGR02605         5 EYRCTACGHRFE   16 (52)
T ss_pred             EEEeCCCCCEeE
Confidence            456666665443


No 93 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=26.47  E-value=37  Score=18.64  Aligned_cols=10  Identities=0%  Similarity=-0.380  Sum_probs=7.3

Q ss_pred             CCcccCCCCC
Q psy3162          16 GKVLTYALDF   25 (91)
Q Consensus        16 ~~~~C~~C~~   25 (91)
                      +.|.|+-|++
T Consensus         1 ~~f~CP~C~~   10 (54)
T PF05605_consen    1 DSFTCPYCGK   10 (54)
T ss_pred             CCcCCCCCCC
Confidence            4677888877


No 94 
>PF04795 PAPA-1:  PAPA-1-like conserved region;  InterPro: IPR006880 This is a group of proteins with a conserved C-terminal region which is found in PAPA-1, a PAP-1 binding protein, Q9C086 from SWISSPROT. 
Probab=26.18  E-value=53  Score=20.30  Aligned_cols=19  Identities=26%  Similarity=0.583  Sum_probs=14.5

Q ss_pred             CCeeeecceEEecCCCCCC
Q psy3162          54 DWTLAKLDVEVEMPDTIDL   72 (91)
Q Consensus        54 ~~~~~Kl~~~V~~P~~LDl   72 (91)
                      .|...+..+.|.||+++++
T Consensus        70 R~v~~~~G~~vs~P~~~~~   88 (89)
T PF04795_consen   70 RWVSNKNGSRVSVPEEMGL   88 (89)
T ss_pred             EEEECCCceEEEecCCCCC
Confidence            3566678889999988764


No 95 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=25.78  E-value=53  Score=20.71  Aligned_cols=13  Identities=8%  Similarity=-0.276  Sum_probs=11.0

Q ss_pred             hcCCcccCCCCCc
Q psy3162          14 YCGKVLTYALDFV   26 (91)
Q Consensus        14 l~~~~~C~~C~~~   26 (91)
                      ....|.|+.|+++
T Consensus        32 ~~~~~~Cp~C~~~   44 (89)
T COG1997          32 QRAKHVCPFCGRT   44 (89)
T ss_pred             HhcCCcCCCCCCc
Confidence            3578999999998


No 96 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=25.63  E-value=54  Score=27.38  Aligned_cols=25  Identities=4%  Similarity=-0.238  Sum_probs=16.0

Q ss_pred             Cchhhhh------cCCcccCCCCCcceeEEE
Q psy3162           8 KSFLGLY------CGKVLTYALDFVLSTLRT   32 (91)
Q Consensus         8 ~sl~~cl------~~~~~C~~C~~~~~a~k~   32 (91)
                      ..+.-|.      ...+.||.||+......|
T Consensus       624 ~~~~~C~~CG~~~g~~~~CP~CG~~~~v~sR  654 (656)
T PRK08270        624 PTFSICPKHGYLSGEHEFCPKCGEETEVYSR  654 (656)
T ss_pred             CCCcccCCCCCcCCCCCCCcCCcCccceEEe
Confidence            3455565      256799999977554433


No 97 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=25.54  E-value=23  Score=16.67  Aligned_cols=11  Identities=0%  Similarity=-0.493  Sum_probs=8.5

Q ss_pred             CCcccCCCCCc
Q psy3162          16 GKVLTYALDFV   26 (91)
Q Consensus        16 ~~~~C~~C~~~   26 (91)
                      ..|.|+.|++.
T Consensus        13 k~~~C~~C~k~   23 (26)
T PF13465_consen   13 KPYKCPYCGKS   23 (26)
T ss_dssp             SSEEESSSSEE
T ss_pred             CCCCCCCCcCe
Confidence            45899999864


No 98 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=25.19  E-value=29  Score=16.38  Aligned_cols=11  Identities=0%  Similarity=-0.278  Sum_probs=6.9

Q ss_pred             CCcccCCCCCc
Q psy3162          16 GKVLTYALDFV   26 (91)
Q Consensus        16 ~~~~C~~C~~~   26 (91)
                      +.-+|+.||.+
T Consensus        15 ~~~fC~~CG~~   25 (26)
T PF13248_consen   15 DAKFCPNCGAK   25 (26)
T ss_pred             ccccChhhCCC
Confidence            45567777753


No 99 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=24.89  E-value=40  Score=26.66  Aligned_cols=29  Identities=10%  Similarity=-0.267  Sum_probs=19.3

Q ss_pred             CCCCCCCCchhhhh----cCCcccCCCCCccee
Q psy3162           1 MPKPQPTKSFLGLY----CGKVLTYALDFVLST   29 (91)
Q Consensus         1 ~~~~~~~~sl~~cl----~~~~~C~~C~~~~~a   29 (91)
                      |.|.++..-...|=    .-.|+|+.|++=.+.
T Consensus         1 m~~~~~~y~C~~Cg~~~~~~~g~Cp~C~~w~t~   33 (454)
T TIGR00416         1 MAKAKSKFVCQHCGADSPKWQGKCPACHAWNTI   33 (454)
T ss_pred             CCCCCCeEECCcCCCCCccccEECcCCCCcccc
Confidence            66666555555555    357899999985543


No 100
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=24.82  E-value=41  Score=15.46  Aligned_cols=13  Identities=23%  Similarity=0.054  Sum_probs=9.1

Q ss_pred             CCcccCCCCCcce
Q psy3162          16 GKVLTYALDFVLS   28 (91)
Q Consensus        16 ~~~~C~~C~~~~~   28 (91)
                      .+|.|++|.-...
T Consensus         1 g~W~C~~C~~~N~   13 (26)
T smart00547        1 GDWECPACTFLNF   13 (26)
T ss_pred             CcccCCCCCCcCh
Confidence            3688999876543


No 101
>PRK11823 DNA repair protein RadA; Provisional
Probab=24.54  E-value=43  Score=26.38  Aligned_cols=31  Identities=6%  Similarity=-0.290  Sum_probs=20.9

Q ss_pred             CCCCCCCCchhhhh----cCCcccCCCCCcceeEE
Q psy3162           1 MPKPQPTKSFLGLY----CGKVLTYALDFVLSTLR   31 (91)
Q Consensus         1 ~~~~~~~~sl~~cl----~~~~~C~~C~~~~~a~k   31 (91)
                      |.|.++..-...|-    .-.|+|+.|++-.+...
T Consensus         1 m~~~~~~y~C~~Cg~~~~~~~g~Cp~C~~w~t~~e   35 (446)
T PRK11823          1 MAKKKTAYVCQECGAESPKWLGRCPECGAWNTLVE   35 (446)
T ss_pred             CCCCCCeEECCcCCCCCcccCeeCcCCCCccceee
Confidence            66666555566665    35779999998665443


No 102
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=23.91  E-value=58  Score=16.19  Aligned_cols=15  Identities=7%  Similarity=-0.110  Sum_probs=11.1

Q ss_pred             CCcccCCCCCcceeE
Q psy3162          16 GKVLTYALDFVLSTL   30 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~   30 (91)
                      +-|+|+.||......
T Consensus         3 ~~ykC~~CGniv~v~   17 (34)
T cd00974           3 EVYKCEICGNIVEVL   17 (34)
T ss_pred             cEEEcCCCCcEEEEE
Confidence            358899999877544


No 103
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=23.64  E-value=30  Score=19.24  Aligned_cols=13  Identities=0%  Similarity=-0.135  Sum_probs=10.4

Q ss_pred             CCcccCCCCCcce
Q psy3162          16 GKVLTYALDFVLS   28 (91)
Q Consensus        16 ~~~~C~~C~~~~~   28 (91)
                      -++.|+.||-.+.
T Consensus         8 tG~~CPgCG~tRa   20 (52)
T PF10825_consen    8 TGIPCPGCGMTRA   20 (52)
T ss_pred             hCCCCCCCcHHHH
Confidence            4789999998764


No 104
>PHA02768 hypothetical protein; Provisional
Probab=23.60  E-value=34  Score=19.61  Aligned_cols=12  Identities=0%  Similarity=-0.441  Sum_probs=9.5

Q ss_pred             CCcccCCCCCcc
Q psy3162          16 GKVLTYALDFVL   27 (91)
Q Consensus        16 ~~~~C~~C~~~~   27 (91)
                      -+|.|+.||+.=
T Consensus         4 ~~y~C~~CGK~F   15 (55)
T PHA02768          4 LGYECPICGEIY   15 (55)
T ss_pred             cccCcchhCCee
Confidence            368999999853


No 105
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=23.38  E-value=47  Score=16.86  Aligned_cols=14  Identities=0%  Similarity=-0.550  Sum_probs=10.1

Q ss_pred             CCcccCCCCCccee
Q psy3162          16 GKVLTYALDFVLST   29 (91)
Q Consensus        16 ~~~~C~~C~~~~~a   29 (91)
                      +.+.|+.|+...-.
T Consensus         2 ~~~~C~~C~~~~i~   15 (33)
T PF08792_consen    2 NLKKCSKCGGNGIV   15 (33)
T ss_pred             CceEcCCCCCCeEE
Confidence            56788888876543


No 106
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=23.10  E-value=81  Score=24.91  Aligned_cols=26  Identities=8%  Similarity=-0.024  Sum_probs=21.0

Q ss_pred             cCCcccCCCCCcceeEEEeecccCCC
Q psy3162          15 CGKVLTYALDFVLSTLRTTRLASFPD   40 (91)
Q Consensus        15 ~~~~~C~~C~~~~~a~k~~~~~~lP~   40 (91)
                      ...-.|+.|+..+...++.+|-.-|-
T Consensus        70 ~~~~~C~~cg~~~~l~R~VSfVDaPG   95 (415)
T COG5257          70 TTEPKCPNCGAETELVRRVSFVDAPG   95 (415)
T ss_pred             ccCCCCCCCCCCccEEEEEEEeeCCc
Confidence            45668999999988889888887773


No 107
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=22.99  E-value=62  Score=16.06  Aligned_cols=15  Identities=7%  Similarity=-0.095  Sum_probs=11.2

Q ss_pred             CCcccCCCCCcceeE
Q psy3162          16 GKVLTYALDFVLSTL   30 (91)
Q Consensus        16 ~~~~C~~C~~~~~a~   30 (91)
                      +-|+|+.||......
T Consensus         6 ~~ykC~~Cgniv~v~   20 (34)
T TIGR00319         6 QVYKCEVCGNIVEVL   20 (34)
T ss_pred             cEEEcCCCCcEEEEE
Confidence            458999999877543


No 108
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=22.20  E-value=38  Score=16.80  Aligned_cols=11  Identities=9%  Similarity=-0.285  Sum_probs=6.5

Q ss_pred             CCcccCCCCCc
Q psy3162          16 GKVLTYALDFV   26 (91)
Q Consensus        16 ~~~~C~~C~~~   26 (91)
                      ..|.|++|+..
T Consensus        12 ~kY~Cp~C~~~   22 (30)
T PF04438_consen   12 AKYRCPRCGAR   22 (30)
T ss_dssp             ESEE-TTT--E
T ss_pred             CEEECCCcCCc
Confidence            57899999875


No 109
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=21.93  E-value=59  Score=16.85  Aligned_cols=15  Identities=7%  Similarity=-0.161  Sum_probs=10.7

Q ss_pred             CcccCCCCCcceeEE
Q psy3162          17 KVLTYALDFVLSTLR   31 (91)
Q Consensus        17 ~~~C~~C~~~~~a~k   31 (91)
                      ..+|+.|++.....|
T Consensus         5 ~v~CP~C~s~~~v~k   19 (36)
T PF03811_consen    5 DVHCPRCQSTEGVKK   19 (36)
T ss_pred             eeeCCCCCCCCccee
Confidence            568999998774433


No 110
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=21.32  E-value=35  Score=20.95  Aligned_cols=13  Identities=0%  Similarity=-0.243  Sum_probs=7.4

Q ss_pred             cCCcccCCCCCcc
Q psy3162          15 CGKVLTYALDFVL   27 (91)
Q Consensus        15 ~~~~~C~~C~~~~   27 (91)
                      +..|.|+.|++..
T Consensus        63 Ms~~~Cp~Cg~~~   75 (81)
T PF10609_consen   63 MSYFVCPHCGERI   75 (81)
T ss_dssp             T-EEE-TTT--EE
T ss_pred             CCccCCCCCCCee
Confidence            5789999999865


No 111
>KOG2324|consensus
Probab=21.12  E-value=1.1e+02  Score=24.41  Aligned_cols=49  Identities=14%  Similarity=0.093  Sum_probs=28.5

Q ss_pred             cccCCCCCcceeEEEeecccCCCeeEEEeeceEECCCCeeeecceE-Eec---CCCCCCCCCC
Q psy3162          18 VLTYALDFVLSTLRTTRLASFPDYLMFHLKKFTMKEDWTLAKLDVE-VEM---PDTIDLTPLR   76 (91)
Q Consensus        18 ~~C~~C~~~~~a~k~~~~~~lP~vLiihlkRF~~~~~~~~~Kl~~~-V~~---P~~LDls~~~   76 (91)
                      -.|++|++-       .+...+.+=|=|.  |..+ +-.+++++.. |++   |+.|+|..|-
T Consensus       248 ~~Cp~C~~~-------~L~~~~~IEVgHt--F~LG-~kYS~~lna~f~~~~gKpe~l~MgCyG  300 (457)
T KOG2324|consen  248 ASCPKCNEG-------RLTKTKSIEVGHT--FLLG-TKYSKPLNAKFVNVEGKPEFLHMGCYG  300 (457)
T ss_pred             ccCCcccCC-------CcccccceEEEEE--EEec-cccccccCceeeeecCCcceEEeccee
Confidence            568888874       2334444444443  4553 3345566665 666   5778888773


No 112
>PHA00616 hypothetical protein
Probab=20.80  E-value=31  Score=18.90  Aligned_cols=9  Identities=0%  Similarity=-0.267  Sum_probs=7.0

Q ss_pred             cccCCCCCc
Q psy3162          18 VLTYALDFV   26 (91)
Q Consensus        18 ~~C~~C~~~   26 (91)
                      |.|+.||..
T Consensus         2 YqC~~CG~~   10 (44)
T PHA00616          2 YQCLRCGGI   10 (44)
T ss_pred             CccchhhHH
Confidence            678888864


No 113
>smart00355 ZnF_C2H2 zinc finger.
Probab=20.76  E-value=51  Score=14.02  Aligned_cols=9  Identities=11%  Similarity=-0.300  Sum_probs=6.0

Q ss_pred             cccCCCCCc
Q psy3162          18 VLTYALDFV   26 (91)
Q Consensus        18 ~~C~~C~~~   26 (91)
                      |.|+.|+..
T Consensus         1 ~~C~~C~~~    9 (26)
T smart00355        1 YRCPECGKV    9 (26)
T ss_pred             CCCCCCcch
Confidence            467777754


No 114
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.72  E-value=52  Score=21.51  Aligned_cols=35  Identities=9%  Similarity=-0.055  Sum_probs=23.5

Q ss_pred             CcccCCCCCccee-EEEeecccCCCeeEEEeeceEE
Q psy3162          17 KVLTYALDFVLST-LRTTRLASFPDYLMFHLKKFTM   51 (91)
Q Consensus        17 ~~~C~~C~~~~~a-~k~~~~~~lP~vLiihlkRF~~   51 (91)
                      +|.|++|+.+.-. --.-.+-.|.=|+--||.|=..
T Consensus         1 GY~CPrC~skvC~LP~~CpiCgLtLVss~HLARSyH   36 (112)
T TIGR00622         1 GYFCPQCRAKVCELPVECPICGLTLILSTHLARSYH   36 (112)
T ss_pred             CccCCCCCCCccCCCCcCCcCCCEEeccchHHHhhh
Confidence            5899999998731 1233455666677778888654


No 115
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=20.47  E-value=49  Score=16.74  Aligned_cols=11  Identities=0%  Similarity=-0.191  Sum_probs=6.8

Q ss_pred             cccCCCCCcce
Q psy3162          18 VLTYALDFVLS   28 (91)
Q Consensus        18 ~~C~~C~~~~~   28 (91)
                      |.|..||....
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            56777776654


No 116
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=20.17  E-value=42  Score=17.18  Aligned_cols=13  Identities=8%  Similarity=-0.210  Sum_probs=9.0

Q ss_pred             CcccCCCCCccee
Q psy3162          17 KVLTYALDFVLST   29 (91)
Q Consensus        17 ~~~C~~C~~~~~a   29 (91)
                      .+.|++|+....|
T Consensus         4 ~~~C~nC~R~v~a   16 (33)
T PF08209_consen    4 YVECPNCGRPVAA   16 (33)
T ss_dssp             EEE-TTTSSEEEG
T ss_pred             eEECCCCcCCcch
Confidence            4689999987654


No 117
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=20.04  E-value=48  Score=20.76  Aligned_cols=12  Identities=8%  Similarity=-0.377  Sum_probs=10.2

Q ss_pred             cCCcccCCCCCc
Q psy3162          15 CGKVLTYALDFV   26 (91)
Q Consensus        15 ~~~~~C~~C~~~   26 (91)
                      .+.|.|+.||+.
T Consensus        29 ~~~~~C~~CGe~   40 (127)
T TIGR03830        29 VPGWYCPACGEE   40 (127)
T ss_pred             eeeeECCCCCCE
Confidence            578999999985


Done!