Query         psy3210
Match_columns 272
No_of_seqs    270 out of 1785
Neff          7.8 
Searched_HMMs 46136
Date          Fri Aug 16 19:09:58 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3210.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3210hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2996|consensus              100.0 1.7E-55 3.7E-60  408.9  12.1  234   11-253   539-863 (865)
  2 KOG4278|consensus              100.0   8E-30 1.7E-34  241.3   9.3  183   71-267   134-329 (1157)
  3 KOG1264|consensus               99.9 6.1E-28 1.3E-32  232.0  10.8  157   80-254   640-832 (1267)
  4 KOG4792|consensus               99.9   4E-27 8.8E-32  198.0   9.3  156   83-252     6-180 (293)
  5 KOG0197|consensus               99.9 2.5E-27 5.4E-32  221.5   5.3  183   69-267    55-267 (468)
  6 KOG3601|consensus               99.9 6.1E-26 1.3E-30  189.5   3.3  172   69-254    42-220 (222)
  7 smart00252 SH2 Src homology 2   99.8 8.3E-21 1.8E-25  140.2   9.6   83   88-178     1-83  (84)
  8 cd00173 SH2 Src homology 2 dom  99.8 1.2E-20 2.7E-25  141.8   9.8   94   89-193     1-94  (94)
  9 PF00017 SH2:  SH2 domain;  Int  99.8 4.5E-20 9.7E-25  134.1   8.2   76   90-173     1-77  (77)
 10 KOG4637|consensus               99.8 9.8E-20 2.1E-24  162.9   8.0  103   83-194    18-120 (464)
 11 KOG0194|consensus               99.8   4E-18 8.6E-23  161.5  10.5  162   83-267    44-227 (474)
 12 KOG4226|consensus               99.7   1E-16 2.2E-21  138.8   9.5   88   85-182   278-366 (379)
 13 KOG0790|consensus               99.6 7.9E-16 1.7E-20  141.2   7.3  106   76-194   101-216 (600)
 14 KOG4637|consensus               99.6 2.9E-15 6.3E-20  134.4   5.7   97   88-193   332-428 (464)
 15 KOG1264|consensus               99.5 3.6E-14 7.8E-19  137.8   8.6  105   83-194   529-640 (1267)
 16 PF14604 SH3_9:  Variant SH3 do  99.5 4.6E-14 9.9E-19   93.7   5.4   49  200-250     1-49  (49)
 17 PF07653 SH3_2:  Variant SH3 do  99.3 3.4E-12 7.4E-17   86.7   5.5   53  198-252     2-55  (55)
 18 KOG2070|consensus               99.2 4.9E-12 1.1E-16  117.5   4.1   61  197-259    19-79  (661)
 19 KOG2199|consensus               99.2 2.4E-12 5.2E-17  116.9   1.5   54  195-250   215-268 (462)
 20 KOG1118|consensus               99.1 2.3E-11   5E-16  107.3   2.0   60  194-255   305-364 (366)
 21 PF00018 SH3_1:  SH3 domain;  I  99.1 1.6E-10 3.5E-15   76.1   5.4   46  199-246     1-48  (48)
 22 KOG4348|consensus               99.0 4.4E-11 9.5E-16  109.8   0.2   59  195-255   100-158 (627)
 23 smart00326 SH3 Src homology 3   99.0 9.3E-10   2E-14   74.1   4.9   53  197-251     4-57  (58)
 24 cd00174 SH3 Src homology 3 dom  99.0 1.4E-09   3E-14   72.3   5.5   52  198-251     2-54  (54)
 25 KOG0790|consensus               99.0 7.2E-10 1.6E-14  102.4   5.3   97   87-193     3-102 (600)
 26 KOG1930|consensus               99.0 6.4E-10 1.4E-14  101.8   4.9   94   86-193   210-321 (483)
 27 KOG1029|consensus               99.0 2.5E-10 5.3E-15  111.0   2.3   52  197-250  1055-1106(1118)
 28 KOG2856|consensus               98.9 1.9E-10 4.1E-15  103.7   0.9   56  196-252   415-471 (472)
 29 KOG4226|consensus               98.9 9.5E-10 2.1E-14   95.8   4.2   57  197-255   109-165 (379)
 30 KOG0162|consensus               98.8 1.8E-09 3.8E-14  104.8   3.4   56  195-252  1051-1106(1106)
 31 KOG4225|consensus               98.8 3.3E-09 7.2E-14   97.7   3.9   57  196-254   231-287 (489)
 32 KOG4348|consensus               98.8 4.1E-09 8.9E-14   97.0   3.4   59  195-253   261-319 (627)
 33 KOG1029|consensus               98.5 2.6E-08 5.6E-13   97.2   1.9   58  196-256   814-871 (1118)
 34 KOG3875|consensus               98.4 4.7E-08   1E-12   86.7   0.3   58  197-254   270-332 (362)
 35 KOG4225|consensus               98.3 2.8E-07 6.1E-12   85.2   3.3   52  198-251   435-488 (489)
 36 KOG1843|consensus               98.3 2.2E-07 4.8E-12   85.2   1.7   57  195-251   416-472 (473)
 37 KOG3751|consensus               98.2 5.3E-07 1.2E-11   85.1   2.3   98   83-191   514-615 (622)
 38 KOG3655|consensus               98.2 5.2E-07 1.1E-11   84.3   1.5   56  195-252   427-483 (484)
 39 KOG2546|consensus               98.2 9.8E-07 2.1E-11   81.4   2.7   54  197-252   425-478 (483)
 40 KOG3697|consensus               98.1 3.5E-06 7.5E-11   74.3   4.8  106   83-195   196-343 (345)
 41 KOG0515|consensus               98.1 1.1E-06 2.4E-11   83.1   1.8   56  196-251   684-740 (752)
 42 KOG1702|consensus               98.1 2.1E-06 4.6E-11   72.1   2.6   56  194-251   206-263 (264)
 43 KOG2222|consensus               98.0 1.6E-06 3.4E-11   81.3   1.6   56  196-253   549-604 (848)
 44 KOG3632|consensus               97.8 1.2E-05 2.7E-10   80.7   3.8   58  196-254  1139-1204(1335)
 45 PF14633 SH2_2:  SH2 domain; PD  97.6 0.00036 7.8E-09   60.5   9.1   82   87-175    37-123 (220)
 46 KOG3523|consensus               97.5 2.5E-05 5.5E-10   75.2  -0.1   55  197-253   610-666 (695)
 47 PF00130 C1_1:  Phorbol esters/  97.3 0.00012 2.6E-09   48.9   1.8   32   14-45     19-51  (53)
 48 KOG4236|consensus               97.2 6.2E-05 1.3E-09   72.2  -0.3   36   12-47    284-320 (888)
 49 KOG4278|consensus               97.2 0.00029 6.3E-09   68.9   3.2   62  196-258    91-152 (1157)
 50 KOG3632|consensus               96.9 0.00043 9.4E-09   70.0   2.1   59  197-256  1246-1311(1335)
 51 KOG4566|consensus               96.9  0.0013 2.8E-08   58.2   4.6   87   83-178    47-140 (258)
 52 KOG0695|consensus               96.8 0.00054 1.2E-08   62.6   1.8   36   13-48    148-184 (593)
 53 KOG4429|consensus               96.8 0.00066 1.4E-08   60.3   2.2   55  196-252   364-418 (421)
 54 KOG4773|consensus               96.8 0.00021 4.6E-09   64.7  -1.1   54  197-252   177-230 (386)
 55 KOG4575|consensus               96.8  0.0013 2.8E-08   63.9   4.1   55  189-249     5-62  (874)
 56 KOG3601|consensus               96.8 0.00019 4.2E-09   60.9  -1.3   52  198-250     3-54  (222)
 57 KOG3771|consensus               96.7 0.00069 1.5E-08   63.8   1.3   54  196-250   401-454 (460)
 58 KOG4792|consensus               96.6  0.0019 4.2E-08   55.5   3.2   54  197-252   229-284 (293)
 59 KOG2528|consensus               96.6 0.00085 1.8E-08   62.7   1.1   56  197-253     4-60  (490)
 60 cd00029 C1 Protein kinase C co  96.5  0.0016 3.4E-08   42.5   1.7   29   14-42     19-47  (50)
 61 KOG1451|consensus               96.4  0.0027 5.9E-08   61.3   3.7   56  195-251   756-811 (812)
 62 KOG3725|consensus               96.2  0.0016 3.4E-08   57.0   0.5   56  196-251   318-373 (375)
 63 KOG3557|consensus               96.0  0.0017 3.8E-08   63.2   0.1   58  196-256   501-559 (721)
 64 KOG0197|consensus               96.0  0.0023   5E-08   61.0   0.6   56  195-252    11-69  (468)
 65 KOG0609|consensus               96.0  0.0061 1.3E-07   58.5   3.4   58  195-254   214-283 (542)
 66 smart00109 C1 Protein kinase C  95.8   0.004 8.7E-08   40.2   1.1   27   15-42     20-46  (49)
 67 KOG4236|consensus               95.6   0.023 5.1E-07   55.0   5.6   32   15-46    165-197 (888)
 68 KOG3775|consensus               94.7   0.014   3E-07   53.7   1.3   57  196-254   263-321 (482)
 69 KOG0696|consensus               92.9   0.033 7.2E-07   52.5   0.3   33   14-46    129-162 (683)
 70 KOG0192|consensus               92.8   0.035 7.6E-07   51.9   0.4   21  247-267    85-105 (362)
 71 KOG0196|consensus               91.7   0.079 1.7E-06   53.5   1.3   46  219-267   635-696 (996)
 72 KOG0199|consensus               91.2    0.18 3.9E-06   50.6   3.2   52  198-250   377-430 (1039)
 73 KOG1856|consensus               91.2     0.2 4.4E-06   52.3   3.7   82   87-175  1107-1193(1299)
 74 KOG0615|consensus               91.0   0.088 1.9E-06   49.5   0.8   23  245-267   219-242 (475)
 75 PF08239 SH3_3:  Bacterial SH3   90.7    0.49 1.1E-05   31.1   4.1   36  214-250    19-55  (55)
 76 KOG0040|consensus               90.6  0.0092   2E-07   63.1  -6.5   67  196-265   969-1035(2399)
 77 PF14633 SH2_2:  SH2 domain; PD  89.1    0.44 9.6E-06   41.4   3.6   82   84-176   131-219 (220)
 78 KOG0585|consensus               86.8    0.26 5.6E-06   47.4   0.7   20  248-267   155-174 (576)
 79 KOG0199|consensus               86.3    0.18 3.9E-06   50.7  -0.6   22  246-267   156-177 (1039)
 80 KOG0694|consensus               86.3    0.15 3.2E-06   50.7  -1.2   38    9-46    172-210 (694)
 81 KOG1090|consensus               85.8    0.32 6.9E-06   50.3   0.9   26   21-46   1559-1584(1732)
 82 PF03107 C1_2:  C1 domain;  Int  85.6    0.39 8.5E-06   28.0   0.9   16   23-38     15-30  (30)
 83 KOG0600|consensus               84.7    0.35 7.5E-06   46.7   0.5   25  243-267   158-182 (560)
 84 smart00287 SH3b Bacterial SH3   84.4     1.6 3.5E-05   29.3   3.7   36  213-250    26-62  (63)
 85 KOG0663|consensus               83.8    0.43 9.3E-06   44.1   0.7   23  244-266   118-140 (419)
 86 KOG1856|consensus               83.6     2.4 5.2E-05   44.7   5.9   81   86-177  1203-1288(1299)
 87 KOG0658|consensus               83.6    0.49 1.1E-05   43.8   1.0   20  250-269    66-85  (364)
 88 KOG1095|consensus               82.3    0.49 1.1E-05   49.6   0.5   22  246-267   740-761 (1025)
 89 PF13831 PHD_2:  PHD-finger; PD  82.0    0.44 9.6E-06   29.1   0.0   18   23-40      4-21  (36)
 90 KOG3565|consensus               80.8    0.43 9.2E-06   47.8  -0.5   56  196-252   579-636 (640)
 91 KOG4257|consensus               80.4     0.6 1.3E-05   46.5   0.4   22  246-267   436-457 (974)
 92 KOG3705|consensus               80.1     1.1 2.4E-05   42.0   2.0   88  162-251   471-565 (580)
 93 KOG1011|consensus               80.1    0.31 6.7E-06   48.3  -1.7   30   15-44    192-222 (1283)
 94 KOG0591|consensus               79.7    0.56 1.2E-05   42.5  -0.1   21  246-266    63-83  (375)
 95 PRK10884 SH3 domain-containing  79.4     2.5 5.4E-05   36.4   3.8   40  213-253    49-89  (206)
 96 PF14603 hSH3:  Helically-exten  79.2     4.4 9.5E-05   29.9   4.4   43  206-250    27-70  (89)
 97 KOG0957|consensus               79.0     1.2 2.7E-05   42.8   1.9   20   24-43    137-156 (707)
 98 KOG1094|consensus               78.2    0.86 1.9E-05   45.1   0.7   22  246-267   580-601 (807)
 99 PF08746 zf-RING-like:  RING-li  77.2    0.75 1.6E-05   29.3  -0.0   24   17-40      5-30  (43)
100 KOG0586|consensus               75.5     1.1 2.5E-05   44.0   0.7   20  248-267   102-121 (596)
101 KOG0662|consensus               75.4    0.84 1.8E-05   38.7  -0.2   24  244-267    44-67  (292)
102 KOG0193|consensus               73.7     1.8 3.9E-05   42.8   1.6   45  222-266   401-453 (678)
103 KOG0595|consensus               73.6     1.3 2.8E-05   41.8   0.5   21  247-267    55-75  (429)
104 PF07649 C1_3:  C1-like domain;  73.3    0.97 2.1E-05   26.2  -0.2   18   21-38     13-30  (30)
105 KOG0696|consensus               72.5     1.8 3.9E-05   41.3   1.2   36   12-47     62-98  (683)
106 KOG0584|consensus               72.5    0.91   2E-05   44.8  -0.8   56  214-269    48-109 (632)
107 KOG0694|consensus               71.5     1.7 3.7E-05   43.4   0.8   33   15-47    250-283 (694)
108 cd07872 STKc_PCTAIRE2 Catalyti  71.3     5.2 0.00011   35.5   3.9   22  247-268    50-71  (309)
109 PF13922 PHD_3:  PHD domain of   70.7     1.1 2.3E-05   31.1  -0.5   20   25-44     45-64  (69)
110 KOG1187|consensus               70.7     1.8   4E-05   40.3   0.8   22  246-267   116-137 (361)
111 PHA03211 serine/threonine kina  70.1     5.4 0.00012   38.4   4.0   48  221-268   172-227 (461)
112 cd05073 PTKc_Hck Catalytic dom  69.3     3.9 8.5E-05   35.1   2.6   24  246-269    46-69  (260)
113 PHA03212 serine/threonine kina  69.1     6.2 0.00013   36.9   4.0   22  247-268   129-150 (391)
114 COG3103 SH3 domain protein [Si  68.6     7.6 0.00017   33.4   4.1   42  213-255    49-91  (205)
115 KOG3508|consensus               68.6     6.3 0.00014   40.9   4.1   55   87-146    80-136 (932)
116 cd05072 PTKc_Lyn Catalytic dom  68.3       4 8.8E-05   35.0   2.5   24  246-269    46-69  (261)
117 PF02762 Cbl_N3:  CBL proto-onc  68.1      18  0.0004   26.1   5.2   42   89-135     3-46  (86)
118 KOG1025|consensus               67.9       2 4.4E-05   44.2   0.5   21  247-267   744-764 (1177)
119 PRK00420 hypothetical protein;  67.4     1.8 3.8E-05   33.6  -0.0   40    7-46      7-48  (112)
120 PF06347 SH3_4:  Bacterial SH3   67.2      12 0.00027   24.5   4.1   35  212-249    19-53  (55)
121 KOG1026|consensus               67.1     2.1 4.5E-05   43.7   0.4   22  246-267   534-555 (774)
122 KOG0593|consensus               66.8     1.9 4.2E-05   39.4   0.1   19  248-266    48-66  (396)
123 KOG0033|consensus               66.6     2.3   5E-05   37.9   0.6   23  247-269    56-78  (355)
124 KOG4250|consensus               66.2     2.1 4.6E-05   43.0   0.3   20  248-267    58-77  (732)
125 cd05070 PTKc_Fyn_Yrk Catalytic  65.5       3 6.5E-05   35.8   1.1   24  245-268    45-68  (260)
126 cd05068 PTKc_Frk_like Catalyti  63.3     6.3 0.00014   33.8   2.7   24  245-268    45-68  (261)
127 KOG4384|consensus               63.2     3.7   8E-05   37.9   1.2   62  187-251   129-192 (361)
128 KOG3812|consensus               63.1     2.4 5.3E-05   39.0   0.0   36  210-247    80-118 (475)
129 smart00743 Agenet Tudor-like d  63.0      11 0.00024   25.3   3.3   24  213-238     2-25  (61)
130 PHA02988 hypothetical protein;  62.7     3.3 7.2E-05   36.5   0.8   22  247-268    64-85  (283)
131 PF11302 DUF3104:  Protein of u  61.7      11 0.00024   27.0   3.1   28  211-238     3-34  (75)
132 cd05034 PTKc_Src_like Catalyti  61.3     6.7 0.00015   33.5   2.5   23  246-268    46-68  (261)
133 cd05071 PTKc_Src Catalytic dom  61.2     6.7 0.00015   33.8   2.5   24  245-268    45-68  (262)
134 cd07873 STKc_PCTAIRE1 Catalyti  60.7      10 0.00022   33.5   3.6   23  246-268    49-71  (301)
135 KOG2996|consensus               60.5     3.8 8.2E-05   40.4   0.8   40  210-250   625-666 (865)
136 KOG0193|consensus               58.1     3.1 6.7E-05   41.3  -0.2   32   15-46    195-227 (678)
137 cd05114 PTKc_Tec_Rlk Catalytic  57.8     9.7 0.00021   32.5   2.9   25  245-269    43-67  (256)
138 cd05076 PTK_Tyk2_rpt1 Pseudoki  57.7     4.6  0.0001   35.3   0.8   23  246-268    61-83  (274)
139 PHA03209 serine/threonine kina  57.6      13 0.00028   34.0   3.8   21  247-267   103-123 (357)
140 cd05067 PTKc_Lck_Blk Catalytic  57.1     7.2 0.00016   33.4   2.0   22  246-267    46-67  (260)
141 cd06644 STKc_STK10_LOK Catalyt  57.1       4 8.7E-05   35.8   0.4   22  247-268    55-76  (292)
142 PTZ00263 protein kinase A cata  57.0      18 0.00039   32.6   4.7   22  247-268    64-85  (329)
143 KOG0611|consensus               57.0     4.5 9.8E-05   38.5   0.7   18  250-267   102-119 (668)
144 PRK13914 invasion associated s  55.5      15 0.00033   35.6   4.0   43  213-257   104-147 (481)
145 KOG3667|consensus               55.3      20 0.00043   36.1   4.8   52   89-145   564-616 (682)
146 PF07714 Pkinase_Tyr:  Protein   53.0     5.1 0.00011   34.6   0.4   22  246-267    46-67  (259)
147 cd05064 PTKc_EphR_A10 Catalyti  52.6     6.6 0.00014   33.9   1.0   23  246-268    51-73  (266)
148 cd05096 PTKc_DDR1 Catalytic do  50.5     6.9 0.00015   34.6   0.8   21  247-267    65-85  (304)
149 PHA03207 serine/threonine kina  49.5      22 0.00048   33.0   4.0   20  248-267   133-152 (392)
150 cd07868 STKc_CDK8 Catalytic do  49.2     7.4 0.00016   34.5   0.8   22  247-268    44-65  (317)
151 cd07871 STKc_PCTAIRE3 Catalyti  48.7     7.7 0.00017   34.0   0.8   23  246-268    48-70  (288)
152 KOG4717|consensus               48.5       7 0.00015   38.4   0.5   21  246-266    62-82  (864)
153 cd07860 STKc_CDK2_3 Catalytic   48.4     7.5 0.00016   33.8   0.7   23  246-268    44-66  (284)
154 PTZ00036 glycogen synthase kin  48.0      23  0.0005   33.6   4.0   19  249-267   107-125 (440)
155 PF06677 Auto_anti-p27:  Sjogre  47.4     4.9 0.00011   25.3  -0.5   25    9-33      3-27  (41)
156 KOG0575|consensus               47.3     8.4 0.00018   38.1   0.8   20  248-267    65-84  (592)
157 cd07859 STKc_TDY_MAPK_plant Ca  47.3     7.9 0.00017   34.6   0.7   22  246-267    44-65  (338)
158 KOG0661|consensus               47.0     7.9 0.00017   37.5   0.6   20  248-267    55-75  (538)
159 cd05069 PTKc_Yes Catalytic dom  46.5      16 0.00034   31.3   2.4   23  246-268    46-68  (260)
160 cd07866 STKc_BUR1 Catalytic do  46.0      22 0.00048   31.0   3.4   22  246-267    52-73  (311)
161 cd05087 PTKc_Aatyk1_Aatyk3 Cat  45.9     8.7 0.00019   33.1   0.7   23  246-268    40-62  (269)
162 PF14446 Prok-RING_1:  Prokaryo  45.8       9  0.0002   25.6   0.6   26   21-46     19-44  (54)
163 cd06615 PKc_MEK Catalytic doma  45.6     9.3  0.0002   33.9   0.9   23  246-268    44-66  (308)
164 cd05042 PTKc_Aatyk Catalytic d  45.0     9.7 0.00021   32.8   0.9   22  246-267    40-61  (269)
165 KOG1035|consensus               45.0     7.9 0.00017   41.5   0.3   21  248-268   524-544 (1351)
166 cd06650 PKc_MEK1 Catalytic dom  44.7     8.8 0.00019   34.7   0.6   23  246-268    48-70  (333)
167 PF13696 zf-CCHC_2:  Zinc knuck  44.6     9.6 0.00021   22.7   0.5   14   21-34      6-19  (32)
168 PF05641 Agenet:  Agenet domain  44.5      27 0.00058   24.2   2.9   25  214-238     1-26  (68)
169 cd07869 STKc_PFTAIRE1 Catalyti  44.2      10 0.00022   33.5   0.9   21  247-267    49-69  (303)
170 KOG0659|consensus               44.1     8.8 0.00019   34.6   0.4   22  245-266    45-66  (318)
171 cd05075 PTKc_Axl Catalytic dom  43.5     9.8 0.00021   32.7   0.6   22  246-267    45-66  (272)
172 cd06649 PKc_MEK2 Catalytic dom  43.4      11 0.00024   34.0   1.0   22  246-267    48-69  (331)
173 cd05077 PTK_Jak1_rpt1 Pseudoki  43.3      11 0.00024   32.5   0.9   24  246-269    49-72  (262)
174 cd05086 PTKc_Aatyk2 Catalytic   43.2      11 0.00024   32.5   0.9   23  245-267    39-61  (268)
175 KOG0582|consensus               43.1      12 0.00025   36.1   1.1   23  247-269    70-92  (516)
176 cd00729 rubredoxin_SM Rubredox  42.9      20 0.00044   21.4   1.8   23   24-46      3-26  (34)
177 cd05084 PTKc_Fes Catalytic dom  42.8      11 0.00024   32.0   0.8   23  246-268    38-60  (252)
178 cd05108 PTKc_EGFR Catalytic do  42.5      11 0.00025   33.5   0.9   22  246-267    54-75  (316)
179 smart00557 IG_FLMN Filamin-typ  42.5      37  0.0008   24.8   3.6   30  103-137    49-78  (93)
180 cd05113 PTKc_Btk_Bmx Catalytic  42.3      11 0.00025   32.2   0.9   25  245-269    43-67  (256)
181 cd05582 STKc_RSK_N N-terminal   42.3      12 0.00027   33.3   1.1   22  247-268    44-65  (318)
182 cd05046 PTK_CCK4 Pseudokinase   42.0      11 0.00024   32.5   0.7   24  246-269    53-76  (275)
183 KOG4239|consensus               41.5     5.1 0.00011   36.4  -1.5   31   16-46     72-103 (348)
184 TIGR00354 polC DNA polymerase,  41.3      16 0.00034   38.4   1.7   31   16-46   1005-1036(1095)
185 cd05080 PTKc_Tyk2_rpt2 Catalyt  41.2      11 0.00023   32.8   0.5   22  246-267    51-72  (283)
186 cd05044 PTKc_c-ros Catalytic d  41.1      12 0.00027   32.0   0.9   21  247-267    45-65  (269)
187 cd07867 STKc_CDC2L6 Catalytic   41.0      12 0.00025   33.2   0.7   22  247-268    44-65  (317)
188 PRK04023 DNA polymerase II lar  40.9      16 0.00035   38.5   1.7   31   16-46   1030-1061(1121)
189 KOG1989|consensus               40.9      10 0.00023   38.7   0.4   20  248-267    81-101 (738)
190 cd05115 PTKc_Zap-70 Catalytic   40.9      11 0.00023   32.5   0.4   22  246-267    40-61  (257)
191 cd05595 STKc_PKB_beta Catalyti  40.6      14  0.0003   33.3   1.1   23  247-269    41-63  (323)
192 cd05052 PTKc_Abl Catalytic dom  40.6      22 0.00048   30.4   2.4   23  246-268    47-69  (263)
193 cd07844 STKc_PCTAIRE_like Cata  40.3      13 0.00028   32.4   0.9   23  246-268    48-70  (291)
194 cd05062 PTKc_IGF-1R Catalytic   40.1      12 0.00027   32.3   0.8   22  247-268    55-76  (277)
195 cd05037 PTK_Jak_rpt1 Pseudokin  39.9      12 0.00027   31.7   0.7   25  245-269    45-69  (259)
196 cd05045 PTKc_RET Catalytic dom  39.7      13 0.00029   32.4   0.9   24  246-269    48-71  (290)
197 PLN00009 cyclin-dependent kina  39.4      12 0.00026   32.7   0.6   24  245-268    45-68  (294)
198 cd05066 PTKc_EphR_A Catalytic   39.3      14  0.0003   31.8   0.9   21  247-267    51-71  (267)
199 cd05083 PTKc_Chk Catalytic dom  39.1      22 0.00049   30.2   2.2   23  246-268    44-66  (254)
200 cd05102 PTKc_VEGFR3 Catalytic   38.9      12 0.00026   33.7   0.4   22  247-268    56-78  (338)
201 cd07839 STKc_CDK5 Catalytic do  38.7      13 0.00029   32.1   0.7   24  244-267    42-65  (284)
202 cd06611 STKc_SLK_like Catalyti  38.6      12 0.00027   32.3   0.5   22  246-267    47-68  (280)
203 cd05074 PTKc_Tyro3 Catalytic d  38.3      14  0.0003   31.7   0.8   23  246-268    46-68  (273)
204 cd05105 PTKc_PDGFR_alpha Catal  38.1      13 0.00027   35.1   0.5   22  246-267    85-107 (400)
205 cd05585 STKc_YPK1_like Catalyt  38.0      14  0.0003   32.9   0.7   23  246-268    38-60  (312)
206 cd05058 PTKc_Met_Ron Catalytic  37.7      16 0.00035   31.1   1.1   22  246-267    41-62  (262)
207 cd05584 STKc_p70S6K Catalytic   37.6      14 0.00031   33.1   0.8   22  247-268    46-67  (323)
208 KOG0578|consensus               37.4      10 0.00023   37.1  -0.2   20  248-267   317-336 (550)
209 PTZ00266 NIMA-related protein   37.2      32  0.0007   36.6   3.3   21  247-267    58-78  (1021)
210 cd05095 PTKc_DDR2 Catalytic do  37.2      15 0.00032   32.3   0.8   23  246-268    64-86  (296)
211 cd05040 PTKc_Ack_like Catalyti  36.9      15 0.00032   31.2   0.8   22  246-267    41-62  (257)
212 cd07864 STKc_CDK12 Catalytic d  36.6      14 0.00031   32.2   0.6   23  245-267    50-72  (302)
213 PLN00034 mitogen-activated pro  36.6      15 0.00033   33.4   0.7   22  246-267   117-138 (353)
214 cd05612 STKc_PRKX_like Catalyt  36.6      13 0.00028   32.8   0.3   23  247-269    47-69  (291)
215 cd05078 PTK_Jak2_Jak3_rpt1 Pse  36.4      15 0.00033   31.4   0.7   22  246-267    44-65  (258)
216 KOG1829|consensus               36.4      14  0.0003   36.8   0.4   21   15-35    332-352 (580)
217 KOG0198|consensus               36.0      15 0.00034   33.6   0.7   21  248-268    61-81  (313)
218 PRK00398 rpoP DNA-directed RNA  35.8      24 0.00052   22.4   1.4   24   23-46      3-29  (46)
219 cd05082 PTKc_Csk Catalytic dom  35.8      35 0.00077   28.9   2.9   22  247-268    45-66  (256)
220 KOG0594|consensus               35.7      15 0.00033   33.8   0.6   24  244-267    53-77  (323)
221 PHA03210 serine/threonine kina  35.5      17 0.00036   35.3   0.9   21  247-267   209-229 (501)
222 cd05571 STKc_PKB Catalytic dom  35.3      19 0.00041   32.3   1.1   23  247-269    41-63  (323)
223 cd05593 STKc_PKB_gamma Catalyt  35.2      19 0.00041   32.4   1.2   24  246-269    40-63  (328)
224 cd05051 PTKc_DDR Catalytic dom  35.2      15 0.00033   32.0   0.5   23  246-268    64-86  (296)
225 cd06621 PKc_MAPKK_Pek1_like Ca  35.2      17 0.00036   31.8   0.8   22  246-267    44-65  (287)
226 KOG0032|consensus               35.1      16 0.00035   34.4   0.7   21  247-267    81-102 (382)
227 cd08229 STKc_Nek7 Catalytic do  34.9      15 0.00032   31.4   0.4   24  246-269    47-70  (267)
228 cd05065 PTKc_EphR_B Catalytic   34.8      17 0.00038   31.1   0.8   23  246-268    50-72  (269)
229 cd06619 PKc_MKK5 Catalytic dom  34.7      18 0.00039   31.4   0.9   24  246-269    44-67  (279)
230 cd05578 STKc_Yank1 Catalytic d  34.6      14 0.00031   31.4   0.3   22  246-267    45-66  (258)
231 cd05056 PTKc_FAK Catalytic dom  34.6      18 0.00038   31.1   0.8   21  247-267    53-73  (270)
232 cd05085 PTKc_Fer Catalytic dom  34.5      19 0.00041   30.5   1.0   21  247-267    38-58  (250)
233 cd07845 STKc_CDK10 Catalytic d  34.5      19 0.00042   31.8   1.1   22  246-267    51-72  (309)
234 cd05057 PTKc_EGFR_like Catalyt  34.3      18 0.00039   31.3   0.8   21  247-267    55-75  (279)
235 KOG0597|consensus               34.3      13 0.00028   37.1  -0.1   22  246-267    46-67  (808)
236 cd06625 STKc_MEKK3_like Cataly  34.2      17 0.00037   30.9   0.7   21  247-267    50-70  (263)
237 cd08228 STKc_Nek6 Catalytic do  34.2      17 0.00037   31.0   0.7   21  247-267    48-68  (267)
238 PRK14714 DNA polymerase II lar  34.2      23  0.0005   38.3   1.7   31   16-46   1246-1277(1337)
239 cd08221 STKc_Nek9 Catalytic do  34.2      17 0.00037   30.8   0.7   22  247-268    45-66  (256)
240 PTZ00426 cAMP-dependent protei  34.2      19 0.00041   32.8   1.0   21  248-268    78-98  (340)
241 cd05043 PTK_Ryk Pseudokinase d  33.7      19 0.00042   31.1   0.9   22  247-268    54-75  (280)
242 cd05104 PTKc_Kit Catalytic dom  33.7      16 0.00035   33.7   0.5   22  247-268    84-106 (375)
243 cd07865 STKc_CDK9 Catalytic do  33.7      19  0.0004   31.6   0.8   22  247-268    57-78  (310)
244 cd08227 PK_STRAD_alpha Pseudok  33.7      19 0.00041   32.2   0.9   21  247-267    45-65  (327)
245 cd07843 STKc_CDC2L1 Catalytic   33.6      17 0.00037   31.7   0.6   23  245-267    48-70  (293)
246 cd08529 STKc_FA2-like Catalyti  33.4      18 0.00039   30.6   0.7   23  246-268    44-66  (256)
247 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  33.3      18  0.0004   31.3   0.7   22  247-268    51-72  (284)
248 PF09151 DUF1936:  Domain of un  33.2      19 0.00042   21.1   0.6   10   25-34      3-12  (36)
249 PRK14715 DNA polymerase II lar  32.8      25 0.00054   38.3   1.7   30   16-46   1535-1565(1627)
250 cd07836 STKc_Pho85 Catalytic d  32.8      18  0.0004   31.2   0.6   24  246-269    43-66  (284)
251 cd05097 PTKc_DDR_like Catalyti  32.7      21 0.00046   31.3   1.0   22  247-268    63-84  (295)
252 cd00350 rubredoxin_like Rubred  32.7      38 0.00082   19.9   1.8   23   24-46      2-25  (33)
253 COG1439 Predicted nucleic acid  32.4      22 0.00048   29.8   1.0   27   19-46    135-161 (177)
254 cd05035 PTKc_Axl_like Catalyti  32.2      20 0.00043   30.7   0.7   22  246-267    46-67  (273)
255 cd05110 PTKc_HER4 Catalytic do  32.2      22 0.00048   31.4   1.1   21  247-267    55-75  (303)
256 cd05033 PTKc_EphR Catalytic do  32.0      20 0.00044   30.7   0.8   22  246-267    50-71  (266)
257 cd07848 STKc_CDKL5 Catalytic d  32.0      19 0.00041   31.3   0.6   22  246-267    45-66  (287)
258 cd05059 PTKc_Tec_like Catalyti  32.0      21 0.00046   30.4   0.9   23  246-268    44-66  (256)
259 KOG0583|consensus               31.9      18  0.0004   33.8   0.5   18  250-267    68-86  (370)
260 cd05050 PTKc_Musk Catalytic do  31.8      20 0.00043   31.2   0.7   23  246-268    53-75  (288)
261 cd06630 STKc_MEKK1 Catalytic d  31.7      18  0.0004   30.8   0.5   24  246-269    48-71  (268)
262 KOG1169|consensus               31.7      22 0.00047   35.6   1.0   26   20-45    126-152 (634)
263 cd05090 PTKc_Ror1 Catalytic do  31.5      21 0.00045   31.0   0.8   22  247-268    53-74  (283)
264 cd05626 STKc_LATS2 Catalytic d  30.9      23  0.0005   32.7   1.0   23  247-269    47-69  (381)
265 cd05093 PTKc_TrkB Catalytic do  30.8      22 0.00047   31.0   0.8   21  247-267    53-73  (288)
266 PTZ00267 NIMA-related protein   30.7      22 0.00048   34.1   0.9   20  248-267   112-131 (478)
267 cd05036 PTKc_ALK_LTK Catalytic  30.7      22 0.00047   30.8   0.8   23  247-269    55-77  (277)
268 PF07935 SSV1_ORF_D-335:  ORF D  30.6 1.3E+02  0.0028   21.4   4.4   44  110-177     6-49  (72)
269 cd07870 STKc_PFTAIRE2 Catalyti  30.6      21 0.00045   31.1   0.6   22  247-268    49-70  (291)
270 PF13824 zf-Mss51:  Zinc-finger  30.6      24 0.00051   23.7   0.7   15   20-34     11-25  (55)
271 cd06607 STKc_TAO Catalytic dom  30.4      21 0.00046   31.5   0.7   21  247-267    61-81  (307)
272 KOG0588|consensus               30.4      20 0.00043   36.3   0.5   23  245-267    56-78  (786)
273 cd05060 PTKc_Syk_like Catalyti  30.4      22 0.00047   30.3   0.7   22  246-267    41-62  (257)
274 cd06628 STKc_MAPKKK_Byr2_like   30.3      23  0.0005   30.2   0.9   23  246-268    51-73  (267)
275 cd07876 STKc_JNK2 Catalytic do  30.2      21 0.00046   32.4   0.7   21  247-267    66-86  (359)
276 COG3357 Predicted transcriptio  30.2      28  0.0006   25.9   1.1   27   19-45     54-80  (97)
277 cd07842 STKc_CDK8_like Catalyt  30.0      23  0.0005   31.1   0.8   24  246-269    47-70  (316)
278 cd05600 STKc_Sid2p_Dbf2p Catal  30.0      26 0.00056   31.4   1.2   23  247-269    47-69  (333)
279 cd05608 STKc_GRK1 Catalytic do  30.0      24 0.00052   30.7   0.9   22  247-268    39-60  (280)
280 KOG0598|consensus               29.8      26 0.00055   32.7   1.1   21  249-269    73-93  (357)
281 cd05116 PTKc_Syk Catalytic dom  29.7      23 0.00049   30.3   0.7   23  245-267    40-62  (257)
282 cd05607 STKc_GRK7 Catalytic do  29.6      25 0.00054   30.6   1.0   22  248-269    40-61  (277)
283 cd07851 STKc_p38 Catalytic dom  29.6      62  0.0013   29.2   3.6   20  248-267    61-80  (343)
284 cd05112 PTKc_Itk Catalytic dom  29.6      23  0.0005   30.0   0.7   23  246-268    44-66  (256)
285 cd07878 STKc_p38beta_MAPK11 Ca  29.4      22 0.00047   32.0   0.6   20  248-267    61-80  (343)
286 PRK10345 hypothetical protein;  29.4      20 0.00044   30.7   0.3   22  246-267    41-67  (210)
287 KOG1769|consensus               29.3 2.2E+02  0.0049   21.5   5.8   48  164-225    41-92  (99)
288 cd07847 STKc_CDKL1_4 Catalytic  29.2      25 0.00054   30.3   0.9   21  247-267    46-66  (286)
289 cd07861 STKc_CDK1_euk Catalyti  29.1      24 0.00051   30.5   0.7   22  246-267    44-65  (285)
290 cd05091 PTKc_Ror2 Catalytic do  29.0      27 0.00059   30.2   1.1   22  246-267    53-74  (283)
291 cd05049 PTKc_Trk Catalytic dom  29.0      24 0.00052   30.3   0.8   24  246-269    53-76  (280)
292 cd07853 STKc_NLK Catalytic dom  29.0      23 0.00051   32.4   0.7   21  247-267    45-65  (372)
293 cd05605 STKc_GRK4_like Catalyt  28.9      24 0.00053   30.8   0.8   23  246-268    45-67  (285)
294 cd06643 STKc_SLK Catalytic dom  28.8      24 0.00051   30.6   0.7   22  246-267    47-68  (282)
295 cd08217 STKc_Nek2 Catalytic do  28.8      25 0.00055   29.6   0.8   22  246-267    44-65  (265)
296 cd05107 PTKc_PDGFR_beta Cataly  28.8      24 0.00053   33.2   0.8   21  247-267    86-107 (401)
297 cd07856 STKc_Sty1_Hog1 Catalyt  28.7      23  0.0005   31.9   0.6   22  247-268    55-76  (328)
298 cd05063 PTKc_EphR_A2 Catalytic  28.6      26 0.00056   30.0   0.9   23  247-269    52-74  (268)
299 cd07835 STKc_CDK1_like Catalyt  28.6      23 0.00049   30.6   0.5   24  245-268    42-65  (283)
300 cd05055 PTKc_PDGFR Catalytic d  28.5      26 0.00056   31.0   0.8   22  247-268    84-106 (302)
301 COG3677 Transposase and inacti  28.4      26 0.00057   27.7   0.8   13   21-33     51-63  (129)
302 cd05580 STKc_PKA Catalytic dom  28.4      27 0.00058   30.5   0.9   22  247-268    47-68  (290)
303 PF01363 FYVE:  FYVE zinc finge  28.3      31 0.00068   23.6   1.1   21   18-38     20-40  (69)
304 cd05106 PTKc_CSF-1R Catalytic   28.2      25 0.00054   32.5   0.7   22  247-268    87-109 (374)
305 cd05632 STKc_GRK5 Catalytic do  28.1      27  0.0006   30.4   1.0   24  246-269    45-68  (285)
306 cd07849 STKc_ERK1_2_like Catal  27.9      26 0.00056   31.5   0.8   21  247-267    49-69  (336)
307 cd05631 STKc_GRK4 Catalytic do  27.8      27 0.00059   30.5   0.9   24  246-269    45-68  (285)
308 cd06624 STKc_ASK Catalytic dom  27.5      27 0.00059   29.9   0.8   21  247-267    51-71  (268)
309 cd07879 STKc_p38delta_MAPK13 C  27.5      26 0.00056   31.7   0.7   22  246-267    59-80  (342)
310 PF03811 Zn_Tnp_IS1:  InsA N-te  27.4      31 0.00066   21.0   0.8   11   20-30     26-36  (36)
311 cd07874 STKc_JNK3 Catalytic do  27.3      25 0.00054   31.9   0.6   21  247-267    62-82  (355)
312 cd05579 STKc_MAST_like Catalyt  27.2      19 0.00041   30.4  -0.3   24  246-269    38-61  (265)
313 cd06635 STKc_TAO1 Catalytic do  27.1      27 0.00058   31.1   0.7   21  247-267    71-91  (317)
314 cd05032 PTKc_InsR_like Catalyt  27.1      27 0.00058   30.0   0.7   21  247-267    55-75  (277)
315 cd07840 STKc_CDK9_like Catalyt  27.1      24 0.00052   30.3   0.4   24  245-268    42-65  (287)
316 cd07855 STKc_ERK5 Catalytic do  27.1      26 0.00057   31.4   0.7   21  247-267    50-70  (334)
317 cd07850 STKc_JNK Catalytic dom  26.9      75  0.0016   28.7   3.7   21  247-267    61-81  (353)
318 cd07854 STKc_MAPK4_6 Catalytic  26.9      23 0.00049   32.0   0.2   23  246-268    47-69  (342)
319 cd08226 PK_STRAD_beta Pseudoki  26.7      30 0.00066   30.9   1.0   22  246-267    44-65  (328)
320 PHA00626 hypothetical protein   26.7      33 0.00071   23.2   0.9   17   21-37     21-37  (59)
321 cd05039 PTKc_Csk_like Catalyti  26.5      27 0.00059   29.6   0.6   22  247-268    46-67  (256)
322 cd06642 STKc_STK25-YSK1 Cataly  26.5      26 0.00057   30.2   0.5   22  247-268    48-69  (277)
323 cd07877 STKc_p38alpha_MAPK14 C  26.3      28  0.0006   31.6   0.7   21  247-267    62-82  (345)
324 cd06652 STKc_MEKK2 Catalytic d  26.2      30 0.00064   29.6   0.8   22  247-268    50-71  (265)
325 cd06613 STKc_MAP4K3_like Catal  26.1      30 0.00065   29.3   0.8   23  246-268    45-67  (262)
326 cd05625 STKc_LATS1 Catalytic d  26.1      30 0.00066   31.7   0.9   23  247-269    47-69  (382)
327 cd05594 STKc_PKB_alpha Catalyt  26.0      34 0.00073   30.6   1.2   23  247-269    41-63  (325)
328 cd06641 STKc_MST3 Catalytic do  25.9      29 0.00062   30.0   0.7   22  247-268    48-69  (277)
329 cd07841 STKc_CDK7 Catalytic do  25.8      30 0.00066   30.1   0.8   23  246-268    47-69  (298)
330 cd06620 PKc_MAPKK_Byr1_like Ca  25.7      28 0.00061   30.2   0.6   22  246-267    48-69  (284)
331 PTZ00024 cyclin-dependent prot  25.6      30 0.00065   30.9   0.8   21  247-267    66-86  (335)
332 cd07880 STKc_p38gamma_MAPK12 C  25.5      31 0.00068   31.2   0.9   21  247-267    60-80  (343)
333 cd06651 STKc_MEKK3 Catalytic d  25.5      31 0.00067   29.6   0.8   22  247-268    50-71  (266)
334 cd06646 STKc_MAP4K5 Catalytic   25.5      33 0.00072   29.3   1.0   23  247-269    52-74  (267)
335 cd06609 STKc_MST3_like Catalyt  25.3      31 0.00067   29.7   0.7   23  247-269    45-67  (274)
336 cd05629 STKc_NDR_like_fungal C  25.2      36 0.00077   31.2   1.2   22  247-268    47-68  (377)
337 cd06633 STKc_TAO3 Catalytic do  25.2      32 0.00069   30.6   0.8   22  247-268    67-88  (313)
338 cd07832 STKc_CCRK Catalytic do  25.2      29 0.00063   29.9   0.5   23  245-267    43-65  (286)
339 KOG0580|consensus               25.1      38 0.00081   30.2   1.2   23  244-266    65-87  (281)
340 cd08220 STKc_Nek8 Catalytic do  25.1      33  0.0007   28.9   0.8   21  247-267    45-65  (256)
341 cd05088 PTKc_Tie2 Catalytic do  25.0      32 0.00069   30.4   0.8   23  247-269    53-76  (303)
342 cd06629 STKc_MAPKKK_Bck1_like   25.0      32  0.0007   29.5   0.8   23  247-269    54-76  (272)
343 cd05048 PTKc_Ror Catalytic Dom  24.9      34 0.00073   29.5   0.9   23  246-268    53-75  (283)
344 cd06640 STKc_MST4 Catalytic do  24.8      33 0.00071   29.7   0.8   24  246-269    47-70  (277)
345 cd05100 PTKc_FGFR3 Catalytic d  24.8      28 0.00061   31.2   0.4   23  246-268    62-85  (334)
346 cd05094 PTKc_TrkC Catalytic do  24.6      38 0.00081   29.6   1.2   24  246-269    52-75  (291)
347 cd06622 PKc_MAPKK_PBS2_like Ca  24.5      26 0.00057   30.3   0.1   23  246-268    44-66  (286)
348 PF00630 Filamin:  Filamin/ABP2  24.5      70  0.0015   23.2   2.5   29  105-138    65-93  (101)
349 cd08225 STKc_Nek5 Catalytic do  24.3      32 0.00069   29.0   0.6   23  246-268    44-66  (257)
350 cd05598 STKc_LATS Catalytic do  24.3      37  0.0008   31.0   1.1   23  246-268    46-68  (376)
351 PF07754 DUF1610:  Domain of un  24.3      38 0.00083   18.7   0.7   11   21-31     14-24  (24)
352 cd08216 PK_STRAD Pseudokinase   24.2      31 0.00067   30.4   0.6   21  247-267    45-65  (314)
353 smart00249 PHD PHD zinc finger  24.1      48   0.001   20.0   1.3   19   23-41     14-32  (47)
354 cd05061 PTKc_InsR Catalytic do  24.1      35 0.00076   29.7   0.9   22  247-268    55-76  (288)
355 cd06612 STKc_MST1_2 Catalytic   24.1      31 0.00068   29.1   0.5   23  245-267    42-64  (256)
356 cd07846 STKc_CDKL2_3 Catalytic  24.0      26 0.00056   30.2   0.0   24  245-268    44-67  (286)
357 cd05596 STKc_ROCK Catalytic do  23.9      39 0.00084   31.1   1.2   21  248-268    90-110 (370)
358 KOG4718|consensus               23.9      25 0.00055   30.3  -0.1   22   17-38    188-209 (235)
359 cd05609 STKc_MAST Catalytic do  23.8      37  0.0008   29.9   1.0   23  247-269    47-69  (305)
360 PF09237 GAGA:  GAGA factor;  I  23.8      34 0.00074   22.7   0.5   24   14-37     15-38  (54)
361 COG3168 PilP Tfp pilus assembl  23.7      60  0.0013   26.7   2.1   47   70-116    75-125 (170)
362 cd05047 PTKc_Tie Catalytic dom  23.7      34 0.00074   29.4   0.7   23  246-268    40-63  (270)
363 cd05111 PTK_HER3 Pseudokinase   23.6      38 0.00081   29.4   1.0   22  247-268    55-76  (279)
364 cd06653 STKc_MEKK3_like_1 Cata  23.6      36 0.00078   29.1   0.8   22  247-268    50-71  (264)
365 cd07833 STKc_CDKL Catalytic do  23.6      34 0.00074   29.5   0.7   23  246-268    45-67  (288)
366 cd05092 PTKc_TrkA Catalytic do  23.2      39 0.00085   29.3   1.0   22  247-268    53-74  (280)
367 KOG1829|consensus               23.1      22 0.00047   35.4  -0.7   21   23-43    531-551 (580)
368 cd05621 STKc_ROCK2 Catalytic d  23.1      37 0.00081   31.3   0.9   21  248-268    90-110 (370)
369 smart00064 FYVE Protein presen  23.1      42 0.00091   22.8   0.9   22   18-39     21-42  (68)
370 cd08218 STKc_Nek1 Catalytic do  22.9      37  0.0008   28.7   0.8   23  246-268    44-66  (256)
371 cd08530 STKc_CNK2-like Catalyt  22.9      33 0.00072   28.8   0.5   22  247-268    45-66  (256)
372 COG1571 Predicted DNA-binding   22.8      39 0.00085   32.3   0.9   15   22-36    366-380 (421)
373 cd05572 STKc_cGK_PKG Catalytic  22.6      37 0.00081   28.8   0.7   23  246-268    38-60  (262)
374 cd06647 STKc_PAK_I Catalytic d  22.5      37  0.0008   29.8   0.7   21  247-267    62-82  (293)
375 cd05079 PTKc_Jak1_rpt2 Catalyt  22.3      39 0.00085   29.3   0.8   23  246-268    51-73  (284)
376 PRK11823 DNA repair protein Ra  22.3      50  0.0011   31.7   1.6   26   21-47      5-30  (446)
377 cd06631 STKc_YSK4 Catalytic do  22.2      39 0.00084   28.8   0.8   23  247-269    48-70  (265)
378 cd05041 PTKc_Fes_like Catalyti  22.1      41 0.00089   28.3   0.9   22  246-267    37-58  (251)
379 cd07875 STKc_JNK1 Catalytic do  22.0      39 0.00084   30.8   0.7   21  247-267    69-89  (364)
380 cd06654 STKc_PAK1 Catalytic do  22.0      40 0.00088   29.6   0.9   21  247-267    63-83  (296)
381 cd05622 STKc_ROCK1 Catalytic d  21.8      45 0.00098   30.7   1.2   22  248-269    90-111 (371)
382 cd05599 STKc_NDR_like Catalyti  21.8      43 0.00094   30.4   1.0   22  247-268    47-68  (364)
383 PF06397 Desulfoferrod_N:  Desu  21.7      37 0.00081   20.7   0.4   13   21-33      4-16  (36)
384 TIGR00416 sms DNA repair prote  21.7      49  0.0011   32.0   1.4   26   21-47      5-30  (454)
385 cd05053 PTKc_FGFR Catalytic do  21.7      37 0.00081   29.5   0.6   21  247-267    61-82  (293)
386 cd01121 Sms Sms (bacterial rad  21.6      45 0.00097   31.3   1.1   23   24-47      1-23  (372)
387 cd05577 STKc_GRK Catalytic dom  21.6      43 0.00094   28.9   1.0   23  246-268    38-60  (277)
388 cd00065 FYVE FYVE domain; Zinc  21.5      50  0.0011   21.5   1.0   23   18-40     13-35  (57)
389 cd06645 STKc_MAP4K3 Catalytic   21.4      44 0.00095   28.5   1.0   23  247-269    52-74  (267)
390 cd06648 STKc_PAK_II Catalytic   21.4      42 0.00091   29.3   0.8   22  247-268    62-83  (285)
391 cd06634 STKc_TAO2 Catalytic do  21.3      42 0.00092   29.7   0.8   21  247-267    61-81  (308)
392 cd08219 STKc_Nek3 Catalytic do  21.2      40 0.00087   28.5   0.7   23  246-268    43-65  (255)
393 cd06632 STKc_MEKK1_plant Catal  21.0      42  0.0009   28.3   0.7   23  247-269    48-70  (258)
394 cd07829 STKc_CDK_like Catalyti  20.9      34 0.00074   29.3   0.1   25  244-268    41-65  (282)
395 COG1066 Sms Predicted ATP-depe  20.9      60  0.0013   31.1   1.7   24   22-46      6-29  (456)
396 cd06614 STKc_PAK Catalytic dom  20.9      39 0.00085   29.3   0.5   22  246-267    60-81  (286)
397 cd05038 PTKc_Jak_rpt2 Catalyti  20.8      42 0.00091   28.8   0.7   22  246-267    51-72  (284)
398 cd06638 STKc_myosinIIIA Cataly  20.2      73  0.0016   27.4   2.1   21  247-267    60-81  (286)
399 PF07295 DUF1451:  Protein of u  20.2      65  0.0014   26.1   1.6   24   23-46    112-138 (146)
400 smart00219 TyrKc Tyrosine kina  20.0      42  0.0009   28.2   0.5   22  246-267    46-67  (258)

No 1  
>KOG2996|consensus
Probab=100.00  E-value=1.7e-55  Score=408.93  Aligned_cols=234  Identities=31%  Similarity=0.581  Sum_probs=207.7

Q ss_pred             hheehhcccCCCceecCcCCcchhcccccCCCCCCCC--------------------------CCCCCCC--------CC
Q psy3210          11 ISIVTLKSRGLRPLCSQACYLACHKQCIPHTGRCGTG--------------------------VPLPAMS--------PR   56 (272)
Q Consensus        11 ~~~~~~~g~~~qg~~c~~c~~~~h~~c~~~~~~C~~~--------------------------~~~p~~~--------pp   56 (272)
                      .-.|||||+|||||.|.+||+.+||+|+++++.|++.                          +|+|+|.        ||
T Consensus       539 vC~mllrGtfYQGY~C~~c~~~ahkecl~~vp~cgr~~q~~~Gt~k~~~k~~~~~r~t~~rn~~GLpkm~~vq~ysg~p~  618 (865)
T KOG2996|consen  539 VCQMLLRGTFYQGYKCEKCGADAHKECLGRVPPCGRYLQFAKGTRKEVIKMTGHNRFTNKRNRPGLPKMDVVQNYSGIPP  618 (865)
T ss_pred             HHHHHhhhhhhcceeeeeccccHHHHhccCCCCcccccccCCcchhhhhhhcCccccccccCCCCCcchhhhhccCCCCC
Confidence            3579999999999999999999999999999999543                          4678885        55


Q ss_pred             CC-----cccccCCCCC------------------CCCcceeecCccC------------cCCcccccEeeeeCCHHHHH
Q psy3210          57 PP-----LMDIAGAAQP------------------LGGNEWTAKSWAD------------HENLSEYLWFVGEMGREKAT  101 (272)
Q Consensus        57 pp-----~~~~~~~~~~------------------~~~~g~~P~~~~~------------~~~l~~~~Wf~g~isR~~Ae  101 (272)
                      ||     ++.++.||.+                  .+..||+|++..+            +.+++.++||.|.|.|.+||
T Consensus       619 Pag~igP~l~~~~gdvlel~~~d~~s~~w~gr~~~sr~sg~fpss~vkp~~~vpr~~~~~~~d~s~~~WyaG~MERaqae  698 (865)
T KOG2996|consen  619 PAGSIGPRLVLQEGDVLELLKGDAESSWWEGRNHGSRESGNFPSSTVKPCPSVPRQQDYVPTDYSEFPWYAGEMERAQAE  698 (865)
T ss_pred             CCccCCCceEecCCceeehhcCCCCCcccccCCccCCccCCCCccccCcCCCCCCCCCCCccchhhhhhhcchHhhhhhh
Confidence            54     6778888833                  1337888888522            56788899999999999999


Q ss_pred             HhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhhhhhhhhhccccccc
Q psy3210         102 SLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIEN  181 (272)
Q Consensus       102 ~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~eLV~~y~~~~L~~~  181 (272)
                      ..|+++++|+||||.+...     ...|+||++++..|+|++|.+.+ |   +|+|.+.+.|.|+.|||+||+.|+|.+.
T Consensus       699 s~Lk~~~ngT~LVR~r~ke-----a~e~AISikynnevKHikI~~~d-g---~~~i~E~k~F~sl~ELVeyYq~~sLke~  769 (865)
T KOG2996|consen  699 STLKNRPNGTYLVRYRTKE-----AKEFAISIKYNNEVKHIKIETND-G---KVHITEDKKFNSLVELVEYYQSHSLKEI  769 (865)
T ss_pred             hHhhcCCCceEEEEecccc-----hhheeEEEEeccccceEEEEecC-C---eEEechhhhhhhHHHHHHHHHhccHHHH
Confidence            9999999999999999754     58999999999999999999985 4   9999999999999999999999999999


Q ss_pred             ccccccccccccee----------------------eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCC
Q psy3210         182 FIGLNVRLQLPFRQ----------------------IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDE  239 (272)
Q Consensus       182 ~~~l~~~L~~P~~~----------------------~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g  239 (272)
                      |..|+++|+.|++.                      ..|+|.|||.+.+..||||++||+|.++++.|++.|||+|+++|
T Consensus       770 Fk~LDTtLk~Pyke~e~sa~~~~~~~~~sv~s~~~~g~AvarYdf~ard~~eLSlk~GDvV~i~~k~g~d~GWWkGevng  849 (865)
T KOG2996|consen  770 FKALDTTLKFPYKEPEHSAGQRGNRAGNSVLSPKVVGTAVARYDFCARDMRELSLKEGDVVKIYDKVGEDQGWWKGEVNG  849 (865)
T ss_pred             HHHhhhhhcCCCcChhhhhhhccccccccccCcceeeeeeeccccCCCchhhcccccCCEEEEehhccccCceecceecC
Confidence            99999999999962                      25789999999999999999999999999999989999999999


Q ss_pred             eeeeeeccchhhhh
Q psy3210         240 RVSYFFQLYWGNFR  253 (272)
Q Consensus       240 ~~G~fP~~yVeE~~  253 (272)
                      ++||||++||+|-.
T Consensus       850 rvGwFPstYVee~~  863 (865)
T KOG2996|consen  850 RVGWFPSTYVEEDD  863 (865)
T ss_pred             cccccccccccccC
Confidence            99999999999854


No 2  
>KOG4278|consensus
Probab=99.96  E-value=8e-30  Score=241.30  Aligned_cols=183  Identities=18%  Similarity=0.339  Sum_probs=146.9

Q ss_pred             CcceeecCcc-CcCCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecC
Q psy3210          71 GNEWTAKSWA-DHENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM  149 (272)
Q Consensus        71 ~~g~~P~~~~-~~~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~  149 (272)
                      ++||||+||+ ...+|+.+.||||.++|..||.+|...-.|+||||+|++.     ++.|+||++++++|+||+|....+
T Consensus       134 GqGWVPSNyItPvNSLeKhsWYHGpvSRsaaEy~LsSgInGSFLVRESEsS-----pgQ~sISlRyeGRVyHYRINt~~d  208 (1157)
T KOG4278|consen  134 GQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYILSSGINGSFLVRESESS-----PGQYSISLRYEGRVYHYRINTDND  208 (1157)
T ss_pred             CCccccccccccccchhhcccccCccccchhhhhhhcCcccceEEeeccCC-----CcceeEEEEecceEEEEEeeccCC
Confidence            4799999994 4679999999999999999999999888899999999855     599999999999999999999888


Q ss_pred             CCcceEEeecccccchhhhhhhhhhccccccccccccccccccceeeeeeeeccCCCCCCCCCccCCCcEEEE----eee
Q psy3210         150 DGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFRQIIAVAEFDFCPTEANQLPLKQGCQVIV----LSK  225 (272)
Q Consensus       150 g~~~~~~i~~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~~~~~~alydf~~~~~~ELsl~~Gd~i~v----~~k  225 (272)
                      |   +.|+.....|.+|.|||.||++.+     ++|-+.|.+|..+.--..+|.-.+.. |++.+.+-||+.-    -++
T Consensus       209 g---K~yvt~EsrF~TLaELVHHHStvA-----DGLittLhYPApK~nKptvygvSPn~-DkWEmeRtdItMkhKLGGGQ  279 (1157)
T KOG4278|consen  209 G---KMYVTQESRFRTLAELVHHHSTVA-----DGLITTLHYPAPKKNKPTVYGVSPNA-DKWEMERTDITMKHKLGGGQ  279 (1157)
T ss_pred             c---cEEEeehhhhhHHHHHHhhccccc-----cceeEeeeccCccCCCCceeeecCCc-chhhccchheeeeeccCCCc
Confidence            7   777777778999999999999998     99999999999643222244333322 4444444444311    235


Q ss_pred             eCCc-CCeEEEEeC-------CeeeeeeccchhhhhhhccCCCCCcccce
Q psy3210         226 EGEQ-KGWWKGKID-------ERVSYFFQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       226 ~ge~-~gwW~G~~~-------g~~G~fP~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .||+ .|.|+...-       +...|--.+|++||.+||.+.|||||||.
T Consensus       280 YGeVYeGvWKkyslTvAVKtLKEDtMeveEFLkEAAvMKeikHpNLVqLL  329 (1157)
T KOG4278|consen  280 YGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLL  329 (1157)
T ss_pred             ccceeeeeeeccceeeehhhhhhcchhHHHHHHHHHHHHhhcCccHHHHh
Confidence            5655 888986432       46677778999999999999999999996


No 3  
>KOG1264|consensus
Probab=99.95  E-value=6.1e-28  Score=231.97  Aligned_cols=157  Identities=28%  Similarity=0.573  Sum_probs=131.2

Q ss_pred             cCcCCcccccEeeeeCCHHHHHHhccc-CCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEee
Q psy3210          80 ADHENLSEYLWFVGEMGREKATSLLER-EADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLS  158 (272)
Q Consensus        80 ~~~~~l~~~~Wf~g~isR~~Ae~lL~~-~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~  158 (272)
                      +.+..+++++|||...+|++||++|.. ..||+||||.++      ..+.|+||++.+++|+|++|.++..    .|.++
T Consensus       640 Pqp~~He~k~W~~as~treqAE~mL~rvp~DGaFLiR~~~------~~nsy~iSfr~~gkikHcRi~rdGr----~fvl~  709 (1267)
T KOG1264|consen  640 PQPNPHESKPWYHASLTREQAEDMLMRVPRDGAFLIRKRE------GSNSYAISFRARGKIKHCRINRDGR----HFVLG  709 (1267)
T ss_pred             CCCCcccCCccccccccHHHHHHHHhhCccCcceEEEecc------CCceEEEEEEEcCcEeEEEEccCce----EEEec
Confidence            345788999999999999999999976 567999999653      3589999999999999999988643    56666


Q ss_pred             cccccchhhhhhhhhhccccccccccccccccccc----------------------------------eeeeeeeeccC
Q psy3210         159 QSRYFRSIVELICCYERNSLIENFIGLNVRLQLPF----------------------------------RQIIAVAEFDF  204 (272)
Q Consensus       159 ~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~----------------------------------~~~~~~alydf  204 (272)
                      .. .|+||++||+||.+++|.+...     |.+|+                                  ++..++|+|||
T Consensus       710 t~-~FesLv~lv~yY~k~~lyR~mk-----Lr~PVnee~l~~~~~e~d~~a~~d~~r~pg~yme~n~~~~~vt~kAL~~Y  783 (1267)
T KOG1264|consen  710 TS-AFESLVELVSYYEKHPLYRKMK-----LRYPVNEELLERYNTERDINALYDVSRMPGDYMEINPSMPQVTVKALYDY  783 (1267)
T ss_pred             cH-HHHHHHHHHHHHhcChhhhccc-----ccCcCCHHHHHHhhhhcccccccccccCCCCccccCccccchhhhhhhcc
Confidence            55 5999999999999999875432     22222                                  12468899999


Q ss_pred             CCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCe-eeeeeccchhhhhh
Q psy3210         205 CPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDER-VSYFFQLYWGNFRL  254 (272)
Q Consensus       205 ~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~-~G~fP~~yVeE~~~  254 (272)
                      .+...|||+|.+|.+|+++.+..  .|||+|++.|+ .+|||+|||+|+-.
T Consensus       784 ka~r~DELSFpk~aiItnv~kee--g~wWrGdYGg~iq~wfPsnyVeei~~  832 (1267)
T KOG1264|consen  784 KAKRSDELSFPKGAIITNVSKEE--GGWWRGDYGGRIQQWFPSNYVEEIST  832 (1267)
T ss_pred             ccCCcccccccccceeEeeeccC--CceeecccccceeeeccHHHhhhhcc
Confidence            99999999999999999998776  68999999975 58999999998754


No 4  
>KOG4792|consensus
Probab=99.94  E-value=4e-27  Score=198.03  Aligned_cols=156  Identities=22%  Similarity=0.405  Sum_probs=129.3

Q ss_pred             CCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCC-c---ceEEee
Q psy3210          83 ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDG-V---PQYFLS  158 (272)
Q Consensus        83 ~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~-~---~~~~i~  158 (272)
                      +..+...||+|.|+|+||..+|.+...|+||||+|...     +|.|+|||+++.+|.||.|.+..-.. +   ..|.|+
T Consensus         6 D~~er~swYfg~mSRqeA~~lL~~~r~G~FLvRDSst~-----pGdYvLsV~E~srVshYiIn~~~p~~~~~~~~~~rIg   80 (293)
T KOG4792|consen    6 DSSERSSWYFGPMSRQEAVALLQGQRHGVFLVRDSSTS-----PGDYVLSVSENSRVSHYIINSSPPSPAQPPPSRLRIG   80 (293)
T ss_pred             ChhhccceecCcccHHHHHHHhcCcceeeEEEecCCCC-----CCceEEEEecCcceeeeeecCCCCCccCCCcceeeec
Confidence            34455689999999999999999988999999999754     69999999999999999998732210 1   158998


Q ss_pred             cccccchhhhhhhhhhccccccccccccccccccce--------------eeeeeeeccCCCCCCCCCccCCCcEEEEee
Q psy3210         159 QSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFR--------------QIIAVAEFDFCPTEANQLPLKQGCQVIVLS  224 (272)
Q Consensus       159 ~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~--------------~~~~~alydf~~~~~~ELsl~~Gd~i~v~~  224 (272)
                      +.. |++|+.|++||+.+-|.      .++|..|++              ...++|+|||.+.+.++|.|++||+++|+.
T Consensus        81 dQ~-Fd~lPaLL~fykihyLd------tttLi~p~~r~~~~~~~~~~~~~~~~vr~~fdF~G~deeDLPFkkGeiL~I~~  153 (293)
T KOG4792|consen   81 DQE-FDSLPALLEFYKIHYLD------TTTLIEPAKRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGEILRIRD  153 (293)
T ss_pred             ccc-ccchHHHHhheeEeeec------cccccccccccccccCcccchhhhhheeeeeccCCCccccCCcccCcEEEEec
Confidence            885 99999999999987652      344555543              235778999999999999999999999999


Q ss_pred             eeCCcCCeEEEEeC-Ceeeeeeccchhhh
Q psy3210         225 KEGEQKGWWKGKID-ERVSYFFQLYWGNF  252 (272)
Q Consensus       225 k~ge~~gwW~G~~~-g~~G~fP~~yVeE~  252 (272)
                      |..  +.||..+.. |++|++|.+||+..
T Consensus       154 K~e--eqWW~Arns~Gk~GmIPvpYVe~~  180 (293)
T KOG4792|consen  154 KPE--EQWWNARNSEGKRGMIPVPYVEKY  180 (293)
T ss_pred             CcH--HHhhhhhccCCcccceechHHHhh
Confidence            887  459999875 99999999999954


No 5  
>KOG0197|consensus
Probab=99.94  E-value=2.5e-27  Score=221.45  Aligned_cols=183  Identities=23%  Similarity=0.381  Sum_probs=147.5

Q ss_pred             CCCcceeecCccCc-------CCcccccEeeeeCCHHHHHHhccc--CCCceEEEEeCCCCCCCCCCCceEEEEeeCC--
Q psy3210          69 LGGNEWTAKSWADH-------ENLSEYLWFVGEMGREKATSLLER--EADGTYLLRIRPQGPTHPNETIYALSLKTDE--  137 (272)
Q Consensus        69 ~~~~g~~P~~~~~~-------~~l~~~~Wf~g~isR~~Ae~lL~~--~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~--  137 (272)
                      ++.+|++|+|+...       .+++.++||+|.|+|++||+.|..  ...|+||||+|++     .++.|+||++...  
T Consensus        55 ~~~~g~ip~N~v~~~~~~~~~~~l~~~~Wf~~~isR~~ae~~ll~p~~~~G~flvR~se~-----~~g~yslsv~~~~~~  129 (468)
T KOG0197|consen   55 LGQEGYIPSNYVARNRGSPAFIKLSDEPWFFGKISREEAERQLLAPENKEGAFLVRESES-----DKGDYSLSVREGDSG  129 (468)
T ss_pred             cCCCCcCcCceeeccccCCCccccccCCchhccccHHHHHHhhcCCCCCccceeeecccC-----CcCCeeEEEEecccc
Confidence            35689999999443       789999999999999999987755  4569999999974     4799999999965  


Q ss_pred             ----eeeEEEEEEecCCCcceEE--eecccccchhhhhhhhhhccccccccccccccccccceee----eeee-e-ccCC
Q psy3210         138 ----KVKHMKVYEKEMDGVPQYF--LSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFRQI----IAVA-E-FDFC  205 (272)
Q Consensus       138 ----~v~H~~I~~~~~g~~~~~~--i~~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~~~----~~~a-l-ydf~  205 (272)
                          .|+||+|...+++   .++  +.....|++|.+||+||+.++     +++++.|..|+...    ...+ + +|-+
T Consensus       130 ~~~~~v~hyri~~~~~~---~~~~~~~~~~~F~~l~~lv~~~~~~~-----~gl~~~l~~p~~~~~~~~p~~~~~~~d~w  201 (468)
T KOG0197|consen  130 GLGAKVKHYRIRQLDGG---GLYPYIDERELFSSLQQLVNYYSKNA-----DGLCTRLRDPCSKQGHTKPQTPDLARDPW  201 (468)
T ss_pred             CCccceeeeeeeEcCCC---CeecCCCHHHhhhhHHHHHhhhhccC-----cchhhcccCchhccCCCCCCCCccccCCe
Confidence                8999999998876   455  888889999999999999999     79999999998531    2222 1 4445


Q ss_pred             CCCCCCCccCCCcEEEEeeeeCCc-CCeEEEEeC------CeeeeeeccchhhhhhhccCCCCCcccce
Q psy3210         206 PTEANQLPLKQGCQVIVLSKEGEQ-KGWWKGKID------ERVSYFFQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       206 ~~~~~ELsl~~Gd~i~v~~k~ge~-~gwW~G~~~------g~~G~fP~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..++++|.|.+ ++  +.+.||++ .|+|+|...      ....+.|..|++||++||+|+|+|||||.
T Consensus       202 ei~r~~l~l~~-~L--G~G~FG~V~~g~~~~~~~vavk~ik~~~m~~~~f~~Ea~iMk~L~H~~lV~l~  267 (468)
T KOG0197|consen  202 EIPREELKLIR-EL--GSGQFGEVWLGKWNGSTKVAVKTIKEGSMSPEAFLREAQIMKKLRHEKLVKLY  267 (468)
T ss_pred             eecHHHHHHHH-Hh--cCCccceEEEEEEcCCCcccceEEeccccChhHHHHHHHHHHhCcccCeEEEE
Confidence            55678888764 22  45678876 888988854      13357789999999999999999999985


No 6  
>KOG3601|consensus
Probab=99.92  E-value=6.1e-26  Score=189.47  Aligned_cols=172  Identities=26%  Similarity=0.367  Sum_probs=148.5

Q ss_pred             CCCcceeecCccCcCCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEec
Q psy3210          69 LGGNEWTAKSWADHENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE  148 (272)
Q Consensus        69 ~~~~g~~P~~~~~~~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~  148 (272)
                      .+.+|++|+|+   .....+.||+|.++|..||++|....+|+||+|.++..     ++.|++|++....|.|+++.+..
T Consensus        42 ~g~~g~~P~Na---i~~~~~~wve~~i~r~~ae~~l~~~~~G~fl~r~s~sS-----Pg~fsgsvr~~d~vqhfkvvrpa  113 (222)
T KOG3601|consen   42 DGPEGFIPKNA---IRMKPHEWVEGLIPRPLAEDLLSKKRDGDFLIRLSESS-----PGDFSGSVRFPDGVQHFKVVRPA  113 (222)
T ss_pred             cCccccCcccc---cccccccceecccccchhhhhhhccCcchhhhhhhhcC-----cccccccccCCCCceeccccccC
Confidence            57799999999   66677899999999999999998899999999999865     59999999999999999999887


Q ss_pred             CCCcceEEeecccccchhhhhhhhhhcccccccccccc-------ccccccceeeeeeeeccCCCCCCCCCccCCCcEEE
Q psy3210         149 MDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLN-------VRLQLPFRQIIAVAEFDFCPTEANQLPLKQGCQVI  221 (272)
Q Consensus       149 ~g~~~~~~i~~~~~F~sL~eLV~~y~~~~L~~~~~~l~-------~~L~~P~~~~~~~alydf~~~~~~ELsl~~Gd~i~  221 (272)
                      .+   +|+++..+ |.++.+|++||.+++...+.+...       .++..|.....+.|+|||.+.++.|+.|++||+|+
T Consensus       114 ~~---k~~lw~sk-fnslnplv~Y~rt~s~~r~~qi~l~d~~~~~~~~~~~~~~~yqQa~~df~~~pp~ql~f~~gq~~~  189 (222)
T KOG3601|consen  114 FG---KYFLWSSK-FNSLNPLVSYHRTASQSRNQQIFLRDMEPPPAPLPPAPTNYYQQALYDFQPQPPGQLAFRRGQQIQ  189 (222)
T ss_pred             cc---ccccchhh-ccCCCCCcccCcccccccceeeeecccccccccCCCCccchhhhhcCCCCCCCchhhccccCCcce
Confidence            76   89998765 999999999999988765433221       22344455677899999999999999999999999


Q ss_pred             EeeeeCCcCCeEEEEeCCeeeeeeccchhhhhh
Q psy3210         222 VLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRL  254 (272)
Q Consensus       222 v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~  254 (272)
                      |+++.+  .-||.|...|+.|+||++||..+.+
T Consensus       190 v~~~ss--~~ww~Gs~lg~agiFpagyv~p~d~  220 (222)
T KOG3601|consen  190 VLDSSS--PFWWFGSKLGRAGIFPAGYVAPSDL  220 (222)
T ss_pred             eecCCC--cchhhccccCceeeecCcccccccc
Confidence            998877  6799999999999999999986543


No 7  
>smart00252 SH2 Src homology 2 domains. Src homology 2 domains bind phosphotyrosine-containing polypeptides via 2 surface pockets. Specificity is provided via interaction with residues that are distinct from the phosphotyrosine. Only a single occurrence of a SH2 domain has been found in S. cerevisiae.
Probab=99.84  E-value=8.3e-21  Score=140.20  Aligned_cols=83  Identities=37%  Similarity=0.650  Sum_probs=75.1

Q ss_pred             ccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhh
Q psy3210          88 YLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIV  167 (272)
Q Consensus        88 ~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~  167 (272)
                      ++||||.|+|++||++|.+.++|+||||.|++.     ++.|+||++.++.++|++|...+++   .|++.....|+||.
T Consensus         1 ~~w~~g~i~r~~Ae~lL~~~~~G~FLvR~s~~~-----~~~~~Lsv~~~~~~~h~~I~~~~~~---~~~l~~~~~F~sl~   72 (84)
T smart00252        1 QPWYHGFISREEAEKLLKNEGDGDFLVRDSESE-----PGDYVLSVRVKGKVKHYRIRRNEDG---KFYLDGGRKFPSLV   72 (84)
T ss_pred             CCeecccCCHHHHHHHHhcCCCcEEEEEcCCCC-----CCCEEEEEEECCEEEEEEEEECCCC---cEEECCCCccCCHH
Confidence            489999999999999999888999999999743     5899999999999999999988755   79998877899999


Q ss_pred             hhhhhhhcccc
Q psy3210         168 ELICCYERNSL  178 (272)
Q Consensus       168 eLV~~y~~~~L  178 (272)
                      |||+||+.+++
T Consensus        73 eLI~~y~~~~~   83 (84)
T smart00252       73 ELVEHYQKNSL   83 (84)
T ss_pred             HHHHHHhhCCC
Confidence            99999998874


No 8  
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr). SH2 domains typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites.
Probab=99.84  E-value=1.2e-20  Score=141.82  Aligned_cols=94  Identities=37%  Similarity=0.658  Sum_probs=79.9

Q ss_pred             cEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhhh
Q psy3210          89 LWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIVE  168 (272)
Q Consensus        89 ~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~e  168 (272)
                      +||||.|+|++||++|...++|+||||.|++     .++.|+||++.+++++|++|...+++   .+.......|+||.|
T Consensus         1 ~w~~g~i~r~~Ae~~L~~~~~G~FLiR~s~~-----~~~~~~Lsv~~~~~v~H~~I~~~~~~---~~~~~~~~~f~sl~e   72 (94)
T cd00173           1 PWYHGPISREEAEELLKKKPDGTFLVRDSES-----SPGDYVLSVRVKGKVKHYRIERTDDG---YYLLGEGRSFPSLPE   72 (94)
T ss_pred             CccccCCCHHHHHHHHhcCCCceEEEEecCC-----CCCCEEEEEEECCEEEEEEEEECCCC---eEEecCCCccCCHHH
Confidence            6999999999999999988999999999974     35899999999999999999998775   444443668999999


Q ss_pred             hhhhhhccccccccccccccccccc
Q psy3210         169 LICCYERNSLIENFIGLNVRLQLPF  193 (272)
Q Consensus       169 LV~~y~~~~L~~~~~~l~~~L~~P~  193 (272)
                      ||+||+.+++   ...+...|..|+
T Consensus        73 Lv~~y~~~~~---~~~~~~~L~~p~   94 (94)
T cd00173          73 LIEHYQKNPL---SDGLGVKLRYPV   94 (94)
T ss_pred             HHHHHhhCcc---CCCcccEeCCcC
Confidence            9999999986   245667777664


No 9  
>PF00017 SH2:  SH2 domain;  InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps []. Similar sequences were later found in many other intracellular signal-transducing proteins []. SH2 domains function as regulatory modules of intracellular signalling cascades by interacting with high affinity to phosphotyrosine-containing target peptides in a sequence-specific, SH2 domains recognise between 3-6 residues C-terminal to the phosphorylated tyrosine in a fashion that differs from one SH2 domain to another, and strictly phosphorylation-dependent manner [, , , ]. They are found in a wide variety of protein contexts e.g., in association with catalytic domains of phospholipase Cy (PLCy) and the non-receptor protein tyrosine kinases; within structural proteins such as fodrin and tensin; and in a group of small adaptor molecules, i.e Crk and Nck. The domains are frequently found as repeats in a single protein sequence and will then often bind both mono- and di-phosphorylated substrates.  The structure of the SH2 domain belongs to the alpha+beta class, its overall shape forming a compact flattened hemisphere. The core structural elements comprise a central hydrophobic anti-parallel beta-sheet, flanked by 2 short alpha-helices. The loop between strands 2 and 3 provides many of the binding interactions with the phosphate group of its phosphopeptide ligand, and is hence designated the phosphate binding loop, the phosphorylated ligand binds perpendicular to the beta-sheet and typically interacts with the phosphate binding loop and a hydrophobic binding pocket that interacts with a pY+3 side chain. The N- and C-termini of the domain are close together in space and on the opposite face from the phosphopeptide binding surface and it has been speculated that this has facilitated their integration into surface-exposed regions of host proteins [].; GO: 0005515 protein binding; PDB: 1M27_A 1KA6_A 1D4W_B 1D4T_A 1D1Z_B 1KA7_A 1UUR_A 1UUS_A 1BLJ_A 1BLK_A ....
Probab=99.82  E-value=4.5e-20  Score=134.10  Aligned_cols=76  Identities=38%  Similarity=0.681  Sum_probs=70.6

Q ss_pred             EeeeeCCHHHHHHhccc-CCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhhh
Q psy3210          90 WFVGEMGREKATSLLER-EADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIVE  168 (272)
Q Consensus        90 Wf~g~isR~~Ae~lL~~-~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~e  168 (272)
                      ||||.|+|++||++|.. .++|+||||.|.+.     ++.|+||++.+++|+|++|...+++   .|++.+...|+||.+
T Consensus         1 W~~g~isr~~Ae~~L~~~~~~G~FLvR~s~~~-----~~~~~Lsv~~~~~v~h~~I~~~~~~---~~~~~~~~~F~sl~~   72 (77)
T PF00017_consen    1 WFHGFISRQEAERLLMQGKPDGTFLVRPSSSK-----PGKYVLSVRFDGKVKHFRINRTENG---GYFLSDGKKFPSLSD   72 (77)
T ss_dssp             TBEESSHHHHHHHHHHTTSSTTEEEEEEESSS-----TTSEEEEEEETTEEEEEEEEEETTS---EEESSTSSEBSSHHH
T ss_pred             CcCCCCCHHHHHHHHHhcCCCCeEEEEecccc-----ccccccccccccccEEEEEEecCCc---eEEccCCCcCCCHHH
Confidence            99999999999999998 89999999999743     5889999999999999999999886   789988888999999


Q ss_pred             hhhhh
Q psy3210         169 LICCY  173 (272)
Q Consensus       169 LV~~y  173 (272)
                      ||+||
T Consensus        73 LV~~y   77 (77)
T PF00017_consen   73 LVEHY   77 (77)
T ss_dssp             HHHHH
T ss_pred             HHHhC
Confidence            99998


No 10 
>KOG4637|consensus
Probab=99.80  E-value=9.8e-20  Score=162.94  Aligned_cols=103  Identities=30%  Similarity=0.519  Sum_probs=96.0

Q ss_pred             CCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccc
Q psy3210          83 ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRY  162 (272)
Q Consensus        83 ~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~  162 (272)
                      .+|...+||||.|+|+++.+.|.+.+||+||||+-.     +.+|.|+|+++.++.++-++|...++    +|-+.+.-+
T Consensus        18 ~~L~~a~WYWgdisReev~~~L~d~PDGsFlVRdAs-----tm~GdYTLtl~k~g~~KLikI~h~Dg----KyGF~d~lt   88 (464)
T KOG4637|consen   18 DELQDAEWYWGDISREEVNKKLRDQPDGSFLVRDAS-----TMQGDYTLTLRKGGNNKLIKIVHRDG----KYGFSDPLT   88 (464)
T ss_pred             hhhhhccccccccCHHHHHHHhcCCCCCcEEeeccc-----cCCCceEEEEecCCccceeeeEEecC----ccCCCCchh
Confidence            458999999999999999999999999999999885     45799999999999999999999876    788888889


Q ss_pred             cchhhhhhhhhhccccccccccccccccccce
Q psy3210         163 FRSIVELICCYERNSLIENFIGLNVRLQLPFR  194 (272)
Q Consensus       163 F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~  194 (272)
                      |.|+++||+||+..+|+..++.|+.+|.+|+.
T Consensus        89 f~SVVelIn~yr~~SL~~yN~~LDvrLlyPVs  120 (464)
T KOG4637|consen   89 FNSVVELINHYRNESLAQYNPKLDVRLLYPVS  120 (464)
T ss_pred             hHHHHHHHHHHhhhHHHhhCcccceeeechHH
Confidence            99999999999999999999999999999995


No 11 
>KOG0194|consensus
Probab=99.75  E-value=4e-18  Score=161.47  Aligned_cols=162  Identities=24%  Similarity=0.333  Sum_probs=113.4

Q ss_pred             CCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCce-EEEEeeC--CeeeEEEEEEecCCCcceEEeec
Q psy3210          83 ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIY-ALSLKTD--EKVKHMKVYEKEMDGVPQYFLSQ  159 (272)
Q Consensus        83 ~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y-~LSv~~~--~~v~H~~I~~~~~g~~~~~~i~~  159 (272)
                      ..+..++||||.+.|++|+.+|.+  +|+||||.++..+  .....+ .||++..  ..++||.|.+.++    +++...
T Consensus        44 ~~~~~~~~yHG~l~red~~~lL~~--~GDfLvR~s~~~~--~~~~~~~vlSv~~~~~~~~~h~vi~~~~~----~~~~~~  115 (474)
T KOG0194|consen   44 KDLRELPYYHGLLPREDAEKLLKN--DGDFLVRASEPKE--GEKREFVVLSVKWSVFKKIKHYVIKRNGN----LFFFEG  115 (474)
T ss_pred             hHhhcCccccccccHhHHHHHhCC--CCceEEEeecccC--CcceeEEEEEEEeecCCceeEEEEEEcCC----eeEEec
Confidence            455668999999999999999987  6999999998652  223334 9999985  7899999998766    677777


Q ss_pred             ccccchhhhhhhhhhccccccccccccccccccceeeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCC
Q psy3210         160 SRYFRSIVELICCYERNSLIENFIGLNVRLQLPFRQIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDE  239 (272)
Q Consensus       160 ~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g  239 (272)
                      ...|+++.+||.||+.+.+....  ....|..|+.+..       |...++++.+.+   ...-+.||+   .|.|+..-
T Consensus       116 ~~~F~si~~li~~~~~~~~~~~~--~~~~L~~PI~r~~-------Wel~H~~v~l~k---kLGeGaFGe---V~~G~l~~  180 (474)
T KOG0194|consen  116 LRKFPTISELVNYYKFSKLEITG--KNFFLKRPIPRQK-------WELSHSDIELGK---KLGEGAFGE---VFKGKLKL  180 (474)
T ss_pred             cccCCcHHHHHHHHHhcccceec--cceeecccccccc-------cEEeccCccccc---eeecccccE---EEEEEEEe
Confidence            77899999999999988854332  2335777775421       222345544431   112234443   56665531


Q ss_pred             ee-------------e---e---eeccchhhhhhhccCCCCCcccce
Q psy3210         240 RV-------------S---Y---FFQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       240 ~~-------------G---~---fP~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +.             |   .   --.+|+.||++|++|+|+|||||-
T Consensus       181 ~~~~~~~~VAvK~~k~~~~~~~~~~~e~m~EArvMr~l~H~NVVr~y  227 (474)
T KOG0194|consen  181 KNGFKVVPVAVKTTKGSSELTKEQIKEFMKEARVMRQLNHPNVVRFY  227 (474)
T ss_pred             cCCceeeeeEEEeecccccccHHHHHHHHHHHHHHHhCCCCCEEEEE
Confidence            11             1   0   013689999999999999999983


No 12 
>KOG4226|consensus
Probab=99.69  E-value=1e-16  Score=138.77  Aligned_cols=88  Identities=25%  Similarity=0.469  Sum_probs=77.2

Q ss_pred             cccccEeeeeCCHHHHHHhcc-cCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeeccccc
Q psy3210          85 LSEYLWFVGEMGREKATSLLE-READGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYF  163 (272)
Q Consensus        85 l~~~~Wf~g~isR~~Ae~lL~-~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F  163 (272)
                      +...+||+|+|+|.+||.+|. ...+|+||||+|++     +++.|++|++..++-+||+|...++    .|.|+.. .|
T Consensus       278 ~ag~~WYyG~itR~qae~~Ln~hG~eGdFLiRDSEs-----npgD~SvSlka~grNKHFkVq~~d~----~ycIGqR-kF  347 (379)
T KOG4226|consen  278 FAGRPWYYGNITRHQAECALNEHGHEGDFLIRDSES-----NPGDFSVSLKASGRNKHFKVQLVDN----VYCIGQR-KF  347 (379)
T ss_pred             ccCCcceeccccHHHHHHHHhccCccCceEEecCCC-----CCcceeEEeeccCCCcceEEEEecc----eEEeccc-ee
Confidence            566799999999999999995 45789999999975     4699999999999999999988766    7999876 49


Q ss_pred             chhhhhhhhhhcccccccc
Q psy3210         164 RSIVELICCYERNSLIENF  182 (272)
Q Consensus       164 ~sL~eLV~~y~~~~L~~~~  182 (272)
                      .++.+||+||++.++..+-
T Consensus       348 ~tmd~Lv~HY~kaPIfts~  366 (379)
T KOG4226|consen  348 HTMDELVEHYKKAPIFTSE  366 (379)
T ss_pred             ccHHHHHHhhhcCCceecC
Confidence            9999999999999875443


No 13 
>KOG0790|consensus
Probab=99.61  E-value=7.9e-16  Score=141.18  Aligned_cols=106  Identities=28%  Similarity=0.522  Sum_probs=88.6

Q ss_pred             ecCccCcCCcccccEeeeeCCHHHHHHhcc-cCCCceEEEEeCCCCCCCCCCCceEEEEeeCC---------eeeEEEEE
Q psy3210          76 AKSWADHENLSEYLWFVGEMGREKATSLLE-READGTYLLRIRPQGPTHPNETIYALSLKTDE---------KVKHMKVY  145 (272)
Q Consensus        76 P~~~~~~~~l~~~~Wf~g~isR~~Ae~lL~-~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~---------~v~H~~I~  145 (272)
                      |-++|+   ...+.||||+++-.+||.||. ...+|+||||+|.+.     +|.|+||++.+.         +|.|+.|.
T Consensus       101 pl~cAd---ptserWfHG~LsgkeAekLl~ekgk~gsfLvReSqs~-----PGdfVlSvrTdd~~~~~~~~~kVtHvmI~  172 (600)
T KOG0790|consen  101 PLNCAD---PTSERWFHGHLSGKEAEKLLQEKGKHGSFLVRESQSH-----PGDFVLSVRTDDKKESNDSKLKVTHVMIR  172 (600)
T ss_pred             CCccCC---chhhhhhccCCCchhHHHHHHhcCCCccEEEeccccC-----CCceEEEEEcCCcccCCCCccceEEEEEE
Confidence            667743   456779999999999999994 457899999999854     699999999975         89999999


Q ss_pred             EecCCCcceEEeecccccchhhhhhhhhhccccccccccccccccccce
Q psy3210         146 EKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFR  194 (272)
Q Consensus       146 ~~~~g~~~~~~i~~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~  194 (272)
                      ..+.    +|-+++...|.||.+||+||+++++.|.. +--..|.+|+.
T Consensus       173 ~q~~----kydVGgge~F~sltdLidhykknpmvEt~-gtvv~LrqP~n  216 (600)
T KOG0790|consen  173 CQEG----KYDVGGGERFDSLTDLVEHYKKNPMVETL-GTVVYLRQPLN  216 (600)
T ss_pred             eccc----ccccCCccccchHHHHHHHhccCchhhhc-ceeEEeecccc
Confidence            9764    89999999999999999999999987652 33456677764


No 14 
>KOG4637|consensus
Probab=99.56  E-value=2.9e-15  Score=134.44  Aligned_cols=97  Identities=31%  Similarity=0.497  Sum_probs=87.0

Q ss_pred             ccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhh
Q psy3210          88 YLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIV  167 (272)
Q Consensus        88 ~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~  167 (272)
                      ..|+.+.+.|..||++|+..++|+||||.|.      +.|.|+|||..++.|+|+.|.+...|   +-|-.....+.||.
T Consensus       332 ~~w~~~~a~r~kAe~llrg~~dGtFLIR~ss------~~g~yalSV~~~~~V~HClIy~tatG---~GFa~pyn~y~tlk  402 (464)
T KOG4637|consen  332 KTWRVRDANRDKAEELLRGKPDGTFLIRESS------KGGCYALSVVHDGEVKHCLIYQTATG---FGFAEPYNLYSTLK  402 (464)
T ss_pred             hHhHHhhhhHHHHHHHhcCCCCCeEEEeecc------CCCceEEEEEECCceeeeEEeecccc---ccccchhHHHHHHH
Confidence            4799999999999999999999999999974      45999999999999999999999887   22333344789999


Q ss_pred             hhhhhhhccccccccccccccccccc
Q psy3210         168 ELICCYERNSLIENFIGLNVRLQLPF  193 (272)
Q Consensus       168 eLV~~y~~~~L~~~~~~l~~~L~~P~  193 (272)
                      +||.||++++|.+..+.+.++|.+|+
T Consensus       403 ~lV~hY~h~SLe~HnDal~ttLr~Pv  428 (464)
T KOG4637|consen  403 ELVLHYQHTSLEQHNDALTTTLRYPV  428 (464)
T ss_pred             HHHHHHhhhhHHhhccccccccccce
Confidence            99999999999999999999999998


No 15 
>KOG1264|consensus
Probab=99.51  E-value=3.6e-14  Score=137.85  Aligned_cols=105  Identities=30%  Similarity=0.454  Sum_probs=87.8

Q ss_pred             CCcccccEeeeeCC-HHHHHHhccc------CCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceE
Q psy3210          83 ENLSEYLWFVGEMG-REKATSLLER------EADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQY  155 (272)
Q Consensus        83 ~~l~~~~Wf~g~is-R~~Ae~lL~~------~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~  155 (272)
                      .-+-.+.||||.+. |.+|+++|++      .+||+||||+|+     +..|.|+||+..+++|.|++|.....++..+|
T Consensus       529 ElH~~E~WFHgkle~R~eAekll~eycke~G~~dGtFlVReS~-----tFvgDytLSfwr~grv~HcRIrsk~e~gt~Ky  603 (1267)
T KOG1264|consen  529 ELHFGEKWFHGKLEGRTEAEKLLQEYCKETGGKDGTFLVRESE-----TFVGDYTLSFWRSGRVQHCRIRSKMEGGTLKY  603 (1267)
T ss_pred             hhccchhhhhcccccchHHHHHHHHHHHHhCCCCccEEEeecc-----ccccceeeeeeECCceeeEEEEeeecCCceeE
Confidence            33456799999998 9999999963      359999999995     78899999999999999999998766555689


Q ss_pred             Eeecccccchhhhhhhhhhccccccccccccccccccce
Q psy3210         156 FLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFR  194 (272)
Q Consensus       156 ~i~~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~  194 (272)
                      ++.++..|+||.+||.||+.+.|...  .....|+.|++
T Consensus       604 yl~dN~vfdslY~LI~~Y~~~~Lr~a--eF~m~LtePvP  640 (1267)
T KOG1264|consen  604 YLTDNLVFDSLYALIQHYRETHLRCA--EFEMRLTEPVP  640 (1267)
T ss_pred             EEecchhHHHHHHHHHHHHhcccccc--ceEEEecCCCC
Confidence            99999999999999999999987422  23456676764


No 16 
>PF14604 SH3_9:  Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A ....
Probab=99.49  E-value=4.6e-14  Score=93.68  Aligned_cols=49  Identities=31%  Similarity=0.639  Sum_probs=43.9

Q ss_pred             eeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchh
Q psy3210         200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWG  250 (272)
Q Consensus       200 alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVe  250 (272)
                      |+|||.+.+.+||+|.+||+|.|+.+.+  .|||.|+.+|+.|+||++||+
T Consensus         1 Al~~y~~~~~dELs~~~Gd~i~v~~~~~--~~W~~g~~~g~~G~~P~~yV~   49 (49)
T PF14604_consen    1 ALYDYEAQDPDELSFKKGDVITVLEKSD--DGWWYGRNTGRTGLFPANYVE   49 (49)
T ss_dssp             ESSCBCSSSTTB-EB-TTEEEEEEEESS--TSEEEEEETTEEEEEEGGGEE
T ss_pred             CCccCCCCCcCEeeEcCCCEEEEEEeCC--CCEEEEEECCEEEEECHHhCC
Confidence            6899999999999999999999998766  689999999999999999986


No 17 
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=99.31  E-value=3.4e-12  Score=86.68  Aligned_cols=53  Identities=30%  Similarity=0.636  Sum_probs=46.2

Q ss_pred             eeeeccCCCCCCCCCccCCCcEEEEe-eeeCCcCCeEEEEeCCeeeeeeccchhhh
Q psy3210         198 AVAEFDFCPTEANQLPLKQGCQVIVL-SKEGEQKGWWKGKIDERVSYFFQLYWGNF  252 (272)
Q Consensus       198 ~~alydf~~~~~~ELsl~~Gd~i~v~-~k~ge~~gwW~G~~~g~~G~fP~~yVeE~  252 (272)
                      ++|++||.+..+++|+|.+||+|.|+ ++..  .+||.|+.+|+.|+||++||+++
T Consensus         2 ~~a~~d~~~~~~~~Ls~~~Gd~i~v~~~~~~--~~ww~~~~~g~~G~~P~~~v~~~   55 (55)
T PF07653_consen    2 YRAIFDYVAEDPDELSFKKGDVIEVLGEKDD--DGWWLGENNGRRGWFPSSYVEEI   55 (55)
T ss_dssp             EEESSSBESSSTTB-EB-TTEEEEEEEEECS--TSEEEEEETTEEEEEEGGGEEEH
T ss_pred             EEEeEEECCCCCCceEEecCCEEEEEEeecC--CCEEEEEECCcEEEEcHHHEEEC
Confidence            68999999999999999999999999 5554  58999999999999999999874


No 18 
>KOG2070|consensus
Probab=99.24  E-value=4.9e-12  Score=117.51  Aligned_cols=61  Identities=25%  Similarity=0.547  Sum_probs=55.0

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhhccCC
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLLSSLF  259 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~mk~l~  259 (272)
                      .|+|.|+|.+...|||+|.+||+|+|....+  .|||.|+.+|++||||+|||.|++.-+.|.
T Consensus        19 vvrAkf~F~gsNnDELsf~KgDvItVTq~ee--GGWWEGTlng~TGWFPsnYV~eik~e~pLs   79 (661)
T KOG2070|consen   19 VVRAKFNFQGSNNDELSFSKGDVITVTQVEE--GGWWEGTLNGRTGWFPSNYVREIKSEKPLS   79 (661)
T ss_pred             EEEEEeecccCCCceeccccCCEEEEEEecc--CcceeccccCccCccchHHHHHHhhcCCCC
Confidence            5889999999999999999999999997665  689999999999999999999998655553


No 19 
>KOG2199|consensus
Probab=99.23  E-value=2.4e-12  Score=116.92  Aligned_cols=54  Identities=28%  Similarity=0.487  Sum_probs=50.2

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWG  250 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVe  250 (272)
                      ...|+|||||++.+.+||+|++||||+|+...+  .+||+|.+.+..|+||+|||.
T Consensus       215 ~rkVRALYDFeAaE~nELsFkaGdIItVLd~s~--~~WWKG~~~~~~GlFPsnfVT  268 (462)
T KOG2199|consen  215 VRKVRALYDFEAAEDNELSFKAGDIITVLDDSD--PNWWKGENHRGIGLFPSNFVT  268 (462)
T ss_pred             chhhhhhhcccccCCCccceecCcEEEEcccCC--cchhccccCCcccccchhhhh
Confidence            346899999999999999999999999998777  789999999999999999997


No 20 
>KOG1118|consensus
Probab=99.11  E-value=2.3e-11  Score=107.32  Aligned_cols=60  Identities=22%  Similarity=0.360  Sum_probs=54.9

Q ss_pred             eeeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhh
Q psy3210         194 RQIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLL  255 (272)
Q Consensus       194 ~~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~m  255 (272)
                      ....++|+|||+++...||.|++||+|++++++|  ++||.|+..|..||||.|||+.+-.+
T Consensus       305 ~~p~cralYdFepenEgEL~fkeGDlI~l~~QId--enWyeG~~~g~sG~FPvnYv~vlvpl  364 (366)
T KOG1118|consen  305 DQPCCRALYDFEPENEGELDFKEGDLITLTNQID--ENWYEGEKHGESGMFPVNYVEVLVPL  364 (366)
T ss_pred             cchhheeeeccCCCCCCccCcccCceeeehhhcC--cchhhheecCccCccccceeEEeccC
Confidence            4556899999999999999999999999999999  67999999999999999999976554


No 21 
>PF00018 SH3_1:  SH3 domain;  InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. The crystal structure of the SH3 domain of the cytoskeletal protein spectrin, and the solution structures of SH3 domains of phospholipase C (PLC-y) and phosphatidylinositol 3-kinase p85 alpha-subunit, have been determined [, , ]. In spite of relatively limited sequence similarity, their overall structures are similar. The domains belong to the alpha+beta structural class, with 5 to 8 beta-strands forming 2 tightly-packed, anti-parallel beta-sheets arranged in a barrel-like structure, and intervening loops sometimes forming helices. Conserved aliphatic and aromatic residues form a hydrophobic core (A11, L23, A29, V34, W42, L52 and V59 in PLC-y []) and a hydrophobic pocket on the molecular surface (L12, F13, W53 and P55 in PLC-y). The conserved core is believed to stabilise the fold, while the pocket is thought to serve as a binding site for target proteins. Conserved carboxylic amino acids located in the loops, on the periphery of the pocket (D14 and E22), may be involved in protein-protein interactions via proline-rich regions. The N- and C-termini are packed in close proximity, indicating that they are independent structural modules.; GO: 0005515 protein binding; PDB: 1UHF_A 1W1F_A 1WA7_A 1SEM_A 1KFZ_A 2SEM_B 1K76_A 3SEM_B 1X2Q_A 2J06_B ....
Probab=99.10  E-value=1.6e-10  Score=76.13  Aligned_cols=46  Identities=28%  Similarity=0.590  Sum_probs=41.4

Q ss_pred             eeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC--Ceeeeeec
Q psy3210         199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID--ERVSYFFQ  246 (272)
Q Consensus       199 ~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~--g~~G~fP~  246 (272)
                      +|+|||.+...+||+|++||+|.|+++.+  .+||.++..  ++.|+||+
T Consensus         1 ~Alydf~~~~~~eLs~~~Gd~i~v~~~~~--~~Ww~~~~~~~~~~G~vP~   48 (48)
T PF00018_consen    1 RALYDFDAEDPDELSFKKGDIIEVLEKSD--DGWWKVRNESTGKEGWVPS   48 (48)
T ss_dssp             EESSCBETSSTTBSEB-TTEEEEEEEESS--SSEEEEEETTTTEEEEEEG
T ss_pred             CCCeeeCCCCCCEEeEECCCEEEEEEecC--CCEEEEEECCCCcEEEeeC
Confidence            58999999999999999999999998887  589999987  69999996


No 22 
>KOG4348|consensus
Probab=99.02  E-value=4.4e-11  Score=109.81  Aligned_cols=59  Identities=29%  Similarity=0.597  Sum_probs=53.5

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLL  255 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~m  255 (272)
                      ++.+++.|.|.++..|||+|..||+|++++...  +|||+|..+|..||||+|||+|...-
T Consensus       100 ~r~c~v~f~Y~pqndDELelkVGDiIeli~eVE--eGWw~G~Lngk~GmFPsNFVkel~~~  158 (627)
T KOG4348|consen  100 ARICVVTFAYSPQNDDELELKVGDIIELISEVE--EGWWKGKLNGKVGMFPSNFVKELPTP  158 (627)
T ss_pred             ceeEEEEEeecCCCCceeeeeeccHHHhhhHhh--hhhhhceecCcccccchhhceecCCC
Confidence            457889999999999999999999999998776  68999999999999999999986543


No 23 
>smart00326 SH3 Src homology 3 domains. Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
Probab=98.97  E-value=9.3e-10  Score=74.07  Aligned_cols=53  Identities=28%  Similarity=0.633  Sum_probs=48.2

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGN  251 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE  251 (272)
                      .++|+|||.+...++|+|.+||.|.++++.+  .|||.++.. ++.|+||.+||++
T Consensus         4 ~~~a~~~~~~~~~~~l~~~~Gd~v~v~~~~~--~~w~~~~~~~~~~G~vP~~~v~~   57 (58)
T smart00326        4 QVRALYDYTAQDPDELSFKKGDIITVLEKSD--DGWWKGRLGRGKEGLFPSNYVEE   57 (58)
T ss_pred             EEEEeeeeCCCCCCCCCCCCCCEEEEEEcCC--CCeEEEEeCCCCEEEEchHHEEE
Confidence            5789999999999999999999999998765  689999988 9999999999875


No 24 
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies.
Probab=98.96  E-value=1.4e-09  Score=72.31  Aligned_cols=52  Identities=27%  Similarity=0.586  Sum_probs=46.7

Q ss_pred             eeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCC-eeeeeeccchhh
Q psy3210         198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDE-RVSYFFQLYWGN  251 (272)
Q Consensus       198 ~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g-~~G~fP~~yVeE  251 (272)
                      ++|+|||.+...+||+|.+||.|.+++..+  .|||.++..+ +.|+||.+||++
T Consensus         2 ~~a~~~~~~~~~~~l~~~~Gd~v~v~~~~~--~~w~~~~~~~~~~G~vP~~~v~~   54 (54)
T cd00174           2 VRALYDYDARDPDELSFKKGDIIEVLEKSD--DGWWEGRLLGGKRGLFPSNYVEE   54 (54)
T ss_pred             EEEEEeeCCCCCCCCCCCCCCEEEEEEcCC--CCeEEEEECCCCEEEEccccCcC
Confidence            578999999999999999999999998754  6899999876 999999999873


No 25 
>KOG0790|consensus
Probab=98.96  E-value=7.2e-10  Score=102.40  Aligned_cols=97  Identities=28%  Similarity=0.471  Sum_probs=80.6

Q ss_pred             cccEeeeeCCHHHHHHhccc-CCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccch
Q psy3210          87 EYLWFVGEMGREKATSLLER-EADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRS  165 (272)
Q Consensus        87 ~~~Wf~g~isR~~Ae~lL~~-~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~s  165 (272)
                      ...|||..++-.+||.+|+. ..+|+||.|.|+     ++++.|+||++.+++|.|++|....+    .|.+.+...|.+
T Consensus         3 s~~wfh~~~~g~~ae~Ll~~~g~dgsfl~r~s~-----sNp~~fsl~~r~~~~v~hikiq~~~~----~~~l~~gekfat   73 (600)
T KOG0790|consen    3 SRRWFHPDLSGVEAETLLKERGVDGSFLARPSE-----SNPGDFSLSVRRGDKVTHIKIQNSGD----FYDLYGGEKFAT   73 (600)
T ss_pred             chhhcCCCccchhHHHHHHHhccccchhhcccc-----CCCcceeEEEEeCCceEEEEEeecCc----cccccCCccccc
Confidence            35799999999999999986 578999999997     45799999999999999999988765    688888888999


Q ss_pred             hhhhhhhhhccc--cccccccccccccccc
Q psy3210         166 IVELICCYERNS--LIENFIGLNVRLQLPF  193 (272)
Q Consensus       166 L~eLV~~y~~~~--L~~~~~~l~~~L~~P~  193 (272)
                      +.|||+||+.+.  |.+. .+.-..|.+|.
T Consensus        74 ~~ELvqyyme~~~~lkek-ng~~ielK~pl  102 (600)
T KOG0790|consen   74 LAELVQYYMEHHGQLKEK-NGDVIELKYPL  102 (600)
T ss_pred             hHHHHHHHHhhhHHHHhc-CCCEEEecCCC
Confidence            999999998766  3332 34445666665


No 26 
>KOG1930|consensus
Probab=98.96  E-value=6.4e-10  Score=101.81  Aligned_cols=94  Identities=26%  Similarity=0.403  Sum_probs=77.3

Q ss_pred             ccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeC---------------CeeeEEEEEEecCC
Q psy3210          86 SEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTD---------------EKVKHMKVYEKEMD  150 (272)
Q Consensus        86 ~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~---------------~~v~H~~I~~~~~g  150 (272)
                      ...-||..+|+|++|-.||++++.|+|+||+|.     +.+|.|-|.++..               ..|+||.|+....|
T Consensus       210 TSKyWYKP~isREQAIalLrdkePGtFvvRDS~-----SfrGayGLAlKVstPPPs~~~~~g~~~neLVRHFLIE~spkG  284 (483)
T KOG1930|consen  210 TSKYWYKPNISREQAIALLRDKEPGTFVVRDSH-----SFRGAYGLALKVSTPPPSVQPGDGSDSNELVRHFLIEPSPKG  284 (483)
T ss_pred             ccccccCCCCCHHHHHHHhhcCCCCeEEEecCC-----cCCCccceEEEeccCCCcccCCCCCchhhhhhhheeccCCCc
Confidence            345799999999999999999999999999995     7789999998872               35999999987764


Q ss_pred             CcceEEeec---ccccchhhhhhhhhhccccccccccccccccccc
Q psy3210         151 GVPQYFLSQ---SRYFRSIVELICCYERNSLIENFIGLNVRLQLPF  193 (272)
Q Consensus       151 ~~~~~~i~~---~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~  193 (272)
                          ..|.+   ...|.||..||--|.-.+|     .|++.|..|-
T Consensus       285 ----VkLKGC~nEP~FGSLSALV~QHSIt~L-----ALPckL~iP~  321 (483)
T KOG1930|consen  285 ----VKLKGCDNEPVFGSLSALVYQHSITAL-----ALPCKLVIPD  321 (483)
T ss_pred             ----eeccCCCCCCccchhHHHHhhccchhh-----hcceeEeccC
Confidence                55533   4489999999999988886     4666666554


No 27 
>KOG1029|consensus
Probab=98.95  E-value=2.5e-10  Score=110.99  Aligned_cols=52  Identities=25%  Similarity=0.547  Sum_probs=49.3

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWG  250 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVe  250 (272)
                      .++|+|||.++..|||+|.+||+|.|+++.+  ..||.|+.+|..|+||+|||.
T Consensus      1055 qviamYdY~AqndDELsF~kgdiI~Vlnkde--peWW~Ge~ng~sGLFPSNYV~ 1106 (1118)
T KOG1029|consen 1055 QVIAMYDYEAQNDDELSFKKGDIINVLNKDE--PEWWSGERNGKSGLFPSNYVQ 1106 (1118)
T ss_pred             eeEEeeccccCCcccccccCCCEEEecCCCC--hhhhcccccCccccCcccccc
Confidence            4789999999999999999999999999988  679999999999999999995


No 28 
>KOG2856|consensus
Probab=98.94  E-value=1.9e-10  Score=103.67  Aligned_cols=56  Identities=30%  Similarity=0.569  Sum_probs=51.6

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGNF  252 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE~  252 (272)
                      ..|+|||||.+++.|||+|++||.++++...++ .||.+|+.. |++|++|+|||+-+
T Consensus       415 v~vraLYDY~gqE~DElsfkaGd~l~kl~eeDe-qGWC~Grl~~G~vGLyPAnYVe~~  471 (472)
T KOG2856|consen  415 VRVRALYDYAGQEGDELSFKAGDELEKLEEEDE-QGWCKGRLDSGRVGLYPANYVECI  471 (472)
T ss_pred             eeEEeeeccCcccccchhhccccHhhhcCCccc-cccccccccCCcccccchhhhhcc
Confidence            468999999999999999999999999987777 799999998 99999999999854


No 29 
>KOG4226|consensus
Probab=98.91  E-value=9.5e-10  Score=95.83  Aligned_cols=57  Identities=28%  Similarity=0.599  Sum_probs=51.2

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLL  255 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~m  255 (272)
                      .+..-|.|.++..|||+|.+|+.|.|..|-.  .|||+|..+|.+||||+|||.|.---
T Consensus       109 ~AvVKf~Y~a~~eDELsLtKGtrv~vmEKss--DGWWrG~~ng~VGWFPSNYv~E~~ds  165 (379)
T KOG4226|consen  109 PAVVKFNYVAEREDELSLTKGTRVTVMEKSS--DGWWRGSYNGQVGWFPSNYVTEEVDS  165 (379)
T ss_pred             ceEEEEeeccccccccccccCcEEEEEEecc--CcceecccCCeeccccccceehhccc
Confidence            3667899999999999999999999999887  68999999999999999999876444


No 30 
>KOG0162|consensus
Probab=98.83  E-value=1.8e-09  Score=104.77  Aligned_cols=56  Identities=21%  Similarity=0.565  Sum_probs=51.2

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNF  252 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~  252 (272)
                      ...+.|+|||.+++.+||+|++||+|+++.+..  .|||.|..+|+.||||.+||+|.
T Consensus      1051 ~p~~~A~Y~y~gq~~dEls~~~~diIei~~edp--SGWw~gk~~~keG~~P~~Yv~~~ 1106 (1106)
T KOG0162|consen 1051 NPVCEALYDYPGQDVDELSFKKGDIIEIMREDP--SGWWLGKLNGKEGLFPGNYVTEY 1106 (1106)
T ss_pred             CcceeeeccCCCCCcccccccCCCEEEEeccCC--CcchhhccCCccccccccccccC
Confidence            356889999999999999999999999997766  79999999999999999999873


No 31 
>KOG4225|consensus
Probab=98.80  E-value=3.3e-09  Score=97.75  Aligned_cols=57  Identities=30%  Similarity=0.470  Sum_probs=52.3

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRL  254 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~  254 (272)
                      ..++|+|+|.++...||+|.+||+|.|+.+.+  ..|+.|+.+|+.|+||.+|||.+..
T Consensus       231 ~~aralf~F~~qt~kEL~~~kGDIVyI~rkvD--~nWyeGEhhGr~GifP~sYvE~~~~  287 (489)
T KOG4225|consen  231 RAARALFDFEAQTPKELPFNKGDIVYILRKVD--QNWYEGEHHGRVGIFPASYVEILTP  287 (489)
T ss_pred             chhhheeccccCCccccccCCCCEEEEEeecc--CceeeeeecceecceechheeecCc
Confidence            34889999999999999999999999999888  6799999999999999999996544


No 32 
>KOG4348|consensus
Probab=98.77  E-value=4.1e-09  Score=97.05  Aligned_cols=59  Identities=22%  Similarity=0.534  Sum_probs=52.2

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFR  253 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~  253 (272)
                      +.+++.+|-|+++..|||.|++||+|+++.+.-.+-|||+|+.+|+.|.||.|||+-++
T Consensus       261 Keycrv~F~Ye~qndDELt~KEgdil~lItK~cgdaGWweGELnGk~GvFPDNFv~lv~  319 (627)
T KOG4348|consen  261 KEYCRVKFVYEPQNDDELTLKEGDILILITKNCGDAGWWEGELNGKKGVFPDNFVELVQ  319 (627)
T ss_pred             hhheeeeeeecCCCccceeeccccEEEEecccccccceeeeeecCccccCCchhhhhcC
Confidence            34688999999999999999999999999863333799999999999999999999766


No 33 
>KOG1029|consensus
Probab=98.54  E-value=2.6e-08  Score=97.21  Aligned_cols=58  Identities=22%  Similarity=0.535  Sum_probs=52.4

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhhc
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLLS  256 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~mk  256 (272)
                      ..+.|+|.|.+...++|+|.+||+|+|+.+-+   .||.|++.|++||||.+||+|+.+..
T Consensus       814 lq~iA~y~wrakke~dLsFskgd~I~Vlekqe---mwW~G~v~g~~GwFPksYVk~~~~~t  871 (1118)
T KOG1029|consen  814 LQAIALYPWRAKKENDLSFSKGDTITVLEKQE---MWWFGEVAGEIGWFPKSYVKEVGAIT  871 (1118)
T ss_pred             hhHHhhccccccccccccccCCCeeeeehhcc---ceecccccCccCcCcHHhhhhccccc
Confidence            35789999999999999999999999998776   49999999999999999999887654


No 34 
>KOG3875|consensus
Probab=98.43  E-value=4.7e-08  Score=86.73  Aligned_cols=58  Identities=24%  Similarity=0.232  Sum_probs=50.2

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCc---CCeEEEEeC--Ceeeeeeccchhhhhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQ---KGWWKGKID--ERVSYFFQLYWGNFRL  254 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~---~gwW~G~~~--g~~G~fP~~yVeE~~~  254 (272)
                      +++|+|||.+.++.||+|++||++.|..|.+..   ..||.....  +++|++|.|||+.+.-
T Consensus       270 ~arA~YdF~a~np~ElSlk~Gdml~ia~K~dq~~~~~~gW~lat~dg~~tG~iP~NYvkIi~r  332 (362)
T KOG3875|consen  270 FARALYDFVARNPVELSLKKGDMLAIASKEDQQGVRCEGWLLATRDGGTTGLIPINYVKIIGR  332 (362)
T ss_pred             HHHHHhhhhcCCHHHhhhhcCchhhcccccccCCCCCcceeeeeccCCeeeeeehhhhhhhhc
Confidence            588999999999999999999999999877653   458887764  6899999999998766


No 35 
>KOG4225|consensus
Probab=98.34  E-value=2.8e-07  Score=85.21  Aligned_cols=52  Identities=23%  Similarity=0.449  Sum_probs=48.3

Q ss_pred             eeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEE--EeCCeeeeeeccchhh
Q psy3210         198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKG--KIDERVSYFFQLYWGN  251 (272)
Q Consensus       198 ~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G--~~~g~~G~fP~~yVeE  251 (272)
                      ++|+|.|.++..|||.|.+||+|.|+.|-+  .||+.|  +..|..|.||-|||+.
T Consensus       435 yrAly~Y~pqnedeLEl~egDii~VmeKcd--dgWfvGts~rtg~fGtFPgnyV~~  488 (489)
T KOG4225|consen  435 YRALYSYRPQNEDELELREGDIIDVMEKCD--DGWFVGTSRRTGKFGTFPGNYVKR  488 (489)
T ss_pred             ceeccccCCCCchhheeccCCEEeeeeccc--CcceeccceecccccccCcccccc
Confidence            689999999999999999999999999998  689999  5569999999999984


No 36 
>KOG1843|consensus
Probab=98.31  E-value=2.2e-07  Score=85.24  Aligned_cols=57  Identities=23%  Similarity=0.445  Sum_probs=52.5

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGN  251 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE  251 (272)
                      ...++|+|+|..+...+|+|.+||+|.++++-+....||.|..+++.|+||+|||+-
T Consensus       416 ~n~a~a~ysfage~~GDl~f~kgDii~il~ks~s~~dwwtgr~~~~egifPanyv~~  472 (473)
T KOG1843|consen  416 PNIATALYSFAGEQPGDLSFQKGDIITILKKSDSANDWWTGRGNGYEGIFPANYVSL  472 (473)
T ss_pred             cceeeeeehhccCCCCCcccccCceEEEecCCcchhhHHHhhccccccccccceecc
Confidence            457899999999999999999999999999877768899999999999999999973


No 37 
>KOG3751|consensus
Probab=98.22  E-value=5.3e-07  Score=85.11  Aligned_cols=98  Identities=28%  Similarity=0.501  Sum_probs=76.0

Q ss_pred             CCcccccEeeeeCCHHHHHHhccc--CCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEe-ec
Q psy3210          83 ENLSEYLWFVGEMGREKATSLLER--EADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFL-SQ  159 (272)
Q Consensus        83 ~~l~~~~Wf~g~isR~~Ae~lL~~--~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i-~~  159 (272)
                      ..+..+.||||.|+|+++.++++.  -.+|.||+|+|.+.     +..|++++....+|+||+|.-.++.+. .|+- ..
T Consensus       514 ~~h~sq~~~~~kis~~es~~~ikq~glv~~~~l~r~sqsn-----P~~~~~~~~~~~~v~~~~~~P~~~~~~-~~~t~~~  587 (622)
T KOG3751|consen  514 AIHRSQTWFHGKISRDESQRLIKQQGLVDGLFLVRDSQSN-----PKIFVLSLCHPQKVKHFQILPVEDDGC-TFFTLDD  587 (622)
T ss_pred             hhcccccCcccccCchhhhhHHHhcccceeeeeecccccC-----cchhhhhccCCccccceEEecCCCCCc-eeeccCC
Confidence            345678999999999999998876  35799999999865     577999999999999999987555433 3333 22


Q ss_pred             -ccccchhhhhhhhhhccccccccccccccccc
Q psy3210         160 -SRYFRSIVELICCYERNSLIENFIGLNVRLQL  191 (272)
Q Consensus       160 -~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~  191 (272)
                       ...|.++..|+++|+-+.     ..+++.|..
T Consensus       588 g~t~~sd~~ql~~~~ql~k-----~~l~~al~~  615 (622)
T KOG3751|consen  588 GPTKFSDLIQLVEFYQLNK-----GVLPCALKH  615 (622)
T ss_pred             CCccccccccccchhhcCC-----CcchHHHHH
Confidence             347999999999999885     455555543


No 38 
>KOG3655|consensus
Probab=98.19  E-value=5.2e-07  Score=84.33  Aligned_cols=56  Identities=18%  Similarity=0.407  Sum_probs=50.7

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGNF  252 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE~  252 (272)
                      ...++|+|||++-+..|++|-.+|.|+++...+  .|||.|... |+.|+||+|||+-+
T Consensus       427 ~q~A~A~~dyqAAddtEisf~p~d~it~Id~vd--egww~g~~pdG~~glfPaNyV~li  483 (484)
T KOG3655|consen  427 PQTARALYDYQAADDTEISFDPPDAITLIDQVD--EGWWTGQGPDGEVGLFPANYVELI  483 (484)
T ss_pred             CCCccccccccccCCcccccCCccccccccccC--CccccccCCCCCcCcccccccccC
Confidence            456899999999999999999999999999888  789999975 89999999999854


No 39 
>KOG2546|consensus
Probab=98.17  E-value=9.8e-07  Score=81.40  Aligned_cols=54  Identities=26%  Similarity=0.513  Sum_probs=49.9

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNF  252 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~  252 (272)
                      .++++|||.+...|||+|.+|.+|.|++|.+  .|||+|..+|-.|+||-|||+.+
T Consensus       425 kVv~iydy~~~KddeLsf~E~ailyv~kknd--dgw~EgV~~~VTglFpgnyve~~  478 (483)
T KOG2546|consen  425 KVVAIYDYTADKDDELSFAEGAILYVLKKND--DGWYEGVQDGVTGLFPGNYVEPL  478 (483)
T ss_pred             HHHhhcccccccccccccccccEEEEEEecC--CcchhheecCcceeccCcccccc
Confidence            4789999999999999999999999998866  68999999999999999999954


No 40 
>KOG3697|consensus
Probab=98.11  E-value=3.5e-06  Score=74.26  Aligned_cols=106  Identities=21%  Similarity=0.123  Sum_probs=80.4

Q ss_pred             CCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCC-----------------------------------------
Q psy3210          83 ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGP-----------------------------------------  121 (272)
Q Consensus        83 ~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~-----------------------------------------  121 (272)
                      +.....+||+|++++++++..|.  ++|.|++|.+...|                                         
T Consensus       196 d~p~k~pp~~g~l~~~~~q~~l~--~~a~~~a~~~~~~p~~~~ls~l~~~n~ppp~~p~~kl~~~~~~~n~~~~~~rd~~  273 (345)
T KOG3697|consen  196 DIPSKMPPPGGFLDTRLKQRPLA--PDAAQFAGKEQTYPQGRHLSDLRQGNSPPPSTPEGKLHVAPTYVNTQQIPRRDLF  273 (345)
T ss_pred             cccccCCCCCCccchhhhhccCC--cccchhhhhccCCcccccccchhhcCCCCCCCCCccCCCCcccccccccchhhhc
Confidence            34456799999999999999997  45788877654321                                         


Q ss_pred             -CCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhhhhhhhhhcccccccccccccccccccee
Q psy3210         122 -THPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFRQ  195 (272)
Q Consensus       122 -~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~~  195 (272)
                       ..+.+|.|+|+=..++..||..+.-.++    -.... .+.|+|+..||+|+..+.|+.-..+....|++|+++
T Consensus       274 ~~~~~~gqyvltgl~~~~~khlllvdpeg----vvrtk-d~~fdsishli~yh~~~~lpiis~~sel~l~~pv~r  343 (345)
T KOG3697|consen  274 DETTTPGQYVLTGLQSGQPKHLLLVDPEG----VVRTK-DRRFDSISHLINYHMDNHLPIISAGSELCLQQPVER  343 (345)
T ss_pred             cccCCCccEEEecccCCCcceEEEECCcc----ceecc-cchhhHHHHHHHHhhhccCceecCcchhhhhCcccc
Confidence             0245789999999999999998875543    34433 457999999999999999876666666678888754


No 41 
>KOG0515|consensus
Probab=98.10  E-value=1.1e-06  Score=83.15  Aligned_cols=56  Identities=20%  Similarity=0.478  Sum_probs=50.4

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCc-CCeEEEEeCCeeeeeeccchhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQ-KGWWKGKIDERVSYFFQLYWGN  251 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~-~gwW~G~~~g~~G~fP~~yVeE  251 (272)
                      ..+-|+|||+++..|||+|.+||-++|+.+.|++ ..||-.+.+|+.|++|.||+--
T Consensus       684 G~vYAlwdYeaqf~DELsf~eGd~lTvirr~d~~eteWWwa~lng~eGyVPRnylgL  740 (752)
T KOG0515|consen  684 GVVYALWDYEAQFEDELSFDEGDELTVIRRDDEVETEWWWARLNGEEGYVPRNYLGL  740 (752)
T ss_pred             ceeEEeecccccccccccccCCceeEEEecCCcchhhhhhHhhcCcccccchhhhhc
Confidence            3467999999999999999999999999987776 7799999999999999999863


No 42 
>KOG1702|consensus
Probab=98.07  E-value=2.1e-06  Score=72.12  Aligned_cols=56  Identities=13%  Similarity=0.245  Sum_probs=49.5

Q ss_pred             eeeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC--Ceeeeeeccchhh
Q psy3210         194 RQIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID--ERVSYFFQLYWGN  251 (272)
Q Consensus       194 ~~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~--g~~G~fP~~yVeE  251 (272)
                      ...+.+|.|||.+++.||++|..||.|.....++  .||..|.+.  |..|+.|+||||-
T Consensus       206 ~gktyra~ydysaqdedevsF~dgd~ivnvq~id--dGWmygtv~rtg~tGmlpaNyie~  263 (264)
T KOG1702|consen  206 TGKTYRAFYDYSAQDEDEVSFVDGDYIVNVQSID--DGWMYGTVVRTGWTGMLPANYIEF  263 (264)
T ss_pred             CCccchhhccCcccCcceeEEecCCeEEEEEecc--CCceeeEEEeccccCCCchhheee
Confidence            3457899999999999999999999998888888  679888874  8999999999984


No 43 
>KOG2222|consensus
Probab=98.05  E-value=1.6e-06  Score=81.29  Aligned_cols=56  Identities=16%  Similarity=0.329  Sum_probs=51.2

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFR  253 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~  253 (272)
                      ..++|+.||...+.+||.|+++|+|+++++.+  +..|.|+.+|-.||||+.||+-+.
T Consensus       549 krakal~df~r~dddelgfrkndiitiisekd--ehcwvgelnglrgwfpakfvelld  604 (848)
T KOG2222|consen  549 KRAKALHDFAREDDDELGFRKNDIITIISEKD--EHCWVGELNGLRGWFPAKFVELLD  604 (848)
T ss_pred             HHHHHHhhhhhccccccccccccEEEEeecCC--cceeeeccccccccchHHHHHHHH
Confidence            35789999999999999999999999999888  579999999999999999998554


No 44 
>KOG3632|consensus
Probab=97.84  E-value=1.2e-05  Score=80.75  Aligned_cols=58  Identities=24%  Similarity=0.430  Sum_probs=50.8

Q ss_pred             eeeeeeccCCCCC--------CCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhh
Q psy3210         196 IIAVAEFDFCPTE--------ANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRL  254 (272)
Q Consensus       196 ~~~~alydf~~~~--------~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~  254 (272)
                      ...+|+|||++..        ..||.|++|+||+|++..++ .|+|.|+.+|+.|++|.|||.|+.+
T Consensus      1139 rifVAlfDYDpl~MSpNpDAaEeELpFregqIikV~GDkDa-dgFY~GE~ngr~GlIPcNmvae~~v 1204 (1335)
T KOG3632|consen 1139 RIFVALFDYDPLQMSPNPDAAEEELPFREGQIIKVLGDKDA-DGFYMGELNGRRGLIPCNMVAEQPV 1204 (1335)
T ss_pred             eeeEeeeccCccccCCCCChhhhccccccCcEEEEeccccc-cceeecccccccccccccccccccC
Confidence            3568999997753        57999999999999998777 6999999999999999999998754


No 45 
>PF14633 SH2_2:  SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A.
Probab=97.62  E-value=0.00036  Score=60.46  Aligned_cols=82  Identities=16%  Similarity=0.248  Sum_probs=59.8

Q ss_pred             cccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEee-CCeeeEEEEEEecCCC----cceEEeeccc
Q psy3210          87 EYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKT-DEKVKHMKVYEKEMDG----VPQYFLSQSR  161 (272)
Q Consensus        87 ~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~-~~~v~H~~I~~~~~g~----~~~~~i~~~~  161 (272)
                      .+|-|+ +++-.+|++.|.+...|.++||.|+..     ....+++++. ++...|+-|.+.+...    |..+.|++ .
T Consensus        37 ~HP~F~-n~~~~qAe~~L~~~~~Ge~iIRPSSkG-----~dhL~vTwKv~d~vyqHidV~E~~K~n~~slG~~L~i~~-~  109 (220)
T PF14633_consen   37 KHPLFK-NFNYKQAEEYLADQDVGEVIIRPSSKG-----PDHLTVTWKVADGVYQHIDVKEEDKENEFSLGKTLKIGG-E  109 (220)
T ss_dssp             CSTTEE-SS-HHHHHHHHCCS-TT-EEEEE-TTT-----TTEEEEEEEEETTEEEEEEEEEECSSSTTS-SSEEEETT-E
T ss_pred             cCCCcc-CCCHHHHHHHHhcCCCCCEEEeeCCCC-----CCeEEEEEEEcCCcEEEEEEEECCCcCccccCcEEEECC-e
Confidence            456677 899999999999988899999999754     3568889888 5677799998765321    23566664 4


Q ss_pred             ccchhhhhhhhhhc
Q psy3210         162 YFRSIVELICCYER  175 (272)
Q Consensus       162 ~F~sL~eLV~~y~~  175 (272)
                      .|.+|.|||.-|-.
T Consensus       110 ~yeDLDEii~r~V~  123 (220)
T PF14633_consen  110 EYEDLDEIIARHVE  123 (220)
T ss_dssp             EESSHHHHHHHCHH
T ss_pred             EECCHHHHHHHHHH
Confidence            69999999998843


No 46 
>KOG3523|consensus
Probab=97.47  E-value=2.5e-05  Score=75.16  Aligned_cols=55  Identities=20%  Similarity=0.306  Sum_probs=48.6

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC--Ceeeeeeccchhhhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID--ERVSYFFQLYWGNFR  253 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~--g~~G~fP~~yVeE~~  253 (272)
                      .+.+...|.+..+|||+|+.+|++.|+.+..  .||.+|+-.  |..||||..||+|+.
T Consensus       610 Qv~~~~sy~a~q~Del~Le~~Dvv~v~~k~~--DGWl~GeRl~Dge~GWFP~~~veeI~  666 (695)
T KOG3523|consen  610 QVQCVHSYKAKQPDELTLELADVVNVLQKTP--DGWLEGERLRDGERGWFPSSYVEEIT  666 (695)
T ss_pred             hhheeeccccCCCceeeeehhhhhhhhhcCC--CccccccccccCccCcchHHHHHHhc
Confidence            3567778999999999999999999999988  689999854  899999999999873


No 47 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=97.32  E-value=0.00012  Score=48.88  Aligned_cols=32  Identities=28%  Similarity=0.605  Sum_probs=24.9

Q ss_pred             ehhcccCCCceecCcCCcchhcccccC-CCCCC
Q psy3210          14 VTLKSRGLRPLCSQACYLACHKQCIPH-TGRCG   45 (272)
Q Consensus        14 ~~~~g~~~qg~~c~~c~~~~h~~c~~~-~~~C~   45 (272)
                      .++-|++.|||.|..|+..+|++|+.. +..|+
T Consensus        19 ~~i~g~~~~g~~C~~C~~~~H~~C~~~~~~~C~   51 (53)
T PF00130_consen   19 KFIWGLGKQGYRCSWCGLVCHKKCLSKVPPSCG   51 (53)
T ss_dssp             SBECSSSSCEEEETTTT-EEETTGGCTSSSBSS
T ss_pred             cccCCCCCCeEEECCCCChHhhhhhhhcCCCCC
Confidence            455789999999999999999999554 44553


No 48 
>KOG4236|consensus
Probab=97.25  E-value=6.2e-05  Score=72.17  Aligned_cols=36  Identities=25%  Similarity=0.426  Sum_probs=33.0

Q ss_pred             heehhcccCCCceecCcCCcchhccc-ccCCCCCCCC
Q psy3210          12 SIVTLKSRGLRPLCSQACYLACHKQC-IPHTGRCGTG   47 (272)
Q Consensus        12 ~~~~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~~   47 (272)
                      -+.||||||.||..|+-|+..|||.| .+++.+|-+.
T Consensus       284 CkkLLkGL~rQGlqCkDCk~NcHkrCa~~v~~dClge  320 (888)
T KOG4236|consen  284 CKKLLKGLFRQGLQCKDCKFNCHKRCAMKVPNDCLGE  320 (888)
T ss_pred             HHHHHHHHHhcCcccccCCcchhhhhhhhcccccccc
Confidence            47899999999999999999999999 8889999754


No 49 
>KOG4278|consensus
Probab=97.16  E-value=0.00029  Score=68.90  Aligned_cols=62  Identities=19%  Similarity=0.315  Sum_probs=51.4

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhhccC
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLLSSL  258 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~mk~l  258 (272)
                      +..+|+|||-+...+.|++.+||.++|++.--. ..|.+.+.+.-.||+|+||+...+.+.|.
T Consensus        91 NLFVALYDFvasGdntLSitKGeklRvLGYN~N-gEWcEartKNGqGWVPSNyItPvNSLeKh  152 (1157)
T KOG4278|consen   91 NLFVALYDFVASGDNTLSITKGEKLRVLGYNKN-GEWCEARTKNGQGWVPSNYITPVNSLEKH  152 (1157)
T ss_pred             ceeEeeeeeeccccceeeeecCceEEEeeecCC-CcceeecccCCCccccccccccccchhhc
Confidence            357899999999999999999999999974332 34888887544499999999999988874


No 50 
>KOG3632|consensus
Probab=96.92  E-value=0.00043  Score=70.04  Aligned_cols=59  Identities=19%  Similarity=0.321  Sum_probs=51.7

Q ss_pred             eeeeeccCCCCC-------CCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhhc
Q psy3210         197 IAVAEFDFCPTE-------ANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLLS  256 (272)
Q Consensus       197 ~~~alydf~~~~-------~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~mk  256 (272)
                      ..+|.|||.+++       ..||.|+.||+|.|.+++++ .|.+.|+.+|..|++|++|+++.++-+
T Consensus      1246 ~mvaa~dydpqeSSpg~dgeAelafraGdIitVfg~mdd-dgfyyGelngqkglvpsnfle~p~~e~ 1311 (1335)
T KOG3632|consen 1246 QMVAASDYDPQESSPGLDGEAELAFRAGDIITVFGKMDD-DGFYYGELNGQKGLVPSNFLEAPNAEK 1311 (1335)
T ss_pred             hhhhhhcCCcccCCCCcccceeeccccCCeEEeeccccC-CcccccccCCccCccccccccCCCccc
Confidence            467899998876       46999999999999999987 699999999999999999999875543


No 51 
>KOG4566|consensus
Probab=96.88  E-value=0.0013  Score=58.15  Aligned_cols=87  Identities=21%  Similarity=0.305  Sum_probs=67.8

Q ss_pred             CCcccccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeec---
Q psy3210          83 ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQ---  159 (272)
Q Consensus        83 ~~l~~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~---  159 (272)
                      +.+...+||+|.+.+.+|+..|...+.|+||||+|...     +..+.|+++....-+..+|...++    .|....   
T Consensus        47 ~~~~~~g~~w~~~~~~~~~~~l~~~p~~~~l~Rdss~~-----~~~~~I~vk~~~g~~~~r~~~~~~----sfr~ds~~~  117 (258)
T KOG4566|consen   47 SLLDSSGHYWGLETANEAELCLGQEPRGTFLVRDSSHR-----PYLFTISVKTHSGPKNLRIQYQDS----SFRLDSSHR  117 (258)
T ss_pred             eccccCCcccccccchhHHHhhcCCCccceeeecCcCc-----cccceeEeeeccCCCCcccccccc----ceecccccc
Confidence            45566789999999999999998888999999999744     477899999987777777876653    343321   


Q ss_pred             ---c-cccchhhhhhhhhhcccc
Q psy3210         160 ---S-RYFRSIVELICCYERNSL  178 (272)
Q Consensus       160 ---~-~~F~sL~eLV~~y~~~~L  178 (272)
                         . ..|+.+..++.+|....+
T Consensus       118 ~~~pl~~~e~~~~~~~~y~~~~~  140 (258)
T KOG4566|consen  118 HTPPLISFEDVEVLIHHYRQSRK  140 (258)
T ss_pred             cCCCcccChhHHHHHHhhhhhhh
Confidence               1 379999999999965544


No 52 
>KOG0695|consensus
Probab=96.83  E-value=0.00054  Score=62.62  Aligned_cols=36  Identities=22%  Similarity=0.299  Sum_probs=30.4

Q ss_pred             eehhcccCCCceecCcCCcchhccc-ccCCCCCCCCC
Q psy3210          13 IVTLKSRGLRPLCSQACYLACHKQC-IPHTGRCGTGV   48 (272)
Q Consensus        13 ~~~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~~~   48 (272)
                      --.+=|+..|||+|-.|..-|||+| -.++-.|+.+.
T Consensus       148 ~d~iwglgrqgyrcinckl~vhkkch~~v~~~cg~~~  184 (593)
T KOG0695|consen  148 SDRIWGLGRQGYRCINCKLLVHKKCHGLVPLTCGKHM  184 (593)
T ss_pred             hhhhhhcccccceeecceeehhhhhcccccchhhhhc
Confidence            3356699999999999999999999 66677898764


No 53 
>KOG4429|consensus
Probab=96.82  E-value=0.00066  Score=60.32  Aligned_cols=55  Identities=16%  Similarity=0.078  Sum_probs=48.7

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNF  252 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~  252 (272)
                      ..+.|+|+|.+...+||....||++++-.+..  .|||.+.+.|..+-||+.||+|+
T Consensus       364 ~lcdafYSfqarqddel~~e~gditif~Ekke--eg~~f~rl~gd~~hf~Aa~iEea  418 (421)
T KOG4429|consen  364 ILCDAFYSFQARQDDELGGEIGDITIFDEKKE--EGPTFCRLLGDFEHFHAAEIEEA  418 (421)
T ss_pred             HHhhhhhccccccccccCCcccceeeecCccc--CCCceeeeccccCCCcHHHHHHh
Confidence            45779999999999999999999986666555  68999999999999999999986


No 54 
>KOG4773|consensus
Probab=96.79  E-value=0.00021  Score=64.75  Aligned_cols=54  Identities=28%  Similarity=0.403  Sum_probs=48.9

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNF  252 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~  252 (272)
                      .+.|++||.+....||.|.+||++.+..+.+  ++||.|+..+..||+|..|++.+
T Consensus       177 ~~~a~~df~gns~~EL~l~agdV~~~~~r~e--k~W~~gk~R~~~g~yp~sF~~~l  230 (386)
T KOG4773|consen  177 RAEASFDFPGNSKLELNLVAGDVEFLLSRDE--KYWLLGKVRGLTGYYPDSFVKQL  230 (386)
T ss_pred             HHHhhccCCCCccceeeeehhhHHHHHhhcc--cceeeeeeccccccccHHhhhhh
Confidence            4678999999999999999999988887776  78999999999999999999865


No 55 
>KOG4575|consensus
Probab=96.78  E-value=0.0013  Score=63.90  Aligned_cols=55  Identities=16%  Similarity=0.175  Sum_probs=42.9

Q ss_pred             ccccceeeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEE-eC--Ceeeeeeccch
Q psy3210         189 LQLPFRQIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK-ID--ERVSYFFQLYW  249 (272)
Q Consensus       189 L~~P~~~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~-~~--g~~G~fP~~yV  249 (272)
                      ++.|+   .++|+|.+.++...+|.|.+||+|+++. .+  .|||-+. ..  ...|+||+|||
T Consensus         5 ~q~p~---~vrA~y~w~ge~eGdl~f~egDlie~tr-I~--dgkwwi~lhrNk~~~g~fpsNFv   62 (874)
T KOG4575|consen    5 KQLPC---MVRALYAWPGEREGDLKFTEGDLIEQTR-IE--DGKWWILLHRNKDEDGLFPSNFV   62 (874)
T ss_pred             cCCCc---eEEeeccCCCCcccccceecccceeEEe-ec--cceeeeeeeecccccccCcccce
Confidence            44455   5899999999999999999999999984 44  3555543 32  57899999999


No 56 
>KOG3601|consensus
Probab=96.78  E-value=0.00019  Score=60.91  Aligned_cols=52  Identities=23%  Similarity=0.389  Sum_probs=46.8

Q ss_pred             eeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchh
Q psy3210         198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWG  250 (272)
Q Consensus       198 ~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVe  250 (272)
                      +.+++||.+...+||+|.+||.+++++.+++ ..|.+.+..|..|++|.||.+
T Consensus         3 a~a~n~f~a~i~dELsFlkg~~lk~l~~~d~-~nw~~ael~g~~g~~P~Nai~   54 (222)
T KOG3601|consen    3 AVAKNDFLAGIRDELSFLKGDNLKILNMEDD-INWYKAELDGPEGFIPKNAIR   54 (222)
T ss_pred             hhhhhhhhhcCcccceeecCCceEecchHHh-hhhhhHhhcCccccCcccccc
Confidence            5788999999999999999999999987765 689999999999999999984


No 57 
>KOG3771|consensus
Probab=96.67  E-value=0.00069  Score=63.82  Aligned_cols=54  Identities=11%  Similarity=0.147  Sum_probs=41.9

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWG  250 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVe  250 (272)
                      ..++|+|||.+.+.+||+|..||+|.|+. .++...||.|...|..+-++.+|+.
T Consensus       401 ~~v~a~~dy~a~~~deLsf~~gd~i~vi~-s~~~~e~~eg~~mg~ke~~~~~~~~  454 (460)
T KOG3771|consen  401 YKVKALHDYAAQDTDELSFEAGDVILVIP-SDNPEEQDEGWLMGVKESDWNGLFP  454 (460)
T ss_pred             cceeccccccccccccccccCCCEEEEec-CCCccchhhHHHhhhccccccccee
Confidence            35889999999999999999999999997 3333668888887655555555544


No 58 
>KOG4792|consensus
Probab=96.57  E-value=0.0019  Score=55.53  Aligned_cols=54  Identities=20%  Similarity=0.174  Sum_probs=43.6

Q ss_pred             eeeeeccC--CCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhh
Q psy3210         197 IAVAEFDF--CPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNF  252 (272)
Q Consensus       197 ~~~alydf--~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~  252 (272)
                      .++++++-  .+.+...|.|+.||+|.|..+.-  .|-|+|+++|+.|.||-.||+-.
T Consensus       229 ~Arv~q~RVPnAYDkTaL~levGdiVkVTk~ni--nGqwegElnGk~G~fPfThvrf~  284 (293)
T KOG4792|consen  229 YARVIQKRVPNAYDKTALALEVGDIVKVTKKNI--NGQWEGELNGKIGHFPFTHVRFT  284 (293)
T ss_pred             heeeehhcCCCccChhhhhhhcCcEEEEEeecc--CceeeeeecCccccccceeEEee
Confidence            34444444  45567889999999999998776  68999999999999999998743


No 59 
>KOG2528|consensus
Probab=96.55  E-value=0.00085  Score=62.74  Aligned_cols=56  Identities=23%  Similarity=0.325  Sum_probs=47.7

Q ss_pred             eeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhhhh
Q psy3210         197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGNFR  253 (272)
Q Consensus       197 ~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE~~  253 (272)
                      .++|+|||.....+|++...||++.+.....- .|||.|... |..|.||+.||+-+.
T Consensus         4 k~RamyDf~~E~~sElsi~~~evl~i~~e~~~-~GwLeg~Nsrge~GlfPa~yVeV~~   60 (490)
T KOG2528|consen    4 KARAMYDFQSEGHSELSIWEGEVLSITSEDVI-EGWLEGSNSRGERGLFPASYVEVTR   60 (490)
T ss_pred             chhhhcchhhcccccccccccceeeecCcccc-cccccCCCccCccCCCcccceeeec
Confidence            47899999998999999999999988865432 799999864 899999999998543


No 60 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=96.47  E-value=0.0016  Score=42.50  Aligned_cols=29  Identities=21%  Similarity=0.351  Sum_probs=23.9

Q ss_pred             ehhcccCCCceecCcCCcchhcccccCCC
Q psy3210          14 VTLKSRGLRPLCSQACYLACHKQCIPHTG   42 (272)
Q Consensus        14 ~~~~g~~~qg~~c~~c~~~~h~~c~~~~~   42 (272)
                      .++.|+..|||.|..|+..+|++|...++
T Consensus        19 ~~i~~~~~~~~~C~~C~~~~H~~C~~~v~   47 (50)
T cd00029          19 KSIWGLFKQGLRCSWCKVKCHKKCADKVP   47 (50)
T ss_pred             hhhhccccceeEcCCCCCchhhhhhccCC
Confidence            34567778999999999999999966544


No 61 
>KOG1451|consensus
Probab=96.44  E-value=0.0027  Score=61.35  Aligned_cols=56  Identities=13%  Similarity=0.255  Sum_probs=47.1

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGN  251 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE  251 (272)
                      ...++++|.-.+..+.|++|..|.++.-.-...+ .||..|+.+|..|++|+|||+.
T Consensus       756 ~rk~k~lyAc~a~h~selsf~~gt~f~nv~~S~e-~Gwl~GtLnGktglip~nyve~  811 (812)
T KOG1451|consen  756 SRRVKTLYACTADHHSELSFEPGTIFTNVYESNE-DGWLVGTLNGKTGLIPSNYVEP  811 (812)
T ss_pred             cccccceeccCCCCcccccccCcceeeeecccCC-CCceeeecCCCcccCcccccCc
Confidence            3457889999999999999999988766543333 6899999999999999999985


No 62 
>KOG3725|consensus
Probab=96.18  E-value=0.0016  Score=57.02  Aligned_cols=56  Identities=18%  Similarity=0.199  Sum_probs=50.6

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGN  251 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE  251 (272)
                      ..++.+|||++-...||++...|+|+|..-.|-+.+|..|+..++.|-+|..|++-
T Consensus       318 rkArVlyDYdAa~s~ElslladeiitVyslpGMD~dwlmgErGnkkGKvPvtYlEL  373 (375)
T KOG3725|consen  318 RKARVLYDYDAALSQELSLLADEIITVYSLPGMDADWLMGERGNKKGKVPVTYLEL  373 (375)
T ss_pred             cceeeeecccccchhhhhhhhcceEEEEecCCCChHHhhhhhcCCCCCcchhHHHh
Confidence            45889999999999999999999999998777667899999999999999999984


No 63 
>KOG3557|consensus
Probab=96.04  E-value=0.0017  Score=63.22  Aligned_cols=58  Identities=22%  Similarity=0.395  Sum_probs=48.8

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhhhhhhc
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGNFRLLS  256 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE~~~mk  256 (272)
                      ..+..+|||.+....||+..+||+++|+. .  ..+||+.... |+.|++|.|-+..++...
T Consensus       501 k~~~~~Ydf~arNs~ELsV~k~E~LEvl~-d--~R~WW~~kn~~G~~GyvP~nIL~~~~~~~  559 (721)
T KOG3557|consen  501 KWVLVLYDFQARNSSELSVKKGEVLEVLD-D--GRKWWKVKNGHGRAGYVPSNILAPLQPEH  559 (721)
T ss_pred             eeeeeehhhhcccchhhhhhhhhhhhhhh-c--cccceeccCccCCCCCcchhhhccCCCcc
Confidence            36788999999999999999999998883 2  2789998875 899999999988766543


No 64 
>KOG0197|consensus
Probab=95.96  E-value=0.0023  Score=61.03  Aligned_cols=56  Identities=21%  Similarity=0.491  Sum_probs=46.5

Q ss_pred             eeeeeeeccCCCCCCCCCccCCCcE-EEEeeeeCCcCCeEEEEe--CCeeeeeeccchhhh
Q psy3210         195 QIIAVAEFDFCPTEANQLPLKQGCQ-VIVLSKEGEQKGWWKGKI--DERVSYFFQLYWGNF  252 (272)
Q Consensus       195 ~~~~~alydf~~~~~~ELsl~~Gd~-i~v~~k~ge~~gwW~G~~--~g~~G~fP~~yVeE~  252 (272)
                      ...+.|+|||.+....+|+|.+||. ..+++...  ..||+...  .+..|++|.|||.+.
T Consensus        11 ~~~~valyd~~s~~~~dLsf~~Gd~~~~~~~~~~--~~Ww~ar~~~~~~~g~ip~N~v~~~   69 (468)
T KOG0197|consen   11 ETIVVALYDYASRTPEDLSFRKGDVVLILLETTN--GDWWRARSLQLGQEGYIPSNYVARN   69 (468)
T ss_pred             cceEEEeccccCCCccccccccCceEEEeeccCC--hhHHHHHHhhcCCCCcCcCceeecc
Confidence            4568999999999999999999999 66665544  57998765  478899999999975


No 65 
>KOG0609|consensus
Probab=95.96  E-value=0.0061  Score=58.52  Aligned_cols=58  Identities=21%  Similarity=0.422  Sum_probs=47.5

Q ss_pred             eeeeeeeccCCCCCC-------CCCccCCCcEEEEeeeeCCcCCeEEEEeC-----Ceeeeeeccchhhhhh
Q psy3210         195 QIIAVAEFDFCPTEA-------NQLPLKQGCQVIVLSKEGEQKGWWKGKID-----ERVSYFFQLYWGNFRL  254 (272)
Q Consensus       195 ~~~~~alydf~~~~~-------~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~-----g~~G~fP~~yVeE~~~  254 (272)
                      ..+++|+|||++++.       .-|+|.+||++.|+++.+  ..||.+...     +..|++|+...+|-+.
T Consensus       214 ~~~vra~FdYdP~~D~~IPCkEagl~F~~GDILqIv~qdD--~nWWQA~~~~~~~~~~AGLiPS~~~qerr~  283 (542)
T KOG0609|consen  214 VVFVRALFDYDPKEDDLIPCKEAGLPFQRGDILQIVSQDD--PNWWQARRVGDPFGGLAGLIPSKELQERRV  283 (542)
T ss_pred             eeeehhhcCcCcccCCcccchhcCCcccccceeeeccCCC--cchhhhhcccCccccccccccCHHHHHHHH
Confidence            367899999999873       468999999999999988  789998765     3568999988876543


No 66 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=95.82  E-value=0.004  Score=40.20  Aligned_cols=27  Identities=22%  Similarity=0.450  Sum_probs=21.7

Q ss_pred             hhcccCCCceecCcCCcchhcccccCCC
Q psy3210          15 TLKSRGLRPLCSQACYLACHKQCIPHTG   42 (272)
Q Consensus        15 ~~~g~~~qg~~c~~c~~~~h~~c~~~~~   42 (272)
                      ++.|.+ |||.|..|++.+|++|...++
T Consensus        20 ~i~~~~-~~~~C~~C~~~~H~~C~~~v~   46 (49)
T smart00109       20 SIWGSF-QGLRCSWCKVKCHKKCAEKVP   46 (49)
T ss_pred             ccCcCC-CCcCCCCCCchHHHHHHhhcC
Confidence            345555 899999999999999966544


No 67 
>KOG4236|consensus
Probab=95.57  E-value=0.023  Score=55.03  Aligned_cols=32  Identities=25%  Similarity=0.406  Sum_probs=29.3

Q ss_pred             hhcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          15 TLKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        15 ~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      +|=||..||..|..||..-||.| .+.+.+|.+
T Consensus       165 mL~GLvrQGlKC~gCglNyHKRCa~kipNNCsG  197 (888)
T KOG4236|consen  165 MLFGLVRQGLKCEGCGLNYHKRCAFKIPNNCSG  197 (888)
T ss_pred             HHHHHHHccccccCCCCcHhhhhhhcCCCCCCc
Confidence            46799999999999999999999 888999965


No 68 
>KOG3775|consensus
Probab=94.70  E-value=0.014  Score=53.70  Aligned_cols=57  Identities=23%  Similarity=0.307  Sum_probs=46.1

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC--Ceeeeeeccchhhhhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID--ERVSYFFQLYWGNFRL  254 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~--g~~G~fP~~yVeE~~~  254 (272)
                      .+-++++.|-+.-+|||.|..||-|.|-.+.+  .-|++|..-  |+.|+||+.|+-|+..
T Consensus       263 ~THR~~~rFvPRHpDELeLEIgDav~Ve~ead--D~W~~G~NlRTG~~GIFPA~ya~evd~  321 (482)
T KOG3775|consen  263 QTHRAVFRFVPRHPDELELEIGDAVLVEAEAD--DFWFEGFNLRTGERGIFPAFYAHEVDG  321 (482)
T ss_pred             hhhhhhhhccCCCcceeeeecCCeeEeeeccc--chhhccccccccccccccceeEEecCC
Confidence            45678999999999999999999987775554  457788763  8999999999876543


No 69 
>KOG0696|consensus
Probab=92.92  E-value=0.033  Score=52.54  Aligned_cols=33  Identities=21%  Similarity=0.375  Sum_probs=30.0

Q ss_pred             ehhcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          14 VTLKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        14 ~~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      -||-|+..||..|..|...||+.| ..+++-|+.
T Consensus       129 sLLyGl~HQGmKC~~C~mNVH~rCv~nVPslCG~  162 (683)
T KOG0696|consen  129 SLLYGLIHQGMKCDTCDMNVHHRCVENVPSLCGT  162 (683)
T ss_pred             HHHHHHHhcccccccccchHHHHHhhcCCcccCC
Confidence            378999999999999999999999 777888985


No 70 
>KOG0192|consensus
Probab=92.84  E-value=0.035  Score=51.87  Aligned_cols=21  Identities=24%  Similarity=0.129  Sum_probs=19.7

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|.+|+.+|.+++|||||+|.
T Consensus        85 ~f~~E~~il~~l~HpNIV~f~  105 (362)
T KOG0192|consen   85 AFRREASLLSRLRHPNIVQFY  105 (362)
T ss_pred             HHHHHHHHHHhCCCCCeeeEE
Confidence            799999999999999999974


No 71 
>KOG0196|consensus
Probab=91.66  E-value=0.079  Score=53.54  Aligned_cols=46  Identities=17%  Similarity=0.256  Sum_probs=32.5

Q ss_pred             EEEEeeeeCCcCCeEEEEeC--C-----------eeeee---eccchhhhhhhccCCCCCcccce
Q psy3210         219 QVIVLSKEGEQKGWWKGKID--E-----------RVSYF---FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       219 ~i~v~~k~ge~~gwW~G~~~--g-----------~~G~f---P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|+..++|||   .+.|+.+  |           +.|+.   -.+|+.||.||-++.||||+||-
T Consensus       635 ~VIGaGEFGE---Vc~GrLk~pgkre~~VAIKTLK~GytekqrrdFL~EAsIMGQFdHPNIIrLE  696 (996)
T KOG0196|consen  635 KVIGAGEFGE---VCSGRLKLPGKREITVAIKTLKAGYTEKQRRDFLSEASIMGQFDHPNIIRLE  696 (996)
T ss_pred             EEEecccccc---eecccccCCCCcceeEEEeeeccCccHHHHhhhhhhhhhcccCCCCcEEEEE
Confidence            3445567886   4566554  2           22332   35899999999999999999984


No 72 
>KOG0199|consensus
Probab=91.23  E-value=0.18  Score=50.64  Aligned_cols=52  Identities=25%  Similarity=0.341  Sum_probs=41.2

Q ss_pred             eeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeC--Ceeeeeeccchh
Q psy3210         198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID--ERVSYFFQLYWG  250 (272)
Q Consensus       198 ~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~--g~~G~fP~~yVe  250 (272)
                      +.|.-+++..+.+.|.|.+||.|.|++..++ .-||+|+..  ++.|.||.+-|.
T Consensus       377 ~~a~~~~d~~ep~aLh~~kgD~IvVIegs~a-~y~WfgQn~Rn~kvG~Fprsvvt  430 (1039)
T KOG0199|consen  377 AVARETYDSIEPGALHLTKGDEIVVIEGSGA-GYDWFGQNKRNQKVGTFPRSVVT  430 (1039)
T ss_pred             ceeeeeccccCCCceeeccCCeEEEEecCCc-cceeeccccccceecccCcceee
Confidence            4455566667899999999999999976664 359999754  789999998776


No 73 
>KOG1856|consensus
Probab=91.18  E-value=0.2  Score=52.26  Aligned_cols=82  Identities=20%  Similarity=0.317  Sum_probs=59.8

Q ss_pred             cccEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeC-CeeeEEEEEEecCC----CcceEEeeccc
Q psy3210          87 EYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTD-EKVKHMKVYEKEMD----GVPQYFLSQSR  161 (272)
Q Consensus        87 ~~~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~-~~v~H~~I~~~~~g----~~~~~~i~~~~  161 (272)
                      .+|.|+ +++-++||..|.....|.++||.|+++     ....+++++.. +.-.|+.|...+..    -|..+.+.+. 
T Consensus      1107 ~HP~F~-n~n~eQAe~yL~~~d~ge~iiRpSSrg-----ddhLvvtwKVsD~iYqhidV~E~eKEn~fslg~~l~i~~e- 1179 (1299)
T KOG1856|consen 1107 AHPLFK-NLNAEQAEAYLSDMDQGELIIRPSSRG-----DDHLVVTWKVSDGIYQHIDVQELEKENYFSLGKTLWIGGE- 1179 (1299)
T ss_pred             cCcccc-CCCHHHHHHHHHhcccccEEeccccCC-----CCceEEEEEecCchhhhhhhhhhhccccccccceEEECCc-
Confidence            457777 899999999999988899999999754     46677788775 55668888764321    0113334443 


Q ss_pred             ccchhhhhhhhhhc
Q psy3210         162 YFRSIVELICCYER  175 (272)
Q Consensus       162 ~F~sL~eLV~~y~~  175 (272)
                      .|..|.|+|.-|-.
T Consensus      1180 ~feDLDEiI~r~vq 1193 (1299)
T KOG1856|consen 1180 EFEDLDEIIARYVQ 1193 (1299)
T ss_pred             ccccHHHHHHHHHH
Confidence            69999999998854


No 74 
>KOG0615|consensus
Probab=90.96  E-value=0.088  Score=49.54  Aligned_cols=23  Identities=17%  Similarity=0.052  Sum_probs=19.2

Q ss_pred             eccc-hhhhhhhccCCCCCcccce
Q psy3210         245 FQLY-WGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~y-VeE~~~mk~l~h~~~v~~~  267 (272)
                      +... ..|++|||+|+||||||++
T Consensus       219 ~~~~v~~EieILkkL~HP~IV~~~  242 (475)
T KOG0615|consen  219 KTRDVQNEIEILKKLSHPNIVRIK  242 (475)
T ss_pred             chhhhHHHHHHHHhcCCCCEEEEe
Confidence            3344 4699999999999999997


No 75 
>PF08239 SH3_3:  Bacterial SH3 domain;  InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. A homologue of the SH3 domain has been found in a number of different bacterial proteins including glycyl-glycine endopeptidase, bacteriocin and some hypothetical proteins.; PDB: 3PVQ_B 3NPF_B 3H41_A 2KQ8_A 2KRS_A 2KYB_A 2KT8_A.
Probab=90.69  E-value=0.49  Score=31.14  Aligned_cols=36  Identities=28%  Similarity=0.577  Sum_probs=28.6

Q ss_pred             cCCCcEEEEeeeeCCcCCeEEE-EeCCeeeeeeccchh
Q psy3210         214 LKQGCQVIVLSKEGEQKGWWKG-KIDERVSYFFQLYWG  250 (272)
Q Consensus       214 l~~Gd~i~v~~k~ge~~gwW~G-~~~g~~G~fP~~yVe  250 (272)
                      +..|+.|+++++.++ .+|++- ..+|..||+.++||+
T Consensus        19 l~~g~~v~v~~~~~~-~~W~~V~~~~g~~GwV~~~~l~   55 (55)
T PF08239_consen   19 LPKGEKVTVLGESGD-GNWYKVRTYDGKTGWVSSSYLS   55 (55)
T ss_dssp             EETTSEEEEEEEETT---EEEEEEETTEEEEEEGGCEE
T ss_pred             EeCCCEEEEEEEcCC-cEEEEEECcCCcEEEEEccccC
Confidence            567999999988763 239888 667899999999984


No 76 
>KOG0040|consensus
Probab=90.61  E-value=0.0092  Score=63.15  Aligned_cols=67  Identities=19%  Similarity=0.335  Sum_probs=53.4

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhhhhhhccCCCCCccc
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFRLLSSLFIVPPVR  265 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE~~~mk~l~h~~~v~  265 (272)
                      ..+.|+|||....+.|.+.++||+.+.+....  ..||+.+++.+.|++|+.||+-+..- .-.-+|+++
T Consensus       969 ~~v~alyd~q~kSprev~mKkgDvltll~s~n--kdwwkve~~d~qg~vpa~yvk~~~~~-~~~~~~l~~ 1035 (2399)
T KOG0040|consen  969 ECVLALYDYQEKSPREVTMKKGDVLTLLNSIN--KDWWKVEVNDRQGFVPAAYVKRLDPG-SASQPNLRR 1035 (2399)
T ss_pred             HHHHHHHHHHhcCHHHHHHhhhhHHHHHhhcc--cccccchhhhhcCcchHHHHHHhccC-CcchHHHHH
Confidence            34679999999999999999999987776555  78999999999999999999855433 444444444


No 77 
>PF14633 SH2_2:  SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A.
Probab=89.11  E-value=0.44  Score=41.39  Aligned_cols=82  Identities=17%  Similarity=0.248  Sum_probs=52.0

Q ss_pred             CcccccEeeeeCCHHHHHHhccc----CCC-ceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEE--EEEEecCCCcceEE
Q psy3210          84 NLSEYLWFVGEMGREKATSLLER----EAD-GTYLLRIRPQGPTHPNETIYALSLKTDEKVKHM--KVYEKEMDGVPQYF  156 (272)
Q Consensus        84 ~l~~~~Wf~g~isR~~Ae~lL~~----~~~-G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~--~I~~~~~g~~~~~~  156 (272)
                      ++..+..|.. -+++++|+.|..    ++. -.|.+-.+.     ..+|.|.|++..+...+|.  .|.-..+|    |.
T Consensus       131 ~~~~h~kf~~-g~~~e~e~~L~~~k~~nP~~i~Y~f~~~~-----~~PG~F~L~y~~~~~~~~~~~~v~V~p~G----f~  200 (220)
T PF14633_consen  131 EMMNHRKFKD-GTKEEVEEWLKEEKKANPKRIPYAFCISK-----EHPGYFILSYKPNKNPRHEYWPVKVTPDG----FR  200 (220)
T ss_dssp             HHHCSTTEES-S-CCCCHHHHHCHHHHSTTS-EEEEEE-T-----TSTTEEEEEEESSTTS-EEEEEEEE-SSS----EE
T ss_pred             HHHhCccccC-CCHHHHHHHHHHHHHhCCCCceEEEEECC-----CCCCEEEEEEEcCCCCceEEeeEEEecCc----EE
Confidence            3444455543 356677887853    233 356666664     3579999999886544443  37666665    77


Q ss_pred             eecccccchhhhhhhhhhcc
Q psy3210         157 LSQSRYFRSIVELICCYERN  176 (272)
Q Consensus       157 i~~~~~F~sL~eLV~~y~~~  176 (272)
                      +... .|++|.+|+.+++.+
T Consensus       201 ~r~~-~f~~~~~L~~~FK~~  219 (220)
T PF14633_consen  201 FRKQ-VFPSLDRLINWFKKH  219 (220)
T ss_dssp             ETTE-EESSHHHHHHHHHHH
T ss_pred             Eecc-cCCCHHHHHHHHhhc
Confidence            7654 699999999999864


No 78 
>KOG0585|consensus
Probab=86.78  E-value=0.26  Score=47.36  Aligned_cols=20  Identities=20%  Similarity=0.170  Sum_probs=17.7

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      -.+|+.|||+|+|||||+|-
T Consensus       155 v~~EIailKkl~H~nVV~Li  174 (576)
T KOG0585|consen  155 VRREIAILKKLHHPNVVKLI  174 (576)
T ss_pred             HHHHHHHHHhcCCcCeeEEE
Confidence            45799999999999999983


No 79 
>KOG0199|consensus
Probab=86.30  E-value=0.18  Score=50.67  Aligned_cols=22  Identities=14%  Similarity=0.025  Sum_probs=20.7

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+|+.|+.+|.+|.|+|||||+
T Consensus       156 ddflrEas~M~~L~H~hliRLy  177 (1039)
T KOG0199|consen  156 DDFLREASHMLKLQHPHLIRLY  177 (1039)
T ss_pred             HHHHHHHHHHHhccCcceeEEe
Confidence            5799999999999999999996


No 80 
>KOG0694|consensus
Probab=86.27  E-value=0.15  Score=50.69  Aligned_cols=38  Identities=18%  Similarity=0.261  Sum_probs=33.1

Q ss_pred             cchheehhcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210           9 RSISIVTLKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus         9 ~~~~~~~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      .|.-..++-||.+|||.|..|-..+||.| .+++..|-.
T Consensus       172 Cs~C~kFi~gL~kqGyQCqvC~~vvHKkCh~kvv~~C~~  210 (694)
T KOG0694|consen  172 CSWCQKFIWGLRKQGYQCQVCWRVVHKKCHVKVVTLCDF  210 (694)
T ss_pred             hhhhhhheeccCCCceEEeeeeehHhhhhHHHHHHhccC
Confidence            34556789999999999999999999999 888888865


No 81 
>KOG1090|consensus
Probab=85.77  E-value=0.32  Score=50.32  Aligned_cols=26  Identities=15%  Similarity=0.409  Sum_probs=23.2

Q ss_pred             CCceecCcCCcchhcccccCCCCCCC
Q psy3210          21 LRPLCSQACYLACHKQCIPHTGRCGT   46 (272)
Q Consensus        21 ~qg~~c~~c~~~~h~~c~~~~~~C~~   46 (272)
                      .|||+|++||+++|.+|-++.-.|+.
T Consensus      1559 pv~~~c~~c~~~~he~c~~~~~~~~~ 1584 (1732)
T KOG1090|consen 1559 PVSVHCKKCRIHVHEGCVNRNITIGN 1584 (1732)
T ss_pred             cceecccccccccchhhccccccccc
Confidence            89999999999999999887777764


No 82 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=85.59  E-value=0.39  Score=27.98  Aligned_cols=16  Identities=19%  Similarity=0.496  Sum_probs=15.0

Q ss_pred             ceecCcCCcchhcccc
Q psy3210          23 PLCSQACYLACHKQCI   38 (272)
Q Consensus        23 g~~c~~c~~~~h~~c~   38 (272)
                      +|.|+.|...+|.+|+
T Consensus        15 ~Y~C~~c~f~lh~~Ca   30 (30)
T PF03107_consen   15 FYHCSECCFTLHVRCA   30 (30)
T ss_pred             eEEeCCCCCeEcCccC
Confidence            9999999999999984


No 83 
>KOG0600|consensus
Probab=84.71  E-value=0.35  Score=46.71  Aligned_cols=25  Identities=16%  Similarity=0.056  Sum_probs=22.4

Q ss_pred             eeeccchhhhhhhccCCCCCcccce
Q psy3210         243 YFFQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       243 ~fP~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      -||..-++|++||++|.|||||+|.
T Consensus       158 ~~~~t~~REI~ILr~l~HpNIikL~  182 (560)
T KOG0600|consen  158 GFPITAIREIKILRRLDHPNIIKLE  182 (560)
T ss_pred             cchHHHHHHHHHHHhcCCCccccee
Confidence            3677888999999999999999985


No 84 
>smart00287 SH3b Bacterial SH3 domain homologues.
Probab=84.43  E-value=1.6  Score=29.31  Aligned_cols=36  Identities=28%  Similarity=0.369  Sum_probs=28.8

Q ss_pred             ccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchh
Q psy3210         213 PLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWG  250 (272)
Q Consensus       213 sl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVe  250 (272)
                      .+..|+.+.++++.+  .+|.+-+.. |..||++..++.
T Consensus        26 ~l~~g~~v~i~~~~~--~~W~~v~~~~g~~Gwi~~~~~~   62 (63)
T smart00287       26 TLKKGDKVKVLGVDG--QDWAKITYGSGQRGYVPGYVVN   62 (63)
T ss_pred             EecCCCEEEEEEccC--CceEEEEcCCCCEEEEEeeeec
Confidence            366899999997665  379998886 899999887764


No 85 
>KOG0663|consensus
Probab=83.78  E-value=0.43  Score=44.06  Aligned_cols=23  Identities=13%  Similarity=-0.039  Sum_probs=21.9

Q ss_pred             eeccchhhhhhhccCCCCCcccc
Q psy3210         244 FFQLYWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       244 fP~~yVeE~~~mk~l~h~~~v~~  266 (272)
                      ||-.+++|++++.+++|+|||.+
T Consensus       118 FPItsLREIniLl~~~H~NIV~v  140 (419)
T KOG0663|consen  118 FPITSLREINILLKARHPNIVEV  140 (419)
T ss_pred             CcchhHHHHHHHHhcCCCCeeee
Confidence            79999999999999999999986


No 86 
>KOG1856|consensus
Probab=83.61  E-value=2.4  Score=44.73  Aligned_cols=81  Identities=16%  Similarity=0.208  Sum_probs=59.4

Q ss_pred             ccccEeeeeCCHHHHHHhccc--CCCceEE---EEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecc
Q psy3210          86 SEYLWFVGEMGREKATSLLER--EADGTYL---LRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQS  160 (272)
Q Consensus        86 ~~~~Wf~g~isR~~Ae~lL~~--~~~G~FL---VR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~  160 (272)
                      ..+.+|. .=++++.|++|..  ..++.+.   +-.|.     .+||.|.||++.+.+++|--|.-...|    |++.+.
T Consensus      1203 ~nhkyf~-~Gt~~~~ek~L~~~k~~np~~~~Y~F~~s~-----~~PG~F~L~y~~~~k~~heyv~v~p~g----~~~rg~ 1272 (1299)
T KOG1856|consen 1203 TNHKYFF-TGTKKEVEKLLRDYKKVNPKKSVYFFCASH-----EHPGKFCLSYKPSSKPRHEYVKVVPEG----FRFRGQ 1272 (1299)
T ss_pred             HhhhHhh-cCCHHHHHHHHHHHhccCCCeeeEEEEecc-----cCCceEEEEeccCCCccceeEEEcccc----eEEecc
Confidence            3444555 2348889999963  3344444   44553     568999999999999999888877775    666655


Q ss_pred             cccchhhhhhhhhhccc
Q psy3210         161 RYFRSIVELICCYERNS  177 (272)
Q Consensus       161 ~~F~sL~eLV~~y~~~~  177 (272)
                       .|+||.+|+.|++.+-
T Consensus      1273 -~f~tld~L~~~FK~h~ 1288 (1299)
T KOG1856|consen 1273 -NFGTLDELCRWFKRHY 1288 (1299)
T ss_pred             -cchhHHHHHHHHHHHh
Confidence             5999999999998865


No 87 
>KOG0658|consensus
Probab=83.57  E-value=0.49  Score=43.78  Aligned_cols=20  Identities=20%  Similarity=0.205  Sum_probs=18.1

Q ss_pred             hhhhhhccCCCCCcccceec
Q psy3210         250 GNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       250 eE~~~mk~l~h~~~v~~~~~  269 (272)
                      .|+++|+++.|||||+|-+.
T Consensus        66 rEl~im~~l~HpNIV~L~~~   85 (364)
T KOG0658|consen   66 RELQIMRKLDHPNIVRLLYF   85 (364)
T ss_pred             HHHHHHHhcCCcCeeeEEEE
Confidence            59999999999999999764


No 88 
>KOG1095|consensus
Probab=82.34  E-value=0.49  Score=49.62  Aligned_cols=22  Identities=18%  Similarity=0.009  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|++|+.+|++++|||||+|-
T Consensus       740 ~~Fl~Ea~~m~~f~HpNiv~li  761 (1025)
T KOG1095|consen  740 SDFLKEALLMSKFDHPNIVSLI  761 (1025)
T ss_pred             HHHHHHHHHHhcCCCcceeeEE
Confidence            4799999999999999999973


No 89 
>PF13831 PHD_2:  PHD-finger; PDB: 2L43_A 2KU3_A.
Probab=81.98  E-value=0.44  Score=29.13  Aligned_cols=18  Identities=28%  Similarity=0.571  Sum_probs=11.8

Q ss_pred             ceecCcCCcchhcccccC
Q psy3210          23 PLCSQACYLACHKQCIPH   40 (272)
Q Consensus        23 g~~c~~c~~~~h~~c~~~   40 (272)
                      =..|..|++.||+.|-++
T Consensus         4 ll~C~~C~v~VH~~CYGv   21 (36)
T PF13831_consen    4 LLFCDNCNVAVHQSCYGV   21 (36)
T ss_dssp             EEE-SSS--EEEHHHHT-
T ss_pred             eEEeCCCCCcCChhhCCc
Confidence            468999999999999544


No 90 
>KOG3565|consensus
Probab=80.80  E-value=0.43  Score=47.84  Aligned_cols=56  Identities=16%  Similarity=0.313  Sum_probs=46.7

Q ss_pred             eeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEE--eCCeeeeeeccchhhh
Q psy3210         196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK--IDERVSYFFQLYWGNF  252 (272)
Q Consensus       196 ~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~--~~g~~G~fP~~yVeE~  252 (272)
                      ..+.|+|.|++...+++++..|+++.++...- +.||=+++  .++..|.+|..|++-.
T Consensus       579 ~~~~a~~~~~~~s~~~~si~~~~il~~ie~~~-g~gwt~~r~~~~~~~g~~Ptsyl~~~  636 (640)
T KOG3565|consen  579 RTSKALYAFEGQSEGTISIDPGEILQVIEEDK-GDGWTRGRLEPNGEKGYVPTSYLDVT  636 (640)
T ss_pred             cceecccCcCCCCCCccccCcchhHHHHhhcc-cCCCCCCCCCCCCcCCCCCccccccc
Confidence            45789999999999999999999988885432 27898888  6689999999999843


No 91 
>KOG4257|consensus
Probab=80.35  E-value=0.6  Score=46.51  Aligned_cols=22  Identities=5%  Similarity=0.086  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+|++|+-+|+++.|||||||-
T Consensus       436 ekflqEa~iMrnfdHphIikLI  457 (974)
T KOG4257|consen  436 EKFLQEASIMRNFDHPHIIKLI  457 (974)
T ss_pred             HHHHHHHHHHHhCCCcchhhee
Confidence            4799999999999999999983


No 92 
>KOG3705|consensus
Probab=80.10  E-value=1.1  Score=42.03  Aligned_cols=88  Identities=17%  Similarity=0.087  Sum_probs=52.8

Q ss_pred             ccchhhhhhhhhhcccc----cccccccccccccc-ceeeeeeeeccCCCCCCCCCccCCCcEEEEeeeeCCcCCeEEEE
Q psy3210         162 YFRSIVELICCYERNSL----IENFIGLNVRLQLP-FRQIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK  236 (272)
Q Consensus       162 ~F~sL~eLV~~y~~~~L----~~~~~~l~~~L~~P-~~~~~~~alydf~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~  236 (272)
                      +|.|-+.-|.|--...+    ...|..|+..--+- .....++++++-.++..+|+.++.||+|-|.+.-  +.|.-+|.
T Consensus       471 TFSSQVCRvaYEimQt~~pDa~~~FhSLDDIYYfGGQnAHn~ivi~aH~prt~~ei~l~vGD~vgvAGNH--WdGySKG~  548 (580)
T KOG3705|consen  471 TFSSQVCRVAYEIMQTSGPDAGSKFHSLDDIYYFGGQNAHNVIVIEAHIPRTNKEIDLKVGDKVGVAGNH--WDGYSKGT  548 (580)
T ss_pred             echHHHHHHHHHHHhccCCCcccccccccceeeecCccccceEEEEecCCCcccccCcccCCeeeecccc--cccccccc
Confidence            58887777766432221    12233333211111 1223467889999999999999999998776432  13444555


Q ss_pred             eC--Ceeeeeeccchhh
Q psy3210         237 ID--ERVSYFFQLYWGN  251 (272)
Q Consensus       237 ~~--g~~G~fP~~yVeE  251 (272)
                      ..  ++.|+||+-=|+|
T Consensus       549 Nr~t~~~GlfPSyKvre  565 (580)
T KOG3705|consen  549 NRQTYKEGLFPSYKVRE  565 (580)
T ss_pred             cccccccCCCccceeee
Confidence            43  6899999855554


No 93 
>KOG1011|consensus
Probab=80.10  E-value=0.31  Score=48.26  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=25.3

Q ss_pred             hhcccCCCceecCcCCcchhccc-ccCCCCC
Q psy3210          15 TLKSRGLRPLCSQACYLACHKQC-IPHTGRC   44 (272)
Q Consensus        15 ~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C   44 (272)
                      ||=|+..||.+|.-|+..||.+| -...+.|
T Consensus       192 llwglarqglrctqc~vk~hdkc~ell~adc  222 (1283)
T KOG1011|consen  192 LLWGLARQGLRCTQCQVKVHDKCRELLSADC  222 (1283)
T ss_pred             HHHHHhhcccchhhccccHHHHHHHHhhhHH
Confidence            68899999999999999999999 3334555


No 94 
>KOG0591|consensus
Probab=79.71  E-value=0.56  Score=42.46  Aligned_cols=21  Identities=24%  Similarity=0.047  Sum_probs=19.1

Q ss_pred             ccchhhhhhhccCCCCCcccc
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~  266 (272)
                      ...|+|+.++++|.|||||+.
T Consensus        63 q~~v~Ei~lLkQL~HpNIVqY   83 (375)
T KOG0591|consen   63 QDCVKEISLLKQLNHPNIVQY   83 (375)
T ss_pred             HHHHHHHHHHHhcCCchHHHH
Confidence            467999999999999999985


No 95 
>PRK10884 SH3 domain-containing protein; Provisional
Probab=79.44  E-value=2.5  Score=36.37  Aligned_cols=40  Identities=13%  Similarity=0.125  Sum_probs=31.8

Q ss_pred             ccCCCcEEEEeeeeCCcCCeEEEEe-CCeeeeeeccchhhhh
Q psy3210         213 PLKQGCQVIVLSKEGEQKGWWKGKI-DERVSYFFQLYWGNFR  253 (272)
Q Consensus       213 sl~~Gd~i~v~~k~ge~~gwW~G~~-~g~~G~fP~~yVeE~~  253 (272)
                      ++..|+.+++++..++ .||.+-+. +|+.||+++.|+....
T Consensus        49 ~l~~G~~v~vl~~~~~-~~w~~Vr~~~G~~GWV~~~~Ls~~p   89 (206)
T PRK10884         49 TLNAGEEVTLLQVNAN-TNYAQIRDSKGRTAWIPLKQLSTTP   89 (206)
T ss_pred             EEcCCCEEEEEEEcCC-CCEEEEEeCCCCEEeEEHHHhcCCc
Confidence            4778999999987653 47998875 5899999999987543


No 96 
>PF14603 hSH3:  Helically-extended SH3 domain; PDB: 1RI9_A.
Probab=79.20  E-value=4.4  Score=29.89  Aligned_cols=43  Identities=14%  Similarity=0.119  Sum_probs=26.5

Q ss_pred             CCCCCCCccCCCcEEEEeeeeCCcCCeEEEEe-CCeeeeeeccchh
Q psy3210         206 PTEANQLPLKQGCQVIVLSKEGEQKGWWKGKI-DERVSYFFQLYWG  250 (272)
Q Consensus       206 ~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~-~g~~G~fP~~yVe  250 (272)
                      .+..-+|.+..||+++|+....  .+-|-.+. .|+-|+++.+++-
T Consensus        27 k~G~kDLpi~~GE~LeVI~~t~--~~kvlCRN~~GKYGYV~~~~L~   70 (89)
T PF14603_consen   27 KWGGKDLPIKPGEILEVIQFTD--DNKVLCRNSEGKYGYVLRSHLL   70 (89)
T ss_dssp             ---TTB----TT-B-EEEEESS--SSEEEEEETTTEEEEEEGGGS-
T ss_pred             cCCcccCCcCCCCEEEEEEeCC--CCeEEEeCCCCceeEEEHHHcc
Confidence            4567899999999999997665  45666665 5899999999884


No 97 
>KOG0957|consensus
Probab=78.98  E-value=1.2  Score=42.77  Aligned_cols=20  Identities=20%  Similarity=0.413  Sum_probs=16.8

Q ss_pred             eecCcCCcchhcccccCCCC
Q psy3210          24 LCSQACYLACHKQCIPHTGR   43 (272)
Q Consensus        24 ~~c~~c~~~~h~~c~~~~~~   43 (272)
                      ..|.+|||.||.+|-++...
T Consensus       137 ~qCd~CGi~VHEgCYGv~dn  156 (707)
T KOG0957|consen  137 LQCDKCGINVHEGCYGVLDN  156 (707)
T ss_pred             eeccccCceecccccccccc
Confidence            46999999999999887633


No 98 
>KOG1094|consensus
Probab=78.24  E-value=0.86  Score=45.06  Aligned_cols=22  Identities=23%  Similarity=0.188  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+|.+|+++|.+|.|||||+|.
T Consensus       580 ~~F~kEIkiLsqLkhPNIveLv  601 (807)
T KOG1094|consen  580 NDFLKEIKILSRLKHPNIVELL  601 (807)
T ss_pred             HHHHHHHHHHhccCCCCeeEEE
Confidence            4799999999999999999984


No 99 
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=77.25  E-value=0.75  Score=29.27  Aligned_cols=24  Identities=17%  Similarity=0.310  Sum_probs=15.0

Q ss_pred             cccCCCceecC--cCCcchhcccccC
Q psy3210          17 KSRGLRPLCSQ--ACYLACHKQCIPH   40 (272)
Q Consensus        17 ~g~~~qg~~c~--~c~~~~h~~c~~~   40 (272)
                      |.+.-||.+|.  .|++..|..|+..
T Consensus         5 ~~iv~~G~~C~~~~C~~r~H~~C~~~   30 (43)
T PF08746_consen    5 KEIVTQGQRCSNRDCNVRLHDDCFKK   30 (43)
T ss_dssp             -SB-SSSEE-SS--S--EE-HHHHHH
T ss_pred             chhHeeeccCCCCccCchHHHHHHHH
Confidence            67889999999  5999999999654


No 100
>KOG0586|consensus
Probab=75.51  E-value=1.1  Score=44.00  Aligned_cols=20  Identities=20%  Similarity=0.074  Sum_probs=17.6

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +-.|+++|+.|+|||||||-
T Consensus       102 ~~rev~imk~l~HPnIvkl~  121 (596)
T KOG0586|consen  102 LGREVDIMKSLNHPNIVKLF  121 (596)
T ss_pred             HHHHHHHHHhcCCcceeeee
Confidence            45799999999999999983


No 101
>KOG0662|consensus
Probab=75.42  E-value=0.84  Score=38.75  Aligned_cols=24  Identities=25%  Similarity=0.054  Sum_probs=22.8

Q ss_pred             eeccchhhhhhhccCCCCCcccce
Q psy3210         244 FFQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       244 fP~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +|+.-++|+-++|.|.|.|||||+
T Consensus        44 vpssalreicllkelkhknivrl~   67 (292)
T KOG0662|consen   44 VPSSALREICLLKELKHKNIVRLH   67 (292)
T ss_pred             CcHHHHHHHHHHHHhhhcceeehh
Confidence            699999999999999999999996


No 102
>KOG0193|consensus
Probab=73.75  E-value=1.8  Score=42.82  Aligned_cols=45  Identities=11%  Similarity=0.088  Sum_probs=33.2

Q ss_pred             EeeeeCCc-CCeEEEEeCC----eeeeeec---cchhhhhhhccCCCCCcccc
Q psy3210         222 VLSKEGEQ-KGWWKGKIDE----RVSYFFQ---LYWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       222 v~~k~ge~-~gwW~G~~~g----~~G~fP~---~yVeE~~~mk~l~h~~~v~~  266 (272)
                      ..+.+|.+ .|.|.|++.-    .++..|+   .|-.|+.++|+=+|.||+=+
T Consensus       401 GsGsFGtV~Rg~whGdVAVK~Lnv~~pt~~qlqaFKnEVa~lkkTRH~NIlLF  453 (678)
T KOG0193|consen  401 GSGSFGTVYRGRWHGDVAVKLLNVDDPTPEQLQAFKNEVAVLKKTRHENILLF  453 (678)
T ss_pred             ccccccceeecccccceEEEEEecCCCCHHHHHHHHHHHHHHhhcchhhheee
Confidence            55677776 8899998762    3344443   56779999999999999743


No 103
>KOG0595|consensus
Probab=73.63  E-value=1.3  Score=41.79  Aligned_cols=21  Identities=29%  Similarity=0.297  Sum_probs=18.4

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +...|++++|++.|+|||+|-
T Consensus        55 ~L~~Ei~iLkel~H~nIV~l~   75 (429)
T KOG0595|consen   55 LLLSEIKILKELKHPNIVRLL   75 (429)
T ss_pred             HHHHHHHHHHhcCCcceeeEE
Confidence            456699999999999999984


No 104
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=73.32  E-value=0.97  Score=26.20  Aligned_cols=18  Identities=17%  Similarity=0.313  Sum_probs=8.9

Q ss_pred             CCceecCcCCcchhcccc
Q psy3210          21 LRPLCSQACYLACHKQCI   38 (272)
Q Consensus        21 ~qg~~c~~c~~~~h~~c~   38 (272)
                      .-.|.|..|...+|++|+
T Consensus        13 ~~~Y~C~~Cdf~lH~~Ca   30 (30)
T PF07649_consen   13 GWFYRCSECDFDLHEECA   30 (30)
T ss_dssp             --EEE-TTT-----HHHH
T ss_pred             CceEECccCCCccChhcC
Confidence            468999999999999984


No 105
>KOG0696|consensus
Probab=72.53  E-value=1.8  Score=41.27  Aligned_cols=36  Identities=22%  Similarity=0.310  Sum_probs=28.9

Q ss_pred             heehhcccCCCceecCcCCcchhccccc-CCCCCCCC
Q psy3210          12 SIVTLKSRGLRPLCSQACYLACHKQCIP-HTGRCGTG   47 (272)
Q Consensus        12 ~~~~~~g~~~qg~~c~~c~~~~h~~c~~-~~~~C~~~   47 (272)
                      -+-++=|..+||..|.+|...|||.|-+ ++=.|.+.
T Consensus        62 CkDFiwGfgKQGfQCqvC~fvvHkrChefVtF~CPGa   98 (683)
T KOG0696|consen   62 CKDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGA   98 (683)
T ss_pred             hhhheeccccCceeeeEEeehhhhhhcceEEEECCCC
Confidence            3456779999999999999999999944 45677654


No 106
>KOG0584|consensus
Probab=72.50  E-value=0.91  Score=44.83  Aligned_cols=56  Identities=23%  Similarity=0.206  Sum_probs=33.9

Q ss_pred             cCCCcEEEEeeeeCCcCCe---EEEEeCCeeeeee---ccchhhhhhhccCCCCCcccceec
Q psy3210         214 LKQGCQVIVLSKEGEQKGW---WKGKIDERVSYFF---QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       214 l~~Gd~i~v~~k~ge~~gw---W~G~~~g~~G~fP---~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      |.+|..-+|..-+++..|.   |.-..-....-.|   ..|-+|++++|.|.|+||||+-.|
T Consensus        48 LGrGafKtVYka~De~~giEVAWnqvk~~d~~q~~~~leR~~~Ev~lLKsL~H~NIirfy~S  109 (632)
T KOG0584|consen   48 LGRGAFKTVYKAFDEEEGIEVAWNQVKIRDVTQSPEELERLYSEVHLLKSLKHPNIIRFYDS  109 (632)
T ss_pred             cccccceeeeeccccccchhhHHHHHhHHHhhcChHHHHHHHHHHHHHccCCCCceeeeeeh
Confidence            5567766777666654221   3221111111122   247789999999999999999543


No 107
>KOG0694|consensus
Probab=71.51  E-value=1.7  Score=43.44  Aligned_cols=33  Identities=21%  Similarity=0.354  Sum_probs=29.8

Q ss_pred             hhcccCCCceecCcCCcchhccc-ccCCCCCCCC
Q psy3210          15 TLKSRGLRPLCSQACYLACHKQC-IPHTGRCGTG   47 (272)
Q Consensus        15 ~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~~   47 (272)
                      +|.|+..||-.|..|++.||..| -.+.+.|+.+
T Consensus       250 ~L~r~~qqGlkCs~Cg~n~H~~c~~~va~~CG~s  283 (694)
T KOG0694|consen  250 VLYRLRQQGLKCSTCGRNVHNRCVENLAPNCGGS  283 (694)
T ss_pred             hhhhhcccCeeehhhhccccHHHHHhcccCCCCc
Confidence            67899999999999999999999 7778899875


No 108
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=71.28  E-value=5.2  Score=35.50  Aligned_cols=22  Identities=23%  Similarity=0.003  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+++|+++++++.|+|||++.-
T Consensus        50 ~~~~E~~~l~~l~h~~iv~~~~   71 (309)
T cd07872          50 TAIREVSLLKDLKHANIVTLHD   71 (309)
T ss_pred             hHHHHHHHHHhCCCCCcceEEE
Confidence            5778999999999999999853


No 109
>PF13922 PHD_3:  PHD domain of transcriptional enhancer, Asx
Probab=70.73  E-value=1.1  Score=31.09  Aligned_cols=20  Identities=35%  Similarity=0.796  Sum_probs=16.3

Q ss_pred             ecCcCCcchhcccccCCCCC
Q psy3210          25 CSQACYLACHKQCIPHTGRC   44 (272)
Q Consensus        25 ~c~~c~~~~h~~c~~~~~~C   44 (272)
                      .|+.||+.+|-.||+-..-|
T Consensus        45 ~Cq~CGAFCHDDCIgpskLC   64 (69)
T PF13922_consen   45 MCQGCGAFCHDDCIGPSKLC   64 (69)
T ss_pred             HHhhccchhccccccHHHHh
Confidence            59999999999998755443


No 110
>KOG1187|consensus
Probab=70.68  E-value=1.8  Score=40.34  Aligned_cols=22  Identities=23%  Similarity=0.234  Sum_probs=20.1

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+|..|+.++.+++|+|||+|.
T Consensus       116 ~eF~~Ei~~ls~l~H~Nlv~Ll  137 (361)
T KOG1187|consen  116 REFLNEVEILSRLRHPNLVKLL  137 (361)
T ss_pred             hHHHHHHHHHhcCCCcCcccEE
Confidence            4599999999999999999984


No 111
>PHA03211 serine/threonine kinase US3; Provisional
Probab=70.12  E-value=5.4  Score=38.45  Aligned_cols=48  Identities=15%  Similarity=0.036  Sum_probs=30.4

Q ss_pred             EEeeeeCCc--CCeEEEEeCC---eeee---eeccchhhhhhhccCCCCCccccee
Q psy3210         221 IVLSKEGEQ--KGWWKGKIDE---RVSY---FFQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       221 ~v~~k~ge~--~gwW~G~~~g---~~G~---fP~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+.+.+|.+  ..+|++....   +..+   ....++.|+++|+++.|+|||++.-
T Consensus       172 ~i~~~Lg~G~~G~Vy~a~~~~~~~~vavK~~~~~~~~~E~~iL~~L~HpnIv~l~~  227 (461)
T PHA03211        172 AIHRALTPGSEGCVFESSHPDYPQRVVVKAGWYASSVHEARLLRRLSHPAVLALLD  227 (461)
T ss_pred             EEEEEEccCCCeEEEEEEECCCCCEEEEecccccCHHHHHHHHHHCCCCCCCcEEE
Confidence            345555543  2357776542   1111   1234678999999999999999874


No 112
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=69.32  E-value=3.9  Score=35.15  Aligned_cols=24  Identities=13%  Similarity=0.130  Sum_probs=20.6

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..|.+|+++|+++.|+|+|+++-.
T Consensus        46 ~~~~~e~~~l~~l~~~~i~~~~~~   69 (260)
T cd05073          46 EAFLAEANVMKTLQHDKLVKLHAV   69 (260)
T ss_pred             HHHHHHHHHHHhcCCCCcceEEEE
Confidence            457889999999999999998644


No 113
>PHA03212 serine/threonine kinase US3; Provisional
Probab=69.13  E-value=6.2  Score=36.93  Aligned_cols=22  Identities=9%  Similarity=-0.087  Sum_probs=19.6

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|||||++.-
T Consensus       129 ~~~~E~~il~~l~HpnIv~~~~  150 (391)
T PHA03212        129 GTATEAHILRAINHPSIIQLKG  150 (391)
T ss_pred             hhHHHHHHHHhCCCCCCCCEeE
Confidence            4678999999999999999964


No 114
>COG3103 SH3 domain protein [Signal transduction mechanisms]
Probab=68.57  E-value=7.6  Score=33.38  Aligned_cols=42  Identities=19%  Similarity=0.332  Sum_probs=34.2

Q ss_pred             ccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhhhhhh
Q psy3210         213 PLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGNFRLL  255 (272)
Q Consensus       213 sl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE~~~m  255 (272)
                      ++++||.++|+++.+. .||...... |+.||++..++.+....
T Consensus        49 ~i~~Ge~vtvl~~~~~-~~~~qI~~~~g~t~wi~~~~lt~e~s~   91 (205)
T COG3103          49 SIKAGEKVTVLGTDGN-TGYYQIRDSSGRTGWILSKNLTSEPSS   91 (205)
T ss_pred             EecCCcEEEEEEEcCc-ccEEEEEecCCceEEEechhhcccccc
Confidence            4778999999998885 479999886 89999999988755443


No 115
>KOG3508|consensus
Probab=68.57  E-value=6.3  Score=40.93  Aligned_cols=55  Identities=24%  Similarity=0.298  Sum_probs=39.8

Q ss_pred             cccEeeeeCCHHHHHHhccc-CCCceEEEEeCCCCCCCCCCCceEEEEeeC-CeeeEEEEEE
Q psy3210          87 EYLWFVGEMGREKATSLLER-EADGTYLLRIRPQGPTHPNETIYALSLKTD-EKVKHMKVYE  146 (272)
Q Consensus        87 ~~~Wf~g~isR~~Ae~lL~~-~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~-~~v~H~~I~~  146 (272)
                      .-.||+|++.|.-|+..+.. ...|.|+||++...     ++.+.++.--. +.+-|.++..
T Consensus        80 ~~~~~~~~lrr~i~e~r~r~~e~s~~~wi~e~~~l-----p~~~~l~~~~~~d~~l~~r~~s  136 (932)
T KOG3508|consen   80 ERKWYMENLRRTIAESRLRRAENSGSYWIREAKRL-----PGKGKLSCLLQLDGTLYARTIS  136 (932)
T ss_pred             hhhhhhcchhhhcccchhhccCCceeEEeeccCcC-----CCcceeehhhccchhHHhhhhh
Confidence            34799999999999999765 45689999999755     46676665432 2266666654


No 116
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=68.32  E-value=4  Score=34.97  Aligned_cols=24  Identities=25%  Similarity=0.160  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+.+|+++++.+.|+|+|++...
T Consensus        46 ~~~~~e~~~l~~l~h~~i~~~~~~   69 (261)
T cd05072          46 QAFLEEANLMKTLQHDKLVRLYAV   69 (261)
T ss_pred             HHHHHHHHHHHhCCCCCeeeEEEE
Confidence            356789999999999999998643


No 117
>PF02762 Cbl_N3:  CBL proto-oncogene N-terminus, SH2-like domain;  InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface. The N-terminal region of Cbl contains a Cbl-type phosphotyrosine-binding (Cbl-PTB) domain, which is composed of three evolutionarily conserved domains: an N-terminal four-helix bundle (4H) domain, an EF hand-like calcium-binding domain, and a divergent SH2-like domain. The calcium-bound EF-hand wedges between the 4H and SH2 domains, and roughly determines their relative orientation. The Cbl-PTB domain has also been named Cbl N-terminal (Cbl-N) or tyrosine kinase binding (TKB) domain [, ]. The N-terminal 4H domain contains four long alpha-helices. The C and D helices in this domain pack against the adjacent EF-hand-like domain, and a highly conserved loop connecting the A and B helices contacts the SH2-like domain. The EF-hand motif is similar to classical EF-hand proteins. The SH2-like domain retains the general helix-sheet-helix architecture of the SH2 fold, but lacks the secondary beta-sheet, comprising beta-strands D', E and F, and also a prominent BG loop [].  This entry represents the SH2-like domain.; PDB: 3PFV_A 3VGO_A 3PLF_B 2Y1M_A 2CBL_A 3BUX_B 3BUN_B 3BUM_B 3OB1_B 3BUW_B ....
Probab=68.10  E-value=18  Score=26.05  Aligned_cols=42  Identities=14%  Similarity=0.301  Sum_probs=31.5

Q ss_pred             cEeeeeCCHHHHHHhccc--CCCceEEEEeCCCCCCCCCCCceEEEEee
Q psy3210          89 LWFVGEMGREKATSLLER--EADGTYLLRIRPQGPTHPNETIYALSLKT  135 (272)
Q Consensus        89 ~Wf~g~isR~~Ae~lL~~--~~~G~FLVR~s~~~~~~~~~~~y~LSv~~  135 (272)
                      |=|...|+-+|+...|+.  ...|+|+.|-|.     +.-|.++|-...
T Consensus         3 pgY~AFlTYdevk~~L~~~~~kpGsYiFRlSC-----TrLGQWAIGyV~   46 (86)
T PF02762_consen    3 PGYMAFLTYDEVKARLQHYRDKPGSYIFRLSC-----TRLGQWAIGYVT   46 (86)
T ss_dssp             TTBETT--HHHHHHHHGGGTTSTTEEEEEEES-----SSTTSEEEEEEE
T ss_pred             CceeEEEeHHHHHHHHHHHhCCcccEEEeecc-----ccccceeEEEEc
Confidence            346667889999999975  567999999997     446899887655


No 118
>KOG1025|consensus
Probab=67.90  E-value=2  Score=44.19  Aligned_cols=21  Identities=19%  Similarity=-0.035  Sum_probs=19.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ++++||-+|.++.||||+||.
T Consensus       744 e~LdeAl~masldHpnl~RLL  764 (1177)
T KOG1025|consen  744 ELLDEALRMASLDHPNLLRLL  764 (1177)
T ss_pred             HHHHHHHHHhcCCCchHHHHh
Confidence            689999999999999999985


No 119
>PRK00420 hypothetical protein; Validated
Probab=67.42  E-value=1.8  Score=33.59  Aligned_cols=40  Identities=15%  Similarity=0.090  Sum_probs=34.1

Q ss_pred             cccchheehhcccCCCceecCcCCcchh--cccccCCCCCCC
Q psy3210           7 NLRSISIVTLKSRGLRPLCSQACYLACH--KQCIPHTGRCGT   46 (272)
Q Consensus         7 ~~~~~~~~~~~g~~~qg~~c~~c~~~~h--~~c~~~~~~C~~   46 (272)
                      ..+.++..||+|--..+..|+.||...=  ++.--.++.|+.
T Consensus         7 ~~k~~a~~Ll~Ga~ml~~~CP~Cg~pLf~lk~g~~~Cp~Cg~   48 (112)
T PRK00420          7 IVKKAAELLLKGAKMLSKHCPVCGLPLFELKDGEVVCPVHGK   48 (112)
T ss_pred             HHHHHHHHHHhHHHHccCCCCCCCCcceecCCCceECCCCCC
Confidence            4567888999999999999999998776  577788899987


No 120
>PF06347 SH3_4:  Bacterial SH3 domain;  InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This family consists of several hypothetical bacterial proteins of unknown function, but that contain an SH-3 region.
Probab=67.22  E-value=12  Score=24.48  Aligned_cols=35  Identities=29%  Similarity=0.518  Sum_probs=27.7

Q ss_pred             CccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccch
Q psy3210         212 LPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYW  249 (272)
Q Consensus       212 Lsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yV  249 (272)
                      ..+.+|..+.++...+   +|.+-+.+|..||++...|
T Consensus        19 ~~l~~g~~v~v~~~~~---~W~~V~~~g~~GWv~~~~l   53 (55)
T PF06347_consen   19 ARLEPGVPVRVIECRG---GWCKVRADGRTGWVHKSLL   53 (55)
T ss_pred             EEECCCCEEEEEEccC---CeEEEEECCeEEeEEeeec
Confidence            3467788888886654   6999998899999988654


No 121
>KOG1026|consensus
Probab=67.11  E-value=2.1  Score=43.68  Aligned_cols=22  Identities=32%  Similarity=0.205  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+|-+||.+|..|.|+|||||.
T Consensus       534 ~dF~REaeLla~l~H~nIVrLl  555 (774)
T KOG1026|consen  534 QDFRREAELLAELQHPNIVRLL  555 (774)
T ss_pred             HHHHHHHHHHHhccCCCeEEEE
Confidence            5799999999999999999984


No 122
>KOG0593|consensus
Probab=66.77  E-value=1.9  Score=39.45  Aligned_cols=19  Identities=26%  Similarity=0.193  Sum_probs=17.4

Q ss_pred             chhhhhhhccCCCCCcccc
Q psy3210         248 YWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~  266 (272)
                      =++|++++|+|.|+|||.|
T Consensus        48 AlREIrmLKqLkH~NLVnL   66 (396)
T KOG0593|consen   48 ALREIRMLKQLKHENLVNL   66 (396)
T ss_pred             HHHHHHHHHhcccchHHHH
Confidence            4789999999999999976


No 123
>KOG0033|consensus
Probab=66.65  E-value=2.3  Score=37.92  Aligned_cols=23  Identities=26%  Similarity=0.001  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..-+||+|-+.|.|||||||+=+
T Consensus        56 ~l~rEarIC~~LqHP~IvrL~~t   78 (355)
T KOG0033|consen   56 KLEREARICRKLQHPNIVRLHDS   78 (355)
T ss_pred             HHHHHHHHHHhcCCCcEeehhhh
Confidence            34569999999999999999743


No 124
>KOG4250|consensus
Probab=66.17  E-value=2.1  Score=42.98  Aligned_cols=20  Identities=20%  Similarity=0.203  Sum_probs=17.7

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      -..|+++||||.|+|||++-
T Consensus        58 ~~~EieilkKLnh~NIVk~f   77 (732)
T KOG4250|consen   58 WCREIEILKKLNHPNIVKLF   77 (732)
T ss_pred             HHHHHHHHHHcCchhhhhhc
Confidence            46799999999999999873


No 125
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=65.54  E-value=3  Score=35.82  Aligned_cols=24  Identities=13%  Similarity=0.023  Sum_probs=20.7

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      +..|..|+++|+++.|+|++++.-
T Consensus        45 ~~~~~~E~~~l~~l~~~~i~~~~~   68 (260)
T cd05070          45 PESFLEEAQIMKKLRHDKLVQLYA   68 (260)
T ss_pred             HHHHHHHHHHHHhcCCCceEEEEe
Confidence            456888999999999999999863


No 126
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=63.31  E-value=6.3  Score=33.79  Aligned_cols=24  Identities=8%  Similarity=0.023  Sum_probs=20.6

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+|..|+++++++.|+|++++.-
T Consensus        45 ~~~~~~e~~~l~~l~h~~i~~~~~   68 (261)
T cd05068          45 PKDFLAEAQIMKKLRHPKLIQLYA   68 (261)
T ss_pred             HHHHHHHHHHHHHCCCCCccceeE
Confidence            356888999999999999999763


No 127
>KOG4384|consensus
Probab=63.15  E-value=3.7  Score=37.89  Aligned_cols=62  Identities=26%  Similarity=0.424  Sum_probs=47.1

Q ss_pred             ccccccceeeeeeeeccC--CCCCCCCCccCCCcEEEEeeeeCCcCCeEEEEeCCeeeeeeccchhh
Q psy3210         187 VRLQLPFRQIIAVAEFDF--CPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGN  251 (272)
Q Consensus       187 ~~L~~P~~~~~~~alydf--~~~~~~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~g~~G~fP~~yVeE  251 (272)
                      +....|+.. .+++.=+|  ...+.++|.+++||+|.++.+-+  .|-|.|-.+++.|-|+-.||.+
T Consensus       129 ~~y~~p~c~-~~~~~t~~tp~p~~~d~lk~~~~~~i~~~~~~~--~~~~~g~~~~kv~~f~~~~v~~  192 (361)
T KOG4384|consen  129 PPYSGPFCG-RARVHTDFTPSPYDTDSLKIKKGDIIDIIEKPP--MGTWLGLLNNKVGSFKFIYVDV  192 (361)
T ss_pred             CCCCCCccc-cccccccCCCCcccccchhhcccchhhccccCc--cccccccccCcccccccceecc
Confidence            344455432 24444455  45578999999999999998887  7899999999999999888873


No 128
>KOG3812|consensus
Probab=63.09  E-value=2.4  Score=38.98  Aligned_cols=36  Identities=11%  Similarity=0.367  Sum_probs=30.1

Q ss_pred             CCCccCCCcEEEEeeeeCCcCCeEEEEeC---Ceeeeeecc
Q psy3210         210 NQLPLKQGCQVIVLSKEGEQKGWWKGKID---ERVSYFFQL  247 (272)
Q Consensus       210 ~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~---g~~G~fP~~  247 (272)
                      ..++|...|++.|..|+.  .+||-|++.   ...||+|+.
T Consensus        80 ~aisF~~kDFlHIkeKyn--nDWWIGRlVkeg~e~gFiPsp  118 (475)
T KOG3812|consen   80 HAISFEAKDFLHIKEKYN--NDWWIGRLVKEGCEIGFIPSP  118 (475)
T ss_pred             ceeeeccccceeehhhcc--cchhHHHHhhcCCccccccch
Confidence            457899999999999998  569999975   478999973


No 129
>smart00743 Agenet Tudor-like domain present in plant sequences. Domain in plant sequences with possible chromatin-associated functions.
Probab=63.01  E-value=11  Score=25.27  Aligned_cols=24  Identities=38%  Similarity=0.800  Sum_probs=19.1

Q ss_pred             ccCCCcEEEEeeeeCCcCCeEEEEeC
Q psy3210         213 PLKQGCQVIVLSKEGEQKGWWKGKID  238 (272)
Q Consensus       213 sl~~Gd~i~v~~k~ge~~gwW~G~~~  238 (272)
                      .|+.||.|.+....+  .+||.|.+.
T Consensus         2 ~~~~G~~Ve~~~~~~--~~W~~a~V~   25 (61)
T smart00743        2 DFKKGDRVEVFSKEE--DSWWEAVVT   25 (61)
T ss_pred             CcCCCCEEEEEECCC--CEEEEEEEE
Confidence            478899999986544  679999875


No 130
>PHA02988 hypothetical protein; Provisional
Probab=62.67  E-value=3.3  Score=36.54  Aligned_cols=22  Identities=5%  Similarity=-0.082  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .|.+|+++|+++.|+|||++.-
T Consensus        64 ~~~~E~~~l~~l~h~nIv~~~g   85 (283)
T PHA02988         64 ITENEIKNLRRIDSNNILKIYG   85 (283)
T ss_pred             HHHHHHHHHHhcCCCCEEEEee
Confidence            4558999999999999999873


No 131
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=61.68  E-value=11  Score=26.99  Aligned_cols=28  Identities=36%  Similarity=0.736  Sum_probs=19.6

Q ss_pred             CCccCCCcEEEEeeee----CCcCCeEEEEeC
Q psy3210         211 QLPLKQGCQVIVLSKE----GEQKGWWKGKID  238 (272)
Q Consensus       211 ELsl~~Gd~i~v~~k~----ge~~gwW~G~~~  238 (272)
                      -|+++.||.+.|....    ..+..||.|++-
T Consensus         3 FL~Vk~Gd~ViV~~~~~~~~~~~~dWWmg~Vi   34 (75)
T PF11302_consen    3 FLSVKPGDTVIVQDEQEVGQKQDKDWWMGQVI   34 (75)
T ss_pred             ccccCCCCEEEEecCccccccCCCCcEEEEEE
Confidence            4778899998776432    112789999863


No 132
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=61.34  E-value=6.7  Score=33.50  Aligned_cols=23  Identities=13%  Similarity=0.089  Sum_probs=20.1

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|+++++-
T Consensus        46 ~~~~~e~~~l~~l~h~~i~~~~~   68 (261)
T cd05034          46 EAFLQEAQIMKKLRHDKLVQLYA   68 (261)
T ss_pred             HHHHHHHHHHhhCCCCCEeeeee
Confidence            46788999999999999999863


No 133
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=61.23  E-value=6.7  Score=33.82  Aligned_cols=24  Identities=13%  Similarity=0.033  Sum_probs=20.4

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      +..|..|+++++.+.|+|++++.-
T Consensus        45 ~~~~~~E~~~l~~l~~~~i~~~~~   68 (262)
T cd05071          45 PEAFLQEAQVMKKLRHEKLVQLYA   68 (262)
T ss_pred             HHHHHHHHHHHHhCCCCCcceEEE
Confidence            345788999999999999999864


No 134
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=60.67  E-value=10  Score=33.46  Aligned_cols=23  Identities=22%  Similarity=-0.032  Sum_probs=19.7

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|||++.=
T Consensus        49 ~~~~~E~~~l~~l~h~nI~~~~~   71 (301)
T cd07873          49 CTAIREVSLLKDLKHANIVTLHD   71 (301)
T ss_pred             hHHHHHHHHHHhcCCCCcceEEE
Confidence            35678999999999999999863


No 135
>KOG2996|consensus
Probab=60.51  E-value=3.8  Score=40.38  Aligned_cols=40  Identities=23%  Similarity=0.452  Sum_probs=31.2

Q ss_pred             CCCccCCCcEEEEeeeeCCcCCeEEEEeC--Ceeeeeeccchh
Q psy3210         210 NQLPLKQGCQVIVLSKEGEQKGWWKGKID--ERVSYFFQLYWG  250 (272)
Q Consensus       210 ~ELsl~~Gd~i~v~~k~ge~~gwW~G~~~--g~~G~fP~~yVe  250 (272)
                      --|.|..||+++++.-..+ ..||.|...  +..|+||++=|+
T Consensus       625 P~l~~~~gdvlel~~~d~~-s~~w~gr~~~sr~sg~fpss~vk  666 (865)
T KOG2996|consen  625 PRLVLQEGDVLELLKGDAE-SSWWEGRNHGSRESGNFPSSTVK  666 (865)
T ss_pred             CceEecCCceeehhcCCCC-CcccccCCccCCccCCCCccccC
Confidence            4577889999988854433 689999976  478999998776


No 136
>KOG0193|consensus
Probab=58.15  E-value=3.1  Score=41.29  Aligned_cols=32  Identities=16%  Similarity=0.233  Sum_probs=27.3

Q ss_pred             hhcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          15 TLKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        15 ~~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      +=++++.+|.+|.-|+..+|+.| -.++..|..
T Consensus       195 ~~~~~l~~gfrC~~C~~KfHq~Cs~~vp~~C~~  227 (678)
T KOG0193|consen  195 CCNKFLFTGFRCQTCGYKFHQSCSPRVPTSCVN  227 (678)
T ss_pred             hcchhhhcccccCCCCCccccccCCCCCCCCCC
Confidence            34678899999999999999999 667788873


No 137
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=57.82  E-value=9.7  Score=32.51  Aligned_cols=25  Identities=12%  Similarity=-0.035  Sum_probs=21.8

Q ss_pred             eccchhhhhhhccCCCCCcccceec
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+|..|+++|++++|+|||++...
T Consensus        43 ~~~~~~e~~~l~~l~h~~i~~~~~~   67 (256)
T cd05114          43 EEDFIEEAKVMMKLSHPKLVQLYGV   67 (256)
T ss_pred             HHHHHHHHHHHHHCCCCCceeEEEE
Confidence            4578889999999999999998754


No 138
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=57.69  E-value=4.6  Score=35.28  Aligned_cols=23  Identities=9%  Similarity=0.050  Sum_probs=20.5

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|.+|+.++++++|+|||+++-
T Consensus        61 ~~~~~~~~~~~~l~h~niv~~~~   83 (274)
T cd05076          61 LAFFETASLMSQVSHIHLAFVHG   83 (274)
T ss_pred             HHHHHHHHHHhcCCCCCeeeEEE
Confidence            46888999999999999999875


No 139
>PHA03209 serine/threonine kinase US3; Provisional
Probab=57.65  E-value=13  Score=34.05  Aligned_cols=21  Identities=14%  Similarity=0.028  Sum_probs=18.4

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ....|+.+++++.|+|||++.
T Consensus       103 ~~~~E~~~l~~l~h~~iv~~~  123 (357)
T PHA03209        103 TTLIEAMLLQNVNHPSVIRMK  123 (357)
T ss_pred             ccHHHHHHHHhCCCCCCcChh
Confidence            346799999999999999986


No 140
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=57.13  E-value=7.2  Score=33.41  Aligned_cols=22  Identities=23%  Similarity=0.241  Sum_probs=19.7

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|..|+.+|+++.|+|++++.
T Consensus        46 ~~~~~E~~~l~~l~h~~i~~~~   67 (260)
T cd05067          46 EAFLAEANLMKQLQHPRLVRLY   67 (260)
T ss_pred             HHHHHHHHHHHhcCCcCeeeEE
Confidence            4678899999999999999875


No 141
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=57.10  E-value=4  Score=35.81  Aligned_cols=22  Identities=18%  Similarity=0.016  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .|..|+++++++.|+|++++.-
T Consensus        55 ~~~~e~~~l~~l~h~~i~~~~~   76 (292)
T cd06644          55 DYMVEIEILATCNHPYIVKLLG   76 (292)
T ss_pred             HHHHHHHHHHhCCCCcEeeeEE
Confidence            5677999999999999999763


No 142
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=56.98  E-value=18  Score=32.55  Aligned_cols=22  Identities=14%  Similarity=-0.144  Sum_probs=18.9

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|||++.-
T Consensus        64 ~~~~E~~~l~~l~hp~iv~~~~   85 (329)
T PTZ00263         64 HVAQEKSILMELSHPFIVNMMC   85 (329)
T ss_pred             HHHHHHHHHHhCCCCCCCcEEE
Confidence            3567999999999999999863


No 143
>KOG0611|consensus
Probab=56.96  E-value=4.5  Score=38.54  Aligned_cols=18  Identities=17%  Similarity=0.187  Sum_probs=16.5

Q ss_pred             hhhhhhccCCCCCcccce
Q psy3210         250 GNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       250 eE~~~mk~l~h~~~v~~~  267 (272)
                      .|++||..|+||||+++.
T Consensus       102 REIeIMSsLNHPhII~Iy  119 (668)
T KOG0611|consen  102 REIEIMSSLNHPHIIQIY  119 (668)
T ss_pred             HHHHHHhhcCCCceeehh
Confidence            599999999999999875


No 144
>PRK13914 invasion associated secreted endopeptidase; Provisional
Probab=55.54  E-value=15  Score=35.63  Aligned_cols=43  Identities=21%  Similarity=0.356  Sum_probs=33.4

Q ss_pred             ccCCCcEEEEeeeeCCcCCeEEEEeC-Ceeeeeeccchhhhhhhcc
Q psy3210         213 PLKQGCQVIVLSKEGEQKGWWKGKID-ERVSYFFQLYWGNFRLLSS  257 (272)
Q Consensus       213 sl~~Gd~i~v~~k~ge~~gwW~G~~~-g~~G~fP~~yVeE~~~mk~  257 (272)
                      +|.+|+.|+|++...  .||++-+++ |+.||+-..||..-..|..
T Consensus       104 sl~~G~~V~Vl~~~~--ngW~kI~~~~GktGwV~~~YLs~~~~~~~  147 (481)
T PRK13914        104 SIKGGTKVTVETTES--NGWHKITYNDGKTGFVNGKYLTDKVTSTP  147 (481)
T ss_pred             eecCCCEEEEeeccc--CCeEEEEcCCCCEEEEecccccCCCccCc
Confidence            577899999975322  579999996 8999999999986444443


No 145
>KOG3667|consensus
Probab=55.28  E-value=20  Score=36.10  Aligned_cols=52  Identities=23%  Similarity=0.344  Sum_probs=37.2

Q ss_pred             cEeeeeCCHHHHHHhcccCCCceEEEEeCCCCCCCCCCCceEEEEeeC-CeeeEEEEE
Q psy3210          89 LWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTD-EKVKHMKVY  145 (272)
Q Consensus        89 ~Wf~g~isR~~Ae~lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~-~~v~H~~I~  145 (272)
                      ....|.++++.+.++|...++|+|++|-|++.     .|..++..... ....|+-|.
T Consensus       564 g~Imgfinkq~~~~ll~~~~~GtflLrfs~S~-----~GgiT~~~v~~~~~~~~~~i~  616 (682)
T KOG3667|consen  564 GVIMGFINKQQERALLMTKPDGTFLLRFSASE-----EGGITIAWVEDQKQNLIMMIM  616 (682)
T ss_pred             ceeeeecchhhhhhhhhcCCCCCceeeeeccc-----cCceeEEecccccccceeEec
Confidence            44578999999999999999999999999742     46555544442 222466665


No 146
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=53.00  E-value=5.1  Score=34.65  Aligned_cols=22  Identities=18%  Similarity=0.234  Sum_probs=19.2

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|.+|++.|++++|+|||++.
T Consensus        46 ~~~~~e~~~l~~l~h~ni~~~~   67 (259)
T PF07714_consen   46 EEFLNEIQILRKLRHPNIVKLY   67 (259)
T ss_dssp             HHHHHHHHHHHTHSBTTBE-EE
T ss_pred             eeeeeccccccccccccccccc
Confidence            4789999999999999999986


No 147
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=52.57  E-value=6.6  Score=33.94  Aligned_cols=23  Identities=17%  Similarity=0.014  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|++|+++|+++.|+|||++.-
T Consensus        51 ~~~~~e~~~l~~l~h~~iv~~~~   73 (266)
T cd05064          51 RGFLAEALTLGQFDHSNIVRLEG   73 (266)
T ss_pred             HHHHHHHHHHhcCCCCCcCeEEE
Confidence            35788999999999999999864


No 148
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=50.49  E-value=6.9  Score=34.58  Aligned_cols=21  Identities=24%  Similarity=0.210  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|.+|+++|+++.|+|||++.
T Consensus        65 ~~~~E~~~l~~l~h~niv~~~   85 (304)
T cd05096          65 DFLKEVKILSRLKDPNIIRLL   85 (304)
T ss_pred             HHHHHHHHHhhcCCCCeeEEE
Confidence            578899999999999999985


No 149
>PHA03207 serine/threonine kinase US3; Provisional
Probab=49.54  E-value=22  Score=33.00  Aligned_cols=20  Identities=10%  Similarity=0.019  Sum_probs=17.9

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ...|+++|++++|+|||++.
T Consensus       133 ~~~E~~il~~l~h~~iv~~~  152 (392)
T PHA03207        133 PGREIDILKTISHRAIINLI  152 (392)
T ss_pred             HHHHHHHHHhcCCCCcccee
Confidence            45799999999999999985


No 150
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=49.20  E-value=7.4  Score=34.54  Aligned_cols=22  Identities=18%  Similarity=0.012  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ....|+++|+++.|+|||++.-
T Consensus        44 ~~~~E~~~l~~l~h~niv~~~~   65 (317)
T cd07868          44 SACREIALLRELKHPNVISLQK   65 (317)
T ss_pred             HHHHHHHHHHhcCCCCCcceee
Confidence            4678999999999999999854


No 151
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=48.65  E-value=7.7  Score=34.05  Aligned_cols=23  Identities=22%  Similarity=-0.026  Sum_probs=20.0

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..++.|+++++++.|+|||++.-
T Consensus        48 ~~~~~E~~~l~~l~h~niv~~~~   70 (288)
T cd07871          48 CTAIREVSLLKNLKHANIVTLHD   70 (288)
T ss_pred             hhHHHHHHHHHhCCCCCEeeEEE
Confidence            35778999999999999999863


No 152
>KOG4717|consensus
Probab=48.46  E-value=7  Score=38.44  Aligned_cols=21  Identities=19%  Similarity=0.137  Sum_probs=18.8

Q ss_pred             ccchhhhhhhccCCCCCcccc
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~  266 (272)
                      ....+|++-||-..|||||||
T Consensus        62 ~hlfqEVRCMKLVQHpNiVRL   82 (864)
T KOG4717|consen   62 GHLFQEVRCMKLVQHPNIVRL   82 (864)
T ss_pred             hHHHHHHHHHHHhcCcCeeee
Confidence            456789999999999999998


No 153
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=48.38  E-value=7.5  Score=33.75  Aligned_cols=23  Identities=22%  Similarity=0.004  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|++++++++|+|+|++.-
T Consensus        44 ~~~~~E~~~l~~l~h~~i~~~~~   66 (284)
T cd07860          44 STAIREISLLKELNHPNIVKLLD   66 (284)
T ss_pred             hHHHHHHHHHHhcCCCCCcchhh
Confidence            46888999999999999999863


No 154
>PTZ00036 glycogen synthase kinase; Provisional
Probab=48.03  E-value=23  Score=33.62  Aligned_cols=19  Identities=11%  Similarity=0.090  Sum_probs=16.8

Q ss_pred             hhhhhhhccCCCCCcccce
Q psy3210         249 WGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       249 VeE~~~mk~l~h~~~v~~~  267 (272)
                      -+|+.+|+++.|+|||++.
T Consensus       107 ~~Ei~il~~l~h~niv~l~  125 (440)
T PTZ00036        107 NRELLIMKNLNHINIIFLK  125 (440)
T ss_pred             HHHHHHHHhcCCCCCccee
Confidence            3599999999999999973


No 155
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=47.38  E-value=4.9  Score=25.32  Aligned_cols=25  Identities=8%  Similarity=0.058  Sum_probs=21.5

Q ss_pred             cchheehhcccCCCceecCcCCcch
Q psy3210           9 RSISIVTLKSRGLRPLCSQACYLAC   33 (272)
Q Consensus         9 ~~~~~~~~~g~~~qg~~c~~c~~~~   33 (272)
                      ..|+..+|+|-..-+..|+.|+...
T Consensus         3 k~m~~~LL~G~~ML~~~Cp~C~~PL   27 (41)
T PF06677_consen    3 KKMGEYLLQGWTMLDEHCPDCGTPL   27 (41)
T ss_pred             HHHHHHHHHhHhHhcCccCCCCCee
Confidence            4688899999999999999997654


No 156
>KOG0575|consensus
Probab=47.32  E-value=8.4  Score=38.11  Aligned_cols=20  Identities=15%  Similarity=0.036  Sum_probs=17.7

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      -..|++|-++|.|||||+|+
T Consensus        65 v~~EIeIHr~L~HpnIV~f~   84 (592)
T KOG0575|consen   65 VLNEIEIHRSLKHPNIVQFY   84 (592)
T ss_pred             HHHHHHHHHhcCCCcEEeee
Confidence            34599999999999999996


No 157
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=47.29  E-value=7.9  Score=34.62  Aligned_cols=22  Identities=18%  Similarity=0.092  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|++++|+|||++.
T Consensus        44 ~~~~~E~~~l~~l~hpniv~~~   65 (338)
T cd07859          44 TRILREIKLLRLLRHPDIVEIK   65 (338)
T ss_pred             HHHHHHHHHHHhCCCCCEeeec
Confidence            3578899999999999999874


No 158
>KOG0661|consensus
Probab=47.04  E-value=7.9  Score=37.46  Aligned_cols=20  Identities=15%  Similarity=0.097  Sum_probs=17.8

Q ss_pred             chhhhhhhccCC-CCCcccce
Q psy3210         248 YWGNFRLLSSLF-IVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~-h~~~v~~~  267 (272)
                      =|+|++.+++|+ |+|||+|.
T Consensus        55 nLREvksL~kln~hpniikL~   75 (538)
T KOG0661|consen   55 NLREVKSLRKLNPHPNIIKLK   75 (538)
T ss_pred             HHHHHHHHHhcCCCCcchhhH
Confidence            367999999999 99999984


No 159
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=46.48  E-value=16  Score=31.33  Aligned_cols=23  Identities=13%  Similarity=0.054  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+++++.+.|+|+|++..
T Consensus        46 ~~~~~E~~~l~~l~h~~i~~~~~   68 (260)
T cd05069          46 EAFLQEAQIMKKLRHDKLVPLYA   68 (260)
T ss_pred             HHHHHHHHHHHhCCCCCeeeEEE
Confidence            45778999999999999998854


No 160
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=45.97  E-value=22  Score=31.05  Aligned_cols=22  Identities=18%  Similarity=0.051  Sum_probs=18.9

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++++++.|+|||++.
T Consensus        52 ~~~~~e~~~l~~l~h~~i~~~~   73 (311)
T cd07866          52 ITALREIKILKKLKHPNVVPLI   73 (311)
T ss_pred             hhHHHHHHHHHhcCCCCccchh
Confidence            3456799999999999999975


No 161
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=45.95  E-value=8.7  Score=33.12  Aligned_cols=23  Identities=9%  Similarity=-0.128  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|.+|+++++.+.|+|+|++.-
T Consensus        40 ~~~~~E~~~l~~l~h~~iv~~~~   62 (269)
T cd05087          40 MKFLEEAQPYRSLQHSNLLQCLG   62 (269)
T ss_pred             HHHHHHHHHHHhCCCCCEeeEEE
Confidence            46889999999999999999864


No 162
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=45.81  E-value=9  Score=25.65  Aligned_cols=26  Identities=19%  Similarity=0.437  Sum_probs=21.7

Q ss_pred             CCceecCcCCcchhcccccCCCCCCC
Q psy3210          21 LRPLCSQACYLACHKQCIPHTGRCGT   46 (272)
Q Consensus        21 ~qg~~c~~c~~~~h~~c~~~~~~C~~   46 (272)
                      .+...|+.||+.-|..|-...+.|..
T Consensus        19 dDiVvCp~CgapyHR~C~~~~g~C~~   44 (54)
T PF14446_consen   19 DDIVVCPECGAPYHRDCWEKAGGCIN   44 (54)
T ss_pred             CCEEECCCCCCcccHHHHhhCCceEe
Confidence            46688999999999999887777754


No 163
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=45.64  E-value=9.3  Score=33.95  Aligned_cols=23  Identities=9%  Similarity=-0.119  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++|+++.|+|||+++-
T Consensus        44 ~~~~~E~~~l~~l~h~~iv~~~~   66 (308)
T cd06615          44 NQIIRELKVLHECNSPYIVGFYG   66 (308)
T ss_pred             HHHHHHHHHHHhCCCCCCCeEEE
Confidence            45778999999999999999873


No 164
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=44.98  E-value=9.7  Score=32.76  Aligned_cols=22  Identities=9%  Similarity=0.001  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|++|+++++.+.|+|||++.
T Consensus        40 ~~~~~e~~~~~~l~h~nii~~~   61 (269)
T cd05042          40 LLFLQEVQPYRELNHPNVLQCL   61 (269)
T ss_pred             HHHHHHHHHHHhCCCCCcceEE
Confidence            4688999999999999999986


No 165
>KOG1035|consensus
Probab=44.95  E-value=7.9  Score=41.51  Aligned_cols=21  Identities=24%  Similarity=0.118  Sum_probs=18.5

Q ss_pred             chhhhhhhccCCCCCccccee
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      -..|++.+.+|+|||+||...
T Consensus       524 I~rEVk~LArLnHpNVVRYys  544 (1351)
T KOG1035|consen  524 ILREVKLLARLNHPNVVRYYS  544 (1351)
T ss_pred             HHHHHHHHhhcCCcceeeeeh
Confidence            567999999999999999853


No 166
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=44.72  E-value=8.8  Score=34.71  Aligned_cols=23  Identities=9%  Similarity=-0.136  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++|+++.|+|||++..
T Consensus        48 ~~~~~E~~~l~~l~h~~iv~~~~   70 (333)
T cd06650          48 NQIIRELQVLHECNSPYIVGFYG   70 (333)
T ss_pred             HHHHHHHHHHHHCCCCcccceeE
Confidence            45788999999999999999874


No 167
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=44.57  E-value=9.6  Score=22.67  Aligned_cols=14  Identities=14%  Similarity=0.131  Sum_probs=12.1

Q ss_pred             CCceecCcCCcchh
Q psy3210          21 LRPLCSQACYLACH   34 (272)
Q Consensus        21 ~qg~~c~~c~~~~h   34 (272)
                      ..+|.|..|+..-|
T Consensus         6 P~~Y~C~~C~~~GH   19 (32)
T PF13696_consen    6 PPGYVCHRCGQKGH   19 (32)
T ss_pred             CCCCEeecCCCCCc
Confidence            56899999988877


No 168
>PF05641 Agenet:  Agenet domain;  InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO []. The function of the agenet domain is unknown. This signature matches one of the two Agenet domains in the FMR proteins [].; GO: 0003723 RNA binding; PDB: 2BKD_N 3O8V_A 3KUF_A 3H8Z_A.
Probab=44.49  E-value=27  Score=24.16  Aligned_cols=25  Identities=28%  Similarity=0.442  Sum_probs=15.1

Q ss_pred             cCCCcEEEEeeeeCCc-CCeEEEEeC
Q psy3210         214 LKQGCQVIVLSKEGEQ-KGWWKGKID  238 (272)
Q Consensus       214 l~~Gd~i~v~~k~ge~-~gwW~G~~~  238 (272)
                      |++|+.|+|..+.+.- ..||.+.+.
T Consensus         1 F~~G~~VEV~s~e~g~~gaWf~a~V~   26 (68)
T PF05641_consen    1 FKKGDEVEVSSDEDGFRGAWFPATVL   26 (68)
T ss_dssp             --TT-EEEEEE-SBTT--EEEEEEEE
T ss_pred             CCCCCEEEEEEcCCCCCcEEEEEEEE
Confidence            6789999999755432 558888875


No 169
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=44.16  E-value=10  Score=33.46  Aligned_cols=21  Identities=24%  Similarity=0.014  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+++|+.+.|+|+|++.
T Consensus        49 ~~~~E~~~l~~l~h~niv~~~   69 (303)
T cd07869          49 TAIREASLLKGLKHANIVLLH   69 (303)
T ss_pred             hHHHHHHHHhhCCCCCcCeEE
Confidence            467899999999999999986


No 170
>KOG0659|consensus
Probab=44.06  E-value=8.8  Score=34.58  Aligned_cols=22  Identities=18%  Similarity=0.107  Sum_probs=20.0

Q ss_pred             eccchhhhhhhccCCCCCcccc
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~  266 (272)
                      ..+-++|++.++.+.|+|||+|
T Consensus        45 ~~talREIK~Lqel~h~nIi~L   66 (318)
T KOG0659|consen   45 NRTALREIKLLQELKHPNIIEL   66 (318)
T ss_pred             cHHHHHHHHHHHHccCcchhhh
Confidence            5567899999999999999987


No 171
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=43.47  E-value=9.8  Score=32.70  Aligned_cols=22  Identities=9%  Similarity=0.003  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|+.++|+|||++.
T Consensus        45 ~~~~~E~~~l~~l~h~~iv~~~   66 (272)
T cd05075          45 EDFLSEAVCMKEFDHPNVMRLI   66 (272)
T ss_pred             HHHHHHHHHHHhCCCCCcceEE
Confidence            5678899999999999999975


No 172
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=43.44  E-value=11  Score=33.98  Aligned_cols=22  Identities=9%  Similarity=-0.082  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..++.|+++|+++.|+|||++.
T Consensus        48 ~~~~~E~~~l~~l~h~~iv~~~   69 (331)
T cd06649          48 NQIIRELQVLHECNSPYIVGFY   69 (331)
T ss_pred             HHHHHHHHHHHHCCCCCCCeEE
Confidence            4688999999999999999986


No 173
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=43.30  E-value=11  Score=32.54  Aligned_cols=24  Identities=8%  Similarity=-0.020  Sum_probs=20.7

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..|.+|+.+++.+.|||||++...
T Consensus        49 ~~~~~~~~~l~~l~hp~iv~~~~~   72 (262)
T cd05077          49 LAFFETASMMRQVSHKHIVLLYGV   72 (262)
T ss_pred             HHHHHHHHHHHhCCCCCEeeEEEE
Confidence            358889999999999999998753


No 174
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=43.18  E-value=11  Score=32.54  Aligned_cols=23  Identities=4%  Similarity=-0.240  Sum_probs=20.5

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ...|.+|+.+++.++|+|||++.
T Consensus        39 ~~~~~~e~~~~~~l~h~~iv~~~   61 (268)
T cd05086          39 QNEFLQQGDPYRILQHPNILQCL   61 (268)
T ss_pred             HHHHHHHHHHHhccCCcchhheE
Confidence            35789999999999999999976


No 175
>KOG0582|consensus
Probab=43.06  E-value=12  Score=36.08  Aligned_cols=23  Identities=13%  Similarity=-0.067  Sum_probs=19.3

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      +-.+|++.|+.++|||||..+-|
T Consensus        70 ~l~kE~~~msl~~HPNIv~~~~s   92 (516)
T KOG0582|consen   70 ALRKEVQTMSLIDHPNIVTYHCS   92 (516)
T ss_pred             HHHHHHHHhhhcCCCCcceEEEE
Confidence            34579999999999999998754


No 176
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=42.90  E-value=20  Score=21.39  Aligned_cols=23  Identities=13%  Similarity=0.211  Sum_probs=16.4

Q ss_pred             eecCcCCcchhccc-ccCCCCCCC
Q psy3210          24 LCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        24 ~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      |+|..||.-.--+. ....+.|+.
T Consensus         3 ~~C~~CG~i~~g~~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEGEEAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeECCcCCCcCcCCCC
Confidence            78999997654443 567777776


No 177
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=42.79  E-value=11  Score=32.05  Aligned_cols=23  Identities=22%  Similarity=0.111  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+++++++.|+|+|++..
T Consensus        38 ~~~~~e~~~l~~l~h~~i~~~~~   60 (252)
T cd05084          38 AKFLQEARILKQYSHPNIVRLIG   60 (252)
T ss_pred             HHHHHHHHHHHhCCCCCcceEEE
Confidence            46889999999999999999874


No 178
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=42.55  E-value=11  Score=33.47  Aligned_cols=22  Identities=14%  Similarity=-0.020  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+.+|+.+.|+|||++.
T Consensus        54 ~~~~~e~~~l~~l~h~niv~~~   75 (316)
T cd05108          54 KEILDEAYVMASVDNPHVCRLL   75 (316)
T ss_pred             HHHHHHHHHHHhCCCCCCCeEE
Confidence            4577899999999999999986


No 179
>smart00557 IG_FLMN Filamin-type immunoglobulin domains. These form a rod-like structure in the actin-binding cytoskeleton protein, filamin. The C-terminal repeats of filamin bind beta1-integrin (CD29).
Probab=42.52  E-value=37  Score=24.80  Aligned_cols=30  Identities=23%  Similarity=0.418  Sum_probs=24.3

Q ss_pred             hcccCCCceEEEEeCCCCCCCCCCCceEEEEeeCC
Q psy3210         103 LLEREADGTYLLRIRPQGPTHPNETIYALSLKTDE  137 (272)
Q Consensus       103 lL~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~  137 (272)
                      .+.++.+|+|.|.-....     .|.|.|+++.++
T Consensus        49 ~v~d~~dGty~v~y~P~~-----~G~~~i~V~~~g   78 (93)
T smart00557       49 EVKDNGDGTYTVSYTPTE-----PGDYTVTVKFGG   78 (93)
T ss_pred             EEEeCCCCEEEEEEEeCC-----CEeEEEEEEECC
Confidence            345678899999988754     599999999876


No 180
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=42.32  E-value=11  Score=32.21  Aligned_cols=25  Identities=12%  Similarity=-0.031  Sum_probs=21.4

Q ss_pred             eccchhhhhhhccCCCCCcccceec
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ...|..|+++++++.|+|||++...
T Consensus        43 ~~~~~~e~~~l~~l~h~~i~~~~~~   67 (256)
T cd05113          43 EDEFIEEAKVMMKLSHEKLVQLYGV   67 (256)
T ss_pred             HHHHHHHHHHHhcCCCCCeeeEEEE
Confidence            3468899999999999999998753


No 181
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=42.31  E-value=12  Score=33.31  Aligned_cols=22  Identities=14%  Similarity=-0.047  Sum_probs=19.0

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|||++..
T Consensus        44 ~~~~E~~~l~~l~h~niv~~~~   65 (318)
T cd05582          44 RTKMERDILAEVNHPFIVKLHY   65 (318)
T ss_pred             HHHHHHHHHHhCCCCCcccEEE
Confidence            3567899999999999999865


No 182
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=41.98  E-value=11  Score=32.46  Aligned_cols=24  Identities=17%  Similarity=0.081  Sum_probs=20.7

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..|..|++++++++|+|||++...
T Consensus        53 ~~~~~E~~~l~~l~h~~iv~~~~~   76 (275)
T cd05046          53 SEFRRELDMFRKLSHKNVVRLLGL   76 (275)
T ss_pred             HHHHHHHHHHHhcCCcceeeeEEE
Confidence            357789999999999999998754


No 183
>KOG4239|consensus
Probab=41.53  E-value=5.1  Score=36.43  Aligned_cols=31  Identities=19%  Similarity=0.385  Sum_probs=27.2

Q ss_pred             hcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          16 LKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        16 ~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      ..|+..+|..|..|+..+|-.| +-+.-.|.+
T Consensus        72 ~~~vl~egL~c~~c~~tch~rcr~lv~ldc~~  103 (348)
T KOG4239|consen   72 IWGVLREGLLCIHCKFTCHIRCRMLVDLDCRS  103 (348)
T ss_pred             HHHHHHHHHhhhhcCCccCHHHHhhhhhhhcC
Confidence            4577889999999999999999 888888877


No 184
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=41.26  E-value=16  Score=38.35  Aligned_cols=31  Identities=13%  Similarity=0.300  Sum_probs=24.7

Q ss_pred             hcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          16 LKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        16 ~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      ||..+.|..+|.+||+.-..-- .+.++.||+
T Consensus      1005 LRaFsrQ~fRC~kC~~kYRR~PL~G~C~kCGg 1036 (1095)
T TIGR00354      1005 LRAFSRQEVRCTKCNTKYRRIPLVGKCLKCGN 1036 (1095)
T ss_pred             HhhhhccceeecccCCccccCCCCCcccccCC
Confidence            4556789999999999988776 566777876


No 185
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=41.23  E-value=11  Score=32.82  Aligned_cols=22  Identities=14%  Similarity=0.208  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+++++++.|+|||++.
T Consensus        51 ~~~~~E~~~l~~l~h~~i~~~~   72 (283)
T cd05080          51 SGWKKEINILKTLYHENIVKYK   72 (283)
T ss_pred             HHHHHHHHHHHhCCCCCEeeEE
Confidence            4577899999999999999976


No 186
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=41.13  E-value=12  Score=32.01  Aligned_cols=21  Identities=19%  Similarity=0.145  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++|+.+.|+|||++.
T Consensus        45 ~~~~e~~~l~~l~h~~i~~~~   65 (269)
T cd05044          45 EFLKEAHLMSNFNHPNIVKLL   65 (269)
T ss_pred             HHHHHHHHHHhcCCCCeeeEe
Confidence            578899999999999999975


No 187
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=41.03  E-value=12  Score=33.17  Aligned_cols=22  Identities=18%  Similarity=0.006  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+.+|+++|+++.|+|||++.-
T Consensus        44 ~~~~E~~~l~~l~h~niv~~~~   65 (317)
T cd07867          44 SACREIALLRELKHPNVIALQK   65 (317)
T ss_pred             HHHHHHHHHHhCCCCCeeeEEE
Confidence            4678999999999999999853


No 188
>PRK04023 DNA polymerase II large subunit; Validated
Probab=40.93  E-value=16  Score=38.50  Aligned_cols=31  Identities=13%  Similarity=0.254  Sum_probs=24.6

Q ss_pred             hcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          16 LKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        16 ~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      ||..+.|..+|.+||+.-..-- .+.++.|++
T Consensus      1030 LRaFsrQ~fRC~kC~~kYRR~PL~G~C~kCGg 1061 (1121)
T PRK04023       1030 LRAFSRQEFRCTKCGAKYRRPPLSGKCPKCGG 1061 (1121)
T ss_pred             hhhhcccceeecccCcccccCCCCCcCccCCC
Confidence            4556789999999999988776 566777866


No 189
>KOG1989|consensus
Probab=40.90  E-value=10  Score=38.67  Aligned_cols=20  Identities=10%  Similarity=-0.084  Sum_probs=17.3

Q ss_pred             chhhhhhhccCC-CCCcccce
Q psy3210         248 YWGNFRLLSSLF-IVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~-h~~~v~~~  267 (272)
                      ...|+.+||+|. |+|||.+-
T Consensus        81 v~~EI~~MK~L~gh~nIV~yi  101 (738)
T KOG1989|consen   81 VKREIDIMKLLSGHKNIVSYI  101 (738)
T ss_pred             HHHHHHHHHHhcCCCceeeEe
Confidence            346999999999 99999873


No 190
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=40.89  E-value=11  Score=32.49  Aligned_cols=22  Identities=14%  Similarity=-0.016  Sum_probs=19.7

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|.+|+++|+++.|+|||++.
T Consensus        40 ~~~~~E~~~l~~l~h~~ii~~~   61 (257)
T cd05115          40 DEMMREAEIMHQLDNPYIVRMI   61 (257)
T ss_pred             HHHHHHHHHHHhcCCCCeEEEE
Confidence            4688999999999999999975


No 191
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=40.61  E-value=14  Score=33.26  Aligned_cols=23  Identities=13%  Similarity=-0.051  Sum_probs=19.9

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .++.|+++|+++.|||+|++...
T Consensus        41 ~~~~E~~~l~~l~hp~i~~~~~~   63 (323)
T cd05595          41 HTVTESRVLQNTRHPFLTALKYA   63 (323)
T ss_pred             HHHHHHHHHHhCCCCCCcceeeE
Confidence            56789999999999999998643


No 192
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=40.61  E-value=22  Score=30.44  Aligned_cols=23  Identities=9%  Similarity=0.005  Sum_probs=20.0

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++.+.|+|+|++.-
T Consensus        47 ~~~~~e~~~l~~l~h~~i~~~~~   69 (263)
T cd05052          47 EEFLKEAAVMKEIKHPNLVQLLG   69 (263)
T ss_pred             HHHHHHHHHHHhCCCCChhheEE
Confidence            35788999999999999999864


No 193
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=40.28  E-value=13  Score=32.42  Aligned_cols=23  Identities=22%  Similarity=-0.070  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..++.|+++|+++.|+||++++-
T Consensus        48 ~~~~~E~~~l~~l~h~~i~~~~~   70 (291)
T cd07844          48 FTAIREASLLKDLKHANIVTLHD   70 (291)
T ss_pred             hhHHHHHHHHhhCCCcceeeEEE
Confidence            34678999999999999999874


No 194
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=40.08  E-value=12  Score=32.30  Aligned_cols=22  Identities=14%  Similarity=0.066  Sum_probs=19.3

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .|..|+.+++.+.|+|+|++.-
T Consensus        55 ~~~~e~~~l~~l~~~~iv~~~~   76 (277)
T cd05062          55 EFLNEASVMKEFNCHHVVRLLG   76 (277)
T ss_pred             HHHHHHHHHHhCCCCCeeeEEE
Confidence            4778999999999999999863


No 195
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=39.93  E-value=12  Score=31.67  Aligned_cols=25  Identities=20%  Similarity=0.090  Sum_probs=21.5

Q ss_pred             eccchhhhhhhccCCCCCcccceec
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ...|.+|+++|+++.|+|+|++.-.
T Consensus        45 ~~~~~~e~~~l~~l~h~~i~~~~~~   69 (259)
T cd05037          45 SLAFFETASLMSQLSHKHLVKLYGV   69 (259)
T ss_pred             HHHHHHHHHHHHcCCCcchhheeeE
Confidence            4578899999999999999998753


No 196
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=39.66  E-value=13  Score=32.40  Aligned_cols=24  Identities=17%  Similarity=0.148  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++++.+.|+|||++...
T Consensus        48 ~~~~~E~~~l~~l~h~~iv~~~~~   71 (290)
T cd05045          48 RDLLSEFNLLKQVNHPHVIKLYGA   71 (290)
T ss_pred             HHHHHHHHHHhhCCCCCEeeEEEE
Confidence            357789999999999999998653


No 197
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=39.42  E-value=12  Score=32.70  Aligned_cols=24  Identities=21%  Similarity=-0.019  Sum_probs=20.7

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      +..+..|+++++++.|+|++++.-
T Consensus        45 ~~~~~~e~~~l~~l~h~~i~~~~~   68 (294)
T PLN00009         45 PSTAIREISLLKEMQHGNIVRLQD   68 (294)
T ss_pred             hHHHHHHHHHHHhccCCCEeeEEE
Confidence            356788999999999999999863


No 198
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=39.31  E-value=14  Score=31.85  Aligned_cols=21  Identities=5%  Similarity=0.055  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|..|+++++.+.|+|||++.
T Consensus        51 ~~~~e~~~l~~l~h~~i~~~~   71 (267)
T cd05066          51 DFLSEASIMGQFDHPNIIHLE   71 (267)
T ss_pred             HHHHHHHHHHhCCCCCcceEE
Confidence            567799999999999999985


No 199
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=39.12  E-value=22  Score=30.15  Aligned_cols=23  Identities=22%  Similarity=0.179  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+.+++.+.|+|++++.-
T Consensus        44 ~~~~~e~~~l~~~~~~~i~~~~~   66 (254)
T cd05083          44 QAFLEETAVMTKLHHKNLVRLLG   66 (254)
T ss_pred             HHHHHHHHHHHhCCCCCcCeEEE
Confidence            45788999999999999999763


No 200
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=38.87  E-value=12  Score=33.66  Aligned_cols=22  Identities=14%  Similarity=0.105  Sum_probs=19.4

Q ss_pred             cchhhhhhhccC-CCCCccccee
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~~  268 (272)
                      .++.|+++|+++ .|+|||++.-
T Consensus        56 ~~~~E~~~l~~l~~h~niv~~~~   78 (338)
T cd05102          56 ALMSELKILIHIGNHLNVVNLLG   78 (338)
T ss_pred             HHHHHHHHHHHhccCcceeeEEe
Confidence            578899999999 8999999863


No 201
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=38.66  E-value=13  Score=32.12  Aligned_cols=24  Identities=25%  Similarity=0.030  Sum_probs=20.3

Q ss_pred             eeccchhhhhhhccCCCCCcccce
Q psy3210         244 FFQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       244 fP~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..+..|+++|+++.|+|++++.
T Consensus        42 ~~~~~~~ei~~l~~l~h~~i~~~~   65 (284)
T cd07839          42 VPSSALREICLLKELKHKNIVRLY   65 (284)
T ss_pred             CccchhHHHHHHHhcCCCCeeeHH
Confidence            345677899999999999999875


No 202
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=38.58  E-value=12  Score=32.29  Aligned_cols=22  Identities=18%  Similarity=0.025  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|..|+++++++.|+|+|++.
T Consensus        47 ~~~~~e~~~l~~l~h~~i~~~~   68 (280)
T cd06611          47 EDFMVEIDILSECKHPNIVGLY   68 (280)
T ss_pred             HHHHHHHHHHHhCCCCceeEEE
Confidence            3578899999999999999986


No 203
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=38.33  E-value=14  Score=31.75  Aligned_cols=23  Identities=4%  Similarity=-0.045  Sum_probs=20.1

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++|+++.|+|+|++.-
T Consensus        46 ~~~~~E~~~l~~l~h~~i~~~~~   68 (273)
T cd05074          46 EEFLREAACMKEFDHPNVIKLIG   68 (273)
T ss_pred             HHHHHHHHHHhcCCCCCcceEEE
Confidence            45788999999999999999864


No 204
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=38.11  E-value=13  Score=35.06  Aligned_cols=22  Identities=18%  Similarity=0.212  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccCC-CCCcccce
Q psy3210         246 QLYWGNFRLLSSLF-IVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~-h~~~v~~~  267 (272)
                      ..++.|+++|+++. |||||++.
T Consensus        85 ~~~~~Ei~~l~~l~~HpnIv~l~  107 (400)
T cd05105          85 QALMSELKIMTHLGPHLNIVNLL  107 (400)
T ss_pred             HHHHHHHHHHHhcCCCCCeeeEE
Confidence            35778999999996 99999986


No 205
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=38.03  E-value=14  Score=32.94  Aligned_cols=23  Identities=13%  Similarity=0.005  Sum_probs=20.1

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..++.|+++|+++.|+|||++..
T Consensus        38 ~~~~~E~~~l~~l~h~~iv~~~~   60 (312)
T cd05585          38 THTLAERTVLAQVNCPFIVPLKF   60 (312)
T ss_pred             HHHHHHHHHHHhCCCCcEeceee
Confidence            35778999999999999999864


No 206
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=37.67  E-value=16  Score=31.14  Aligned_cols=22  Identities=5%  Similarity=-0.014  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+.+|+++.|+|+|++.
T Consensus        41 ~~~~~e~~~l~~l~h~~iv~~~   62 (262)
T cd05058          41 EQFLKEGIIMKDFSHPNVLSLL   62 (262)
T ss_pred             HHHHHHHHHHccCCCCCcceEE
Confidence            4678899999999999999975


No 207
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=37.60  E-value=14  Score=33.05  Aligned_cols=22  Identities=14%  Similarity=-0.046  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+.+.|+|||++..
T Consensus        46 ~~~~E~~il~~l~hp~iv~~~~   67 (323)
T cd05584          46 HTKAERNILEAVKHPFIVDLIY   67 (323)
T ss_pred             HHHHHHHHHHhCCCCchhceee
Confidence            4678999999999999999863


No 208
>KOG0578|consensus
Probab=37.42  E-value=10  Score=37.12  Aligned_cols=20  Identities=10%  Similarity=0.074  Sum_probs=17.8

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      -+.|+.+|+.++|+|||++.
T Consensus       317 ilnEi~Vm~~~~H~NiVnfl  336 (550)
T KOG0578|consen  317 LLNEILVMRDLHHPNIVNFL  336 (550)
T ss_pred             hHHHHHHHHhccchHHHHHH
Confidence            46799999999999999874


No 209
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=37.23  E-value=32  Score=36.65  Aligned_cols=21  Identities=14%  Similarity=-0.048  Sum_probs=18.9

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .++.|+++|++|.|+|||++.
T Consensus        58 ~~~~EI~IL~~L~HPNIVrl~   78 (1021)
T PTZ00266         58 QLVIEVNVMRELKHKNIVRYI   78 (1021)
T ss_pred             HHHHHHHHHHHcCCCCcCeEE
Confidence            477899999999999999985


No 210
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=37.16  E-value=15  Score=32.27  Aligned_cols=23  Identities=17%  Similarity=0.146  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+++|+++.|+|+|++..
T Consensus        64 ~~~~~E~~~l~~l~~~~i~~~~~   86 (296)
T cd05095          64 NDFLKEIKIMSRLKDPNIIRLLA   86 (296)
T ss_pred             HHHHHHHHHHHhCCCCCcceEEE
Confidence            35788999999999999999864


No 211
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=36.92  E-value=15  Score=31.22  Aligned_cols=22  Identities=18%  Similarity=0.122  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|..|+++++++.|+|||++.
T Consensus        41 ~~~~~e~~~l~~l~h~~iv~~~   62 (257)
T cd05040          41 DDFLKEAAIMHSLDHENLIRLY   62 (257)
T ss_pred             HHHHHHHHHHhhcCCCCcccee
Confidence            4677899999999999999975


No 212
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=36.64  E-value=14  Score=32.24  Aligned_cols=23  Identities=17%  Similarity=0.008  Sum_probs=19.6

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +..+..|+++++.++|+|+|+++
T Consensus        50 ~~~~~~e~~~~~~l~h~~i~~~~   72 (302)
T cd07864          50 PITAIREIKILRQLNHRNIVNLK   72 (302)
T ss_pred             hHHHHHHHHHHHhCCCCCeeeee
Confidence            34567899999999999999975


No 213
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=36.59  E-value=15  Score=33.40  Aligned_cols=22  Identities=9%  Similarity=0.048  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+++|+++.|+|||++.
T Consensus       117 ~~~~~E~~~l~~l~h~~iv~~~  138 (353)
T PLN00034        117 RQICREIEILRDVNHPNVVKCH  138 (353)
T ss_pred             HHHHHHHHHHHhCCCCCcceee
Confidence            3577899999999999999975


No 214
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=36.59  E-value=13  Score=32.77  Aligned_cols=23  Identities=22%  Similarity=0.267  Sum_probs=19.7

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++|+++.|+|||++.+.
T Consensus        47 ~~~~E~~~l~~l~hp~iv~~~~~   69 (291)
T cd05612          47 HVHNEKRVLKEVSHPFIIRLFWT   69 (291)
T ss_pred             HHHHHHHHHHhCCCCcHhhhHhh
Confidence            46679999999999999998653


No 215
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=36.44  E-value=15  Score=31.44  Aligned_cols=22  Identities=14%  Similarity=0.046  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|.+|+.+|+.+.|+|+|++.
T Consensus        44 ~~~~~e~~~l~~~~h~~iv~~~   65 (258)
T cd05078          44 ESFFEAASMMSQLSHKHLVLNY   65 (258)
T ss_pred             HHHHHHHHHHHhCCCCChhhee
Confidence            3578899999999999999986


No 216
>KOG1829|consensus
Probab=36.38  E-value=14  Score=36.76  Aligned_cols=21  Identities=10%  Similarity=0.021  Sum_probs=18.6

Q ss_pred             hhcccCCCceecCcCCcchhc
Q psy3210          15 TLKSRGLRPLCSQACYLACHK   35 (272)
Q Consensus        15 ~~~g~~~qg~~c~~c~~~~h~   35 (272)
                      .=+||-.|||+|..||..++.
T Consensus       332 re~gL~aQ~~~CAgC~~~i~~  352 (580)
T KOG1829|consen  332 REKGLDAQNFRCAGCGHTIGP  352 (580)
T ss_pred             hhhhhhccCceecccCCCccc
Confidence            347999999999999999994


No 217
>KOG0198|consensus
Probab=36.02  E-value=15  Score=33.61  Aligned_cols=21  Identities=24%  Similarity=0.042  Sum_probs=18.6

Q ss_pred             chhhhhhhccCCCCCccccee
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .-+|+++|++|.||||||..=
T Consensus        61 l~~Ei~iL~~l~~p~IV~~~G   81 (313)
T KOG0198|consen   61 LEREIRILSRLNHPNIVQYYG   81 (313)
T ss_pred             HHHHHHHHHhCCCCCEEeeCC
Confidence            567999999999999999764


No 218
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=35.82  E-value=24  Score=22.36  Aligned_cols=24  Identities=13%  Similarity=0.059  Sum_probs=16.4

Q ss_pred             ceecCcCCcchhccc---ccCCCCCCC
Q psy3210          23 PLCSQACYLACHKQC---IPHTGRCGT   46 (272)
Q Consensus        23 g~~c~~c~~~~h~~c---~~~~~~C~~   46 (272)
                      -|.|..||..+.-.=   ....+.|+.
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~   29 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGY   29 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCC
Confidence            389999998874433   345677765


No 219
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=35.80  E-value=35  Score=28.94  Aligned_cols=22  Identities=14%  Similarity=0.087  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .|..|+.+++++.|+|+|++.-
T Consensus        45 ~~~~e~~~l~~l~~~~i~~~~~   66 (256)
T cd05082          45 AFLAEASVMTQLRHSNLVQLLG   66 (256)
T ss_pred             HHHHHHHHHHhCCCCCeeeEEE
Confidence            4678999999999999999763


No 220
>KOG0594|consensus
Probab=35.68  E-value=15  Score=33.75  Aligned_cols=24  Identities=25%  Similarity=0.104  Sum_probs=22.6

Q ss_pred             eeccchhhhhhhccCCCCC-cccce
Q psy3210         244 FFQLYWGNFRLLSSLFIVP-PVRLS  267 (272)
Q Consensus       244 fP~~yVeE~~~mk~l~h~~-~v~~~  267 (272)
                      .|.+=+.|+-+|++|+|.| +|+|+
T Consensus        53 ~P~taiREisllk~L~~~~~iv~L~   77 (323)
T KOG0594|consen   53 VPSTAIREISLLKRLSHANHIVRLH   77 (323)
T ss_pred             CCchhhHHHHHHHHhCCCcceEEEE
Confidence            7888999999999999999 99986


No 221
>PHA03210 serine/threonine kinase US3; Provisional
Probab=35.54  E-value=17  Score=35.31  Aligned_cols=21  Identities=10%  Similarity=-0.029  Sum_probs=18.3

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++|+++.|+|||++.
T Consensus       209 ~~~~Ei~il~~l~HpnIv~l~  229 (501)
T PHA03210        209 QLENEILALGRLNHENILKIE  229 (501)
T ss_pred             HHHHHHHHHHhCCCCCcCcEe
Confidence            356799999999999999985


No 222
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=35.31  E-value=19  Score=32.31  Aligned_cols=23  Identities=17%  Similarity=-0.008  Sum_probs=19.9

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .++.|+++|+++.|+|||++...
T Consensus        41 ~~~~e~~~l~~l~hp~i~~~~~~   63 (323)
T cd05571          41 HTLTESRVLQNTRHPFLTALKYS   63 (323)
T ss_pred             HHHHHHHHHHhCCCCCCCCEEEE
Confidence            46789999999999999998653


No 223
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=35.24  E-value=19  Score=32.43  Aligned_cols=24  Identities=17%  Similarity=-0.006  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..++.|+++|+++.|+|||++...
T Consensus        40 ~~~~~E~~~l~~l~hp~iv~~~~~   63 (328)
T cd05593          40 AHTLTESRVLKNTRHPFLTSLKYS   63 (328)
T ss_pred             HHHHHHHHHHHhCCCCCCcceEEE
Confidence            356789999999999999998643


No 224
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=35.23  E-value=15  Score=32.02  Aligned_cols=23  Identities=22%  Similarity=0.122  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+++|+++.|+|+|++.-
T Consensus        64 ~~~~~e~~~l~~l~~~~i~~~~~   86 (296)
T cd05051          64 EDFLKEVKILSRLSDPNIARLLG   86 (296)
T ss_pred             HHHHHHHHHHHhcCCCCEeEEEE
Confidence            35678999999999999999864


No 225
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=35.17  E-value=17  Score=31.79  Aligned_cols=22  Identities=9%  Similarity=-0.103  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|+++.|+|||++.
T Consensus        44 ~~~~~e~~~l~~l~h~~iv~~~   65 (287)
T cd06621          44 KQILRELEINKSCKSPYIVKYY   65 (287)
T ss_pred             HHHHHHHHHHHhCCCCCeeeee
Confidence            4578899999999999999974


No 226
>KOG0032|consensus
Probab=35.12  E-value=16  Score=34.41  Aligned_cols=21  Identities=19%  Similarity=0.044  Sum_probs=18.3

Q ss_pred             cchhhhhhhccCC-CCCcccce
Q psy3210         247 LYWGNFRLLSSLF-IVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~-h~~~v~~~  267 (272)
                      ..-.|+++|+++. |||+|+|.
T Consensus        81 ~v~~Ev~il~~l~~hpniv~l~  102 (382)
T KOG0032|consen   81 DVRREVAILQQLSGHPNIVQLK  102 (382)
T ss_pred             HHHHHHHHHHhccCCCCEEEEE
Confidence            3456999999999 99999986


No 227
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=34.94  E-value=15  Score=31.44  Aligned_cols=24  Identities=17%  Similarity=-0.011  Sum_probs=20.9

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++++.+.|+|+|++...
T Consensus        47 ~~~~~e~~~l~~~~h~~i~~~~~~   70 (267)
T cd08229          47 ADCIKEIDLLKQLNHPNVIKYYAS   70 (267)
T ss_pred             HHHHHHHHHHHHccCCchhhhhhe
Confidence            468889999999999999998754


No 228
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=34.84  E-value=17  Score=31.14  Aligned_cols=23  Identities=4%  Similarity=0.014  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+.+++++.|+|++++.-
T Consensus        50 ~~~~~e~~~l~~l~h~ni~~~~~   72 (269)
T cd05065          50 RDFLSEASIMGQFDHPNIIHLEG   72 (269)
T ss_pred             HHHHHHHHHHHhCCCcCcceEEE
Confidence            35778999999999999999864


No 229
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=34.67  E-value=18  Score=31.42  Aligned_cols=24  Identities=4%  Similarity=-0.124  Sum_probs=20.6

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++++++.|+|+|++...
T Consensus        44 ~~~~~E~~~l~~l~h~~iv~~~~~   67 (279)
T cd06619          44 KQIMSELEILYKCDSPYIIGFYGA   67 (279)
T ss_pred             HHHHHHHHHHHhCCCCCeeeEEEE
Confidence            357789999999999999998754


No 230
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=34.63  E-value=14  Score=31.38  Aligned_cols=22  Identities=23%  Similarity=0.031  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+++++++.|+|+|++.
T Consensus        45 ~~~~~e~~~l~~l~h~~i~~~~   66 (258)
T cd05578          45 RNVLNERRILQELNHPFLVNLW   66 (258)
T ss_pred             HHHHHHHHHHHhCCCCChHHHH
Confidence            5688899999999999999874


No 231
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=34.59  E-value=18  Score=31.12  Aligned_cols=21  Identities=10%  Similarity=0.031  Sum_probs=19.0

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|..|+++++++.|+|+|++.
T Consensus        53 ~~~~e~~~l~~~~h~~i~~~~   73 (270)
T cd05056          53 KFLQEAYIMRQFDHPHIVKLI   73 (270)
T ss_pred             HHHHHHHHHHhCCCCchhcee
Confidence            577899999999999999985


No 232
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=34.49  E-value=19  Score=30.45  Aligned_cols=21  Identities=19%  Similarity=0.151  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++|+++.|+|++++.
T Consensus        38 ~~~~e~~~l~~l~h~~i~~~~   58 (250)
T cd05085          38 KFLSEARILKQYDHPNIVKLI   58 (250)
T ss_pred             HHHHHHHHHHhCCCCCcCeEE
Confidence            588999999999999999875


No 233
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=34.46  E-value=19  Score=31.77  Aligned_cols=22  Identities=23%  Similarity=0.034  Sum_probs=19.2

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..++.|+++++++.|+|+|++.
T Consensus        51 ~~~~~E~~~l~~l~h~~i~~~~   72 (309)
T cd07845          51 ISSLREITLLLNLRHPNIVELK   72 (309)
T ss_pred             chhhHHHHHHHhCCCCCCcceE
Confidence            3567899999999999999975


No 234
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=34.33  E-value=18  Score=31.33  Aligned_cols=21  Identities=19%  Similarity=0.018  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+.+|+++.|+|+|++.
T Consensus        55 ~~~~e~~~l~~l~h~~i~~~~   75 (279)
T cd05057          55 EILDEAYVMASVDHPHVVRLL   75 (279)
T ss_pred             HHHHHHHHHHhCCCCCcceEE
Confidence            567899999999999999986


No 235
>KOG0597|consensus
Probab=34.28  E-value=13  Score=37.05  Aligned_cols=22  Identities=23%  Similarity=0.125  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|..+|++|+++|.|||||.++
T Consensus        46 ~~l~~ev~i~r~lkHpniv~m~   67 (808)
T KOG0597|consen   46 KNLRQEVRILRSLKHPNIVEML   67 (808)
T ss_pred             HHHHHHHHHHHhcCCcchhhHH
Confidence            4678899999999999999986


No 236
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=34.24  E-value=17  Score=30.92  Aligned_cols=21  Identities=19%  Similarity=0.030  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++++.|+|||++.
T Consensus        50 ~~~~e~~~l~~l~~~~i~~~~   70 (263)
T cd06625          50 ALECEIQLLKNLQHERIVQYY   70 (263)
T ss_pred             HHHHHHHHHHhCCCCCeeeeE
Confidence            467799999999999999985


No 237
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=34.18  E-value=17  Score=31.05  Aligned_cols=21  Identities=14%  Similarity=-0.004  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|..|+++++.+.|+|++++.
T Consensus        48 ~~~~e~~~l~~l~h~~i~~~~   68 (267)
T cd08228          48 DCVKEIDLLKQLNHPNVIKYL   68 (267)
T ss_pred             HHHHHHHHHHhCCCcceeeee
Confidence            578899999999999999986


No 238
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=34.18  E-value=23  Score=38.30  Aligned_cols=31  Identities=13%  Similarity=0.245  Sum_probs=24.6

Q ss_pred             hcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          16 LKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        16 ~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      ||..+.|..+|.+||..-..-- .+.++.||+
T Consensus      1246 LraFsrQ~~RC~kC~~kyRR~PL~G~C~kCGg 1277 (1337)
T PRK14714       1246 LRAFSRQEFRCLKCGTKYRRMPLAGKCRKCGG 1277 (1337)
T ss_pred             hhhhhccceeecccCcccccCCCCCcccccCC
Confidence            4556689999999999988776 566777877


No 239
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=34.16  E-value=17  Score=30.80  Aligned_cols=22  Identities=14%  Similarity=-0.130  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|+|++.-
T Consensus        45 ~~~~e~~~l~~~~h~~i~~~~~   66 (256)
T cd08221          45 DALNEIVILSLLQHPNIIAYYN   66 (256)
T ss_pred             HHHHHHHHHHhCCCCCeeEEEe
Confidence            5678999999999999999864


No 240
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=34.16  E-value=19  Score=32.76  Aligned_cols=21  Identities=14%  Similarity=-0.002  Sum_probs=18.2

Q ss_pred             chhhhhhhccCCCCCccccee
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      +..|+++|+.+.|||||++.-
T Consensus        78 ~~~E~~~l~~l~hp~Iv~~~~   98 (340)
T PTZ00426         78 VFSERKILNYINHPFCVNLYG   98 (340)
T ss_pred             HHHHHHHHHhCCCCCCcceEE
Confidence            456999999999999999863


No 241
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=33.73  E-value=19  Score=31.09  Aligned_cols=22  Identities=18%  Similarity=-0.005  Sum_probs=18.7

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|++++..
T Consensus        54 ~~~~e~~~l~~l~h~ni~~~~~   75 (280)
T cd05043          54 LLLQESCLLYGLSHQNILPILH   75 (280)
T ss_pred             HHHHHHHHHHhCCCCCCCeEEE
Confidence            3667999999999999999754


No 242
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=33.71  E-value=16  Score=33.72  Aligned_cols=22  Identities=23%  Similarity=0.150  Sum_probs=19.1

Q ss_pred             cchhhhhhhccC-CCCCccccee
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~~  268 (272)
                      .+.+|+++|+.+ .|||||++.-
T Consensus        84 ~~~~Ei~il~~l~~HpnIv~l~~  106 (375)
T cd05104          84 ALMSELKVLSYLGNHINIVNLLG  106 (375)
T ss_pred             HHHHHHHHHHHhcCCcceeeeee
Confidence            467899999999 8999999863


No 243
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=33.69  E-value=19  Score=31.56  Aligned_cols=22  Identities=18%  Similarity=-0.000  Sum_probs=18.7

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|+|++.-
T Consensus        57 ~~~~e~~~l~~l~h~~iv~~~~   78 (310)
T cd07865          57 TALREIKILQLLKHENVVNLIE   78 (310)
T ss_pred             HHHHHHHHHHhCCCCCccceEE
Confidence            3467999999999999999863


No 244
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=33.65  E-value=19  Score=32.24  Aligned_cols=21  Identities=10%  Similarity=0.015  Sum_probs=17.9

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+++++.++|||||++.
T Consensus        45 ~~~~e~~~l~~l~hpniv~~~   65 (327)
T cd08227          45 FLQGELHVSKLFNHPNIVPYR   65 (327)
T ss_pred             HHHHHHHHHHhcCCCCeeeEE
Confidence            345689999999999999975


No 245
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=33.56  E-value=17  Score=31.68  Aligned_cols=23  Identities=13%  Similarity=-0.064  Sum_probs=19.4

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ...+.+|+++|+++.|+|++++.
T Consensus        48 ~~~~~~e~~~l~~l~h~ni~~~~   70 (293)
T cd07843          48 PITSLREINILLKLQHPNIVTVK   70 (293)
T ss_pred             hhhHHHHHHHHHhcCCCCEEEEE
Confidence            34567899999999999999975


No 246
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=33.38  E-value=18  Score=30.59  Aligned_cols=23  Identities=17%  Similarity=-0.028  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|++++.-
T Consensus        44 ~~~~~e~~~l~~l~h~~i~~~~~   66 (256)
T cd08529          44 EEAIDEARVLAKLDSSYIIRYYE   66 (256)
T ss_pred             HHHHHHHHHHHhcCCCCeehhee
Confidence            46888999999999999999763


No 247
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=33.28  E-value=18  Score=31.30  Aligned_cols=22  Identities=18%  Similarity=0.036  Sum_probs=19.3

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++++.|+|||++..
T Consensus        51 ~~~~e~~~l~~l~h~~iv~~~~   72 (284)
T cd05081          51 DFEREIEILKSLQHDNIVKYKG   72 (284)
T ss_pred             HHHHHHHHHHhCCCCCeeEEEE
Confidence            5678999999999999999864


No 248
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=33.15  E-value=19  Score=21.12  Aligned_cols=10  Identities=10%  Similarity=0.198  Sum_probs=6.1

Q ss_pred             ecCcCCcchh
Q psy3210          25 CSQACYLACH   34 (272)
Q Consensus        25 ~c~~c~~~~h   34 (272)
                      .|++||.+|-
T Consensus         3 lcpkcgvgvl   12 (36)
T PF09151_consen    3 LCPKCGVGVL   12 (36)
T ss_dssp             B-TTTSSSBE
T ss_pred             cCCccCceEE
Confidence            5777777664


No 249
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=32.81  E-value=25  Score=38.28  Aligned_cols=30  Identities=13%  Similarity=0.274  Sum_probs=23.3

Q ss_pred             hcccCCCceecCcCCcchhccc-ccCCCCCCC
Q psy3210          16 LKSRGLRPLCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        16 ~~g~~~qg~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      ||....|..+| +||+.-..-- .+.++.||+
T Consensus      1535 LRaFsrQ~~RC-kC~~kyRR~PL~G~C~kCGg 1565 (1627)
T PRK14715       1535 LRAFSRQEFRC-KCGAKYRRVPLKGKCPKCGS 1565 (1627)
T ss_pred             hhhhhccceee-cCCCccccCCCCCcCcccCC
Confidence            44556799999 9999988766 556777876


No 250
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=32.79  E-value=18  Score=31.18  Aligned_cols=24  Identities=21%  Similarity=0.023  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+.+++++.|+|++++.-.
T Consensus        43 ~~~~~E~~~l~~l~h~~i~~~~~~   66 (284)
T cd07836          43 STAIREISLMKELKHENIVRLHDV   66 (284)
T ss_pred             HHHHHHHHHHHhhcCCCEeeeeee
Confidence            456789999999999999998754


No 251
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=32.71  E-value=21  Score=31.27  Aligned_cols=22  Identities=18%  Similarity=0.150  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .|..|+++|+++.|+|+|++.-
T Consensus        63 ~~~~ei~~l~~l~h~~i~~~~~   84 (295)
T cd05097          63 DFLKEIKIMSRLKNPNIIRLLG   84 (295)
T ss_pred             HHHHHHHHHHhCCCCCcCeEEE
Confidence            4778999999999999999864


No 252
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=32.70  E-value=38  Score=19.91  Aligned_cols=23  Identities=13%  Similarity=0.135  Sum_probs=15.4

Q ss_pred             eecCcCCcchhccc-ccCCCCCCC
Q psy3210          24 LCSQACYLACHKQC-IPHTGRCGT   46 (272)
Q Consensus        24 ~~c~~c~~~~h~~c-~~~~~~C~~   46 (272)
                      |.|..||.-.--+- ....+.|+.
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCCCC
Confidence            78889987755443 556677765


No 253
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=32.43  E-value=22  Score=29.77  Aligned_cols=27  Identities=15%  Similarity=0.142  Sum_probs=20.5

Q ss_pred             cCCCceecCcCCcchhcccccCCCCCCC
Q psy3210          19 RGLRPLCSQACYLACHKQCIPHTGRCGT   46 (272)
Q Consensus        19 ~~~qg~~c~~c~~~~h~~c~~~~~~C~~   46 (272)
                      .+.=.|+|..|+.-.+ .=.+.++.||+
T Consensus       135 v~~w~~rC~GC~~~f~-~~~~~Cp~CG~  161 (177)
T COG1439         135 VRKWRLRCHGCKRIFP-EPKDFCPICGS  161 (177)
T ss_pred             EeeeeEEEecCceecC-CCCCcCCCCCC
Confidence            3444699999988887 55666789987


No 254
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=32.23  E-value=20  Score=30.67  Aligned_cols=22  Identities=5%  Similarity=0.016  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|++.|+++.|+|+|++.
T Consensus        46 ~~~~~e~~~l~~l~h~~iv~~~   67 (273)
T cd05035          46 EEFLSEAACMKDFDHPNVMKLI   67 (273)
T ss_pred             HHHHHHHHHHHhCCCCCeeeEE
Confidence            3578899999999999999975


No 255
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=32.18  E-value=22  Score=31.39  Aligned_cols=21  Identities=19%  Similarity=0.123  Sum_probs=18.7

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+.+++++.|+|+|++.
T Consensus        55 ~~~~e~~~~~~l~h~niv~~~   75 (303)
T cd05110          55 EFMDEALIMASMDHPHLVRLL   75 (303)
T ss_pred             HHHHHHHHHHhCCCCCcccEE
Confidence            467899999999999999975


No 256
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=32.04  E-value=20  Score=30.68  Aligned_cols=22  Identities=9%  Similarity=0.067  Sum_probs=19.2

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|..|+.+++++.|+||+++.
T Consensus        50 ~~~~~e~~~l~~l~h~~i~~~~   71 (266)
T cd05033          50 LDFLTEASIMGQFDHPNIIRLE   71 (266)
T ss_pred             HHHHHHHHHHHhCCCCCcceEe
Confidence            3577899999999999999975


No 257
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=32.00  E-value=19  Score=31.27  Aligned_cols=22  Identities=18%  Similarity=0.181  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|+++.|+|||++.
T Consensus        45 ~~~~~E~~~l~~l~h~~iv~~~   66 (287)
T cd07848          45 ETTLRELKMLRTLKQENIVELK   66 (287)
T ss_pred             hhHHHHHHHHHhCCCccccchh
Confidence            4567899999999999999985


No 258
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=31.96  E-value=21  Score=30.39  Aligned_cols=23  Identities=13%  Similarity=0.017  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+|.+|+++++.+.|+|++++..
T Consensus        44 ~~~~~e~~~l~~l~~~~i~~~~~   66 (256)
T cd05059          44 DDFIEEAKVMMKLSHPNLVQLYG   66 (256)
T ss_pred             HHHHHHHHHHHhCCCCCEEEEEE
Confidence            36888999999999999999864


No 259
>KOG0583|consensus
Probab=31.91  E-value=18  Score=33.81  Aligned_cols=18  Identities=22%  Similarity=0.189  Sum_probs=16.7

Q ss_pred             hhhhhhccCC-CCCcccce
Q psy3210         250 GNFRLLSSLF-IVPPVRLS  267 (272)
Q Consensus       250 eE~~~mk~l~-h~~~v~~~  267 (272)
                      +|+.+|+.+. |||||||.
T Consensus        68 rEi~~~~~~~~HpnI~~l~   86 (370)
T KOG0583|consen   68 REISILRRLRSHPNIIRLL   86 (370)
T ss_pred             HHHHHHHHhccCCCEeEEE
Confidence            6899999999 99999986


No 260
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=31.79  E-value=20  Score=31.23  Aligned_cols=23  Identities=13%  Similarity=-0.037  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|+|++..
T Consensus        53 ~~~~~ei~~l~~l~h~~iv~~~~   75 (288)
T cd05050          53 ADFQREAALMAEFDHPNIVKLLG   75 (288)
T ss_pred             HHHHHHHHHHHhcCCCchheEEE
Confidence            35778999999999999999864


No 261
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=31.71  E-value=18  Score=30.80  Aligned_cols=24  Identities=17%  Similarity=0.154  Sum_probs=20.5

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++++.+.|+|||++...
T Consensus        48 ~~~~~e~~~l~~l~h~~iv~~~~~   71 (268)
T cd06630          48 EALRKEIRLMARLNHPHIIRMLGA   71 (268)
T ss_pred             HHHHHHHHHHHHcCCCceehhhce
Confidence            467789999999999999998643


No 262
>KOG1169|consensus
Probab=31.66  E-value=22  Score=35.63  Aligned_cols=26  Identities=23%  Similarity=0.482  Sum_probs=20.5

Q ss_pred             CCCceecCcCCcchhccc-ccCCCCCC
Q psy3210          20 GLRPLCSQACYLACHKQC-IPHTGRCG   45 (272)
Q Consensus        20 ~~qg~~c~~c~~~~h~~c-~~~~~~C~   45 (272)
                      ..||++|.-|+..||..| ......|.
T Consensus       126 ~~~g~~C~~C~~~vh~~C~~~~~~~~~  152 (634)
T KOG1169|consen  126 IKQGLCCDWCGRTVHERCVRRADPECQ  152 (634)
T ss_pred             ccCceeeccccchHHHHHHhhcCcccc
Confidence            379999999999999999 44444433


No 263
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=31.50  E-value=21  Score=30.98  Aligned_cols=22  Identities=18%  Similarity=0.011  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++.+.|+|||++..
T Consensus        53 ~~~~E~~~l~~l~h~niv~~~~   74 (283)
T cd05090          53 EFQQEASLMAELHHPNIVCLLG   74 (283)
T ss_pred             HHHHHHHHHhhCCCCCeeeEEE
Confidence            4667999999999999999864


No 264
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=30.91  E-value=23  Score=32.66  Aligned_cols=23  Identities=17%  Similarity=-0.044  Sum_probs=20.1

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++|+++.|+|||++.+.
T Consensus        47 ~~~~E~~il~~l~h~~iv~l~~~   69 (381)
T cd05626          47 HVKAERDILAEADNEWVVKLYYS   69 (381)
T ss_pred             HHHHHHHHHHhcCCCCeeeeEEE
Confidence            46779999999999999999764


No 265
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=30.82  E-value=22  Score=31.04  Aligned_cols=21  Identities=19%  Similarity=0.137  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+.+|+++.|+|+|++.
T Consensus        53 ~~~~e~~~l~~l~h~~i~~~~   73 (288)
T cd05093          53 DFHREAELLTNLQHEHIVKFY   73 (288)
T ss_pred             HHHHHHHHHHhCCCCCcceEE
Confidence            578899999999999999985


No 266
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=30.67  E-value=22  Score=34.15  Aligned_cols=20  Identities=10%  Similarity=-0.099  Sum_probs=17.6

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +..|+++|+.+.|+|||++.
T Consensus       112 ~~~E~~~l~~l~Hpniv~~~  131 (478)
T PTZ00267        112 ARSELHCLAACDHFGIVKHF  131 (478)
T ss_pred             HHHHHHHHHhCCCCCEeEEE
Confidence            44599999999999999975


No 267
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=30.67  E-value=22  Score=30.80  Aligned_cols=23  Identities=17%  Similarity=-0.023  Sum_probs=20.1

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      +|..|+.+++++.|+|||++...
T Consensus        55 ~~~~e~~~l~~l~~~~i~~~~~~   77 (277)
T cd05036          55 DFLMEALIMSKFNHQNIVRLIGV   77 (277)
T ss_pred             HHHHHHHHHHhCCCCCEeeEEEE
Confidence            57889999999999999998753


No 268
>PF07935 SSV1_ORF_D-335:  ORF D-335-like protein;  InterPro: IPR012922 The sequences featured in this family are similar to a probable integrase (P20214 from SWISSPROT) expressed by the SSV1 virus of the archaeon Sulfolobus shibatae. This protein may be necessary for the integration of the virus into the host genome by a process of site-specific recombination []. 
Probab=30.62  E-value=1.3e+02  Score=21.38  Aligned_cols=44  Identities=16%  Similarity=0.252  Sum_probs=28.7

Q ss_pred             ceEEEEeCCCCCCCCCCCceEEEEeeCCeeeEEEEEEecCCCcceEEeecccccchhhhhhhhhhccc
Q psy3210         110 GTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNS  177 (272)
Q Consensus       110 G~FLVR~s~~~~~~~~~~~y~LSv~~~~~v~H~~I~~~~~g~~~~~~i~~~~~F~sL~eLV~~y~~~~  177 (272)
                      |+|.||+..        +.|          .=|+|...++|..     .+ ..-.+|.++|+.|-...
T Consensus         6 gd~~irE~K--------GkY----------YVY~iE~~~~G~~-----re-~YVGpL~~VVe~Yik~K   49 (72)
T PF07935_consen    6 GDIIIRERK--------GKY----------YVYKIEKDINGER-----RE-TYVGPLDDVVETYIKLK   49 (72)
T ss_pred             CcEEEEEeC--------CeE----------EEEEEEeccCCce-----ee-eeeccHHHHHHHHHhcc
Confidence            789999883        555          3356766455421     11 23568999999998764


No 269
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=30.59  E-value=21  Score=31.11  Aligned_cols=22  Identities=23%  Similarity=-0.065  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+.+.|+|+++++-
T Consensus        49 ~~~~e~~~l~~l~h~ni~~~~~   70 (291)
T cd07870          49 TAIREASLLKGLKHANIVLLHD   70 (291)
T ss_pred             HHHHHHHHHHhcCCCCEeEEEE
Confidence            4678999999999999998864


No 270
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=30.58  E-value=24  Score=23.74  Aligned_cols=15  Identities=13%  Similarity=0.233  Sum_probs=12.5

Q ss_pred             CCCceecCcCCcchh
Q psy3210          20 GLRPLCSQACYLACH   34 (272)
Q Consensus        20 ~~qg~~c~~c~~~~h   34 (272)
                      ..+-|.|+.||+..|
T Consensus        11 ~~v~~~Cp~cGipth   25 (55)
T PF13824_consen   11 AHVNFECPDCGIPTH   25 (55)
T ss_pred             cccCCcCCCCCCcCc
Confidence            456789999999888


No 271
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=30.42  E-value=21  Score=31.47  Aligned_cols=21  Identities=14%  Similarity=0.067  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++++.|+|+|++.
T Consensus        61 ~~~~Ei~~l~~l~h~niv~~~   81 (307)
T cd06607          61 DIIKEVRFLQQLRHPNTIEYK   81 (307)
T ss_pred             HHHHHHHHHHhCCCCCEEEEE
Confidence            467899999999999999975


No 272
>KOG0588|consensus
Probab=30.41  E-value=20  Score=36.30  Aligned_cols=23  Identities=9%  Similarity=-0.143  Sum_probs=18.8

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      |+.--.|+-+||-+.|||+++|-
T Consensus        56 ~~~IerEIviMkLi~HpnVl~Ly   78 (786)
T KOG0588|consen   56 PAGIEREIVIMKLIEHPNVLRLY   78 (786)
T ss_pred             ccchhhhhHHHHHhcCCCeeeee
Confidence            34445699999999999999984


No 273
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=30.40  E-value=22  Score=30.28  Aligned_cols=22  Identities=18%  Similarity=0.101  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|+.+.|+|+|++.
T Consensus        41 ~~~~~e~~~l~~l~h~~iv~~~   62 (257)
T cd05060          41 KEFLREASVMAQLDHPCIVRLI   62 (257)
T ss_pred             HHHHHHHHHHHhcCCCCeeeEE
Confidence            4678899999999999999975


No 274
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=30.29  E-value=23  Score=30.21  Aligned_cols=23  Identities=17%  Similarity=-0.036  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+||+++..
T Consensus        51 ~~~~~e~~~l~~l~h~~i~~~~~   73 (267)
T cd06628          51 DALAREIALLKELQHENIVQYLG   73 (267)
T ss_pred             HHHHHHHHHHHhcCCCCeeeEEE
Confidence            35778999999999999999874


No 275
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=30.22  E-value=21  Score=32.42  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+.+++.+.|+|||++.
T Consensus        66 ~~~~E~~~l~~l~h~niv~~~   86 (359)
T cd07876          66 RAYRELVLLKCVNHKNIISLL   86 (359)
T ss_pred             HHHHHHHHHHhCCCCCEeeee
Confidence            466899999999999999985


No 276
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=30.22  E-value=28  Score=25.90  Aligned_cols=27  Identities=22%  Similarity=0.400  Sum_probs=21.1

Q ss_pred             cCCCceecCcCCcchhcccccCCCCCC
Q psy3210          19 RGLRPLCSQACYLACHKQCIPHTGRCG   45 (272)
Q Consensus        19 ~~~qg~~c~~c~~~~h~~c~~~~~~C~   45 (272)
                      |..+.-.|++||....-.=++.+.+|.
T Consensus        54 Llv~Pa~CkkCGfef~~~~ik~pSRCP   80 (97)
T COG3357          54 LLVRPARCKKCGFEFRDDKIKKPSRCP   80 (97)
T ss_pred             EEecChhhcccCccccccccCCcccCC
Confidence            456888999999999886677666664


No 277
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=30.02  E-value=23  Score=31.08  Aligned_cols=24  Identities=25%  Similarity=0.010  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+.+++++.|+|+|++.-.
T Consensus        47 ~~~~~e~~~l~~l~h~~i~~~~~~   70 (316)
T cd07842          47 QSACREIALLRELKHENVVSLVEV   70 (316)
T ss_pred             HHHHHHHHHHHhcCCCCccceEEE
Confidence            346789999999999999998753


No 278
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=30.00  E-value=26  Score=31.43  Aligned_cols=23  Identities=13%  Similarity=0.002  Sum_probs=20.0

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++|+.+.|+|||++...
T Consensus        47 ~~~~e~~~l~~~~h~~iv~~~~~   69 (333)
T cd05600          47 HVLTERDILTTTKSEWLVKLLYA   69 (333)
T ss_pred             HHHHHHHHHHhCCCCCCccEEEE
Confidence            46789999999999999999753


No 279
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=29.99  E-value=24  Score=30.72  Aligned_cols=22  Identities=18%  Similarity=0.052  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|++++|+|+|++..
T Consensus        39 ~~~~E~~il~~l~~~~i~~~~~   60 (280)
T cd05608          39 GAMVEKRILAKVHSRFIVSLAY   60 (280)
T ss_pred             HHHHHHHHHHhCCCCcEeeeeE
Confidence            4678999999999999999864


No 280
>KOG0598|consensus
Probab=29.81  E-value=26  Score=32.69  Aligned_cols=21  Identities=24%  Similarity=0.126  Sum_probs=18.9

Q ss_pred             hhhhhhhccCCCCCcccceec
Q psy3210         249 WGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       249 VeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..|.+||.+++||.||.|.||
T Consensus        73 ~~Er~IL~~v~hPFiv~l~ys   93 (357)
T KOG0598|consen   73 KAERNILSKIKHPFIVKLIYS   93 (357)
T ss_pred             HHHHHHHHhCCCCcEeeeEEe
Confidence            358899999999999999987


No 281
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=29.69  E-value=23  Score=30.26  Aligned_cols=23  Identities=13%  Similarity=-0.065  Sum_probs=20.1

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ...+..|+++|+++.|+|+|++.
T Consensus        40 ~~~~~~e~~~l~~l~h~~i~~~~   62 (257)
T cd05116          40 KDELLREANVMQQLDNPYIVRMI   62 (257)
T ss_pred             HHHHHHHHHHHHhCCCCCcceEE
Confidence            35688899999999999999885


No 282
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=29.64  E-value=25  Score=30.57  Aligned_cols=22  Identities=14%  Similarity=0.010  Sum_probs=18.6

Q ss_pred             chhhhhhhccCCCCCcccceec
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ...|+++|+++.|+|||++...
T Consensus        40 ~~~E~~il~~l~hp~i~~~~~~   61 (277)
T cd05607          40 ALLEKEILEKVNSPFIVNLAYA   61 (277)
T ss_pred             HHHHHHHHHhcCCCcEEEEEEE
Confidence            4568999999999999998643


No 283
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=29.62  E-value=62  Score=29.16  Aligned_cols=20  Identities=20%  Similarity=0.205  Sum_probs=17.3

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +..|+.+++++.|+|+|++.
T Consensus        61 ~~~E~~~l~~l~h~~iv~~~   80 (343)
T cd07851          61 TYRELRLLKHMDHENVIGLL   80 (343)
T ss_pred             HHHHHHHHHhccCCCHHHHH
Confidence            44689999999999999875


No 284
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=29.56  E-value=23  Score=30.02  Aligned_cols=23  Identities=13%  Similarity=0.015  Sum_probs=20.3

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+|..|+++++++.|+|++++.-
T Consensus        44 ~~~~~e~~~l~~l~~~~i~~~~~   66 (256)
T cd05112          44 EDFIEEAQVMMKLSHPKLVQLYG   66 (256)
T ss_pred             HHHHHHHHHHHhCCCCCeeeEEE
Confidence            46888999999999999999864


No 285
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=29.39  E-value=22  Score=32.04  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=17.8

Q ss_pred             chhhhhhhccCCCCCcccce
Q psy3210         248 YWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +..|+++|+++.|+|||++.
T Consensus        61 ~~~E~~~l~~l~h~~iv~~~   80 (343)
T cd07878          61 TYRELRLLKHMKHENVIGLL   80 (343)
T ss_pred             HHHHHHHHHhcCCCchhhhh
Confidence            55799999999999999975


No 286
>PRK10345 hypothetical protein; Provisional
Probab=29.36  E-value=20  Score=30.69  Aligned_cols=22  Identities=9%  Similarity=-0.067  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccC-----CCCCcccce
Q psy3210         246 QLYWGNFRLLSSL-----FIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l-----~h~~~v~~~  267 (272)
                      .++..|+++++++     .|+||||+.
T Consensus        41 ~~~~rEi~~l~~L~~~~~~h~nIvr~y   67 (210)
T PRK10345         41 KEIRRELKYYAHLSRRLIDWSGIPRYY   67 (210)
T ss_pred             HHHHHHHHHHHHhhccCCCCcccceee
Confidence            4688999999999     579999986


No 287
>KOG1769|consensus
Probab=29.28  E-value=2.2e+02  Score=21.49  Aligned_cols=48  Identities=19%  Similarity=0.237  Sum_probs=31.2

Q ss_pred             chhhhhhhhhhccccccccccccccccccceeeeeeeeccCCCC----CCCCCccCCCcEEEEeee
Q psy3210         164 RSIVELICCYERNSLIENFIGLNVRLQLPFRQIIAVAEFDFCPT----EANQLPLKQGCQVIVLSK  225 (272)
Q Consensus       164 ~sL~eLV~~y~~~~L~~~~~~l~~~L~~P~~~~~~~alydf~~~----~~~ELsl~~Gd~i~v~~k  225 (272)
                      ..|..|.++|....      ++.        ....+-+||=...    .+++|.++.||.|.+...
T Consensus        41 t~LkKLM~aYc~r~------Gl~--------~~s~RFlFdG~rI~~~~TP~~L~mEd~D~Iev~~~   92 (99)
T KOG1769|consen   41 TPLKKLMKAYCERQ------GLS--------MNSLRFLFDGQRIRETHTPADLEMEDGDEIEVVQE   92 (99)
T ss_pred             ChHHHHHHHHHHHc------CCc--------cceEEEEECCcCcCCCCChhhhCCcCCcEEEEEee
Confidence            45777888997764      222        1234455554322    378999999999988753


No 288
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=29.16  E-value=25  Score=30.32  Aligned_cols=21  Identities=24%  Similarity=0.192  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++++.|+|+|++.
T Consensus        46 ~~~~e~~~l~~~~h~~i~~~~   66 (286)
T cd07847          46 IALREIRMLKQLKHPNLVNLI   66 (286)
T ss_pred             HHHHHHHHHHhCCCCCEeeee
Confidence            467899999999999999975


No 289
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=29.09  E-value=24  Score=30.51  Aligned_cols=22  Identities=23%  Similarity=0.051  Sum_probs=19.1

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++++++.|+|++++.
T Consensus        44 ~~~~~e~~~l~~l~h~~i~~~~   65 (285)
T cd07861          44 STAIREISLLKELQHPNIVCLQ   65 (285)
T ss_pred             HHHHHHHHHHHhcCCCCEeeeE
Confidence            3466799999999999999986


No 290
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=29.03  E-value=27  Score=30.18  Aligned_cols=22  Identities=18%  Similarity=-0.064  Sum_probs=18.9

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+.+++++.|+|||++.
T Consensus        53 ~~~~~e~~~~~~l~h~~iv~~~   74 (283)
T cd05091          53 EEFKHEAMMRSRLQHPNIVCLL   74 (283)
T ss_pred             HHHHHHHHHHhcCCCCCcCeEE
Confidence            3467899999999999999885


No 291
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=29.01  E-value=24  Score=30.35  Aligned_cols=24  Identities=13%  Similarity=-0.002  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..|.+|+++|+++.|+|++++...
T Consensus        53 ~~~~~e~~~l~~l~~~~i~~~~~~   76 (280)
T cd05049          53 KDFEREAELLTNFQHENIVKFYGV   76 (280)
T ss_pred             HHHHHHHHHHHhcCCCCchheeeE
Confidence            357789999999999999998653


No 292
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=28.97  E-value=23  Score=32.39  Aligned_cols=21  Identities=5%  Similarity=-0.026  Sum_probs=18.9

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++|+.+.|+|||++.
T Consensus        45 ~~~~E~~~l~~l~h~niv~~~   65 (372)
T cd07853          45 RVFRELKMLCFFKHDNVLSAL   65 (372)
T ss_pred             HHHHHHHHHHhCCCCCcCCHh
Confidence            577899999999999999875


No 293
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=28.92  E-value=24  Score=30.77  Aligned_cols=23  Identities=13%  Similarity=0.118  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++.++|+|+|++..
T Consensus        45 ~~~~~E~~~l~~l~h~~iv~~~~   67 (285)
T cd05605          45 AMALNEKQILEKVNSRFVVSLAY   67 (285)
T ss_pred             HHHHHHHHHHHhcCCCCEeeeee
Confidence            34678999999999999999864


No 294
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=28.85  E-value=24  Score=30.62  Aligned_cols=22  Identities=23%  Similarity=0.114  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|..|+++|+.+.|+|+|++.
T Consensus        47 ~~~~~e~~~l~~l~h~~ii~~~   68 (282)
T cd06643          47 EDYMVEIDILASCDHPNIVKLL   68 (282)
T ss_pred             HHHHHHHHHHHHCCCCCeeeEE
Confidence            3577899999999999999975


No 295
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=28.80  E-value=25  Score=29.63  Aligned_cols=22  Identities=23%  Similarity=0.099  Sum_probs=19.0

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|++++|+|+|++.
T Consensus        44 ~~~~~e~~~l~~l~~~~i~~~~   65 (265)
T cd08217          44 QQLVSEVNILRELKHPNIVRYY   65 (265)
T ss_pred             HHHHHHHHHHHhcCCCccceee
Confidence            3577899999999999999974


No 296
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=28.77  E-value=24  Score=33.15  Aligned_cols=21  Identities=19%  Similarity=0.191  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCC-CCCcccce
Q psy3210         247 LYWGNFRLLSSLF-IVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~-h~~~v~~~  267 (272)
                      .+..|+++|.++. |+|||++.
T Consensus        86 ~~~~E~~~l~~l~~H~niv~~~  107 (401)
T cd05107          86 ALMSELKIMSHLGPHLNIVNLL  107 (401)
T ss_pred             HHHHHHHHHHhcCCCCCeEEEE
Confidence            5778999999998 99999985


No 297
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=28.73  E-value=23  Score=31.86  Aligned_cols=22  Identities=23%  Similarity=0.148  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++++.|||+|++.-
T Consensus        55 ~~~~E~~~l~~l~hpniv~~~~   76 (328)
T cd07856          55 RTYRELKLLKHLRHENIISLSD   76 (328)
T ss_pred             HHHHHHHHHHhcCCCCeeeEee
Confidence            4667999999999999999764


No 298
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=28.64  E-value=26  Score=29.99  Aligned_cols=23  Identities=9%  Similarity=0.059  Sum_probs=19.8

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .|..|+++++++.|+|++++.-.
T Consensus        52 ~~~~e~~~l~~l~h~~i~~~~~~   74 (268)
T cd05063          52 DFLSEASIMGQFSHHNIIRLEGV   74 (268)
T ss_pred             HHHHHHHHHhcCCCCCeeEEEEE
Confidence            57789999999999999998643


No 299
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=28.63  E-value=23  Score=30.62  Aligned_cols=24  Identities=25%  Similarity=-0.021  Sum_probs=20.4

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ...+..|++++++++|+|+|++.-
T Consensus        42 ~~~~~~E~~~l~~l~~~~iv~~~~   65 (283)
T cd07835          42 PSTAIREISLLKELNHPNIVRLLD   65 (283)
T ss_pred             hhHHHHHHHHHHhcCCCCccCHhh
Confidence            346788999999999999999864


No 300
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=28.47  E-value=26  Score=31.02  Aligned_cols=22  Identities=18%  Similarity=0.098  Sum_probs=19.1

Q ss_pred             cchhhhhhhccC-CCCCccccee
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~~  268 (272)
                      .+..|+++++++ .|+|||++.-
T Consensus        84 ~~~~E~~~l~~l~~h~~iv~~~~  106 (302)
T cd05055          84 ALMSELKIMSHLGNHENIVNLLG  106 (302)
T ss_pred             HHHHHHHHHHhccCCCCcceEEE
Confidence            477899999999 7999999864


No 301
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=28.43  E-value=26  Score=27.73  Aligned_cols=13  Identities=8%  Similarity=0.100  Sum_probs=9.9

Q ss_pred             CCceecCcCCcch
Q psy3210          21 LRPLCSQACYLAC   33 (272)
Q Consensus        21 ~qg~~c~~c~~~~   33 (272)
                      .|.|+|+.|+-..
T Consensus        51 ~qRyrC~~C~~tf   63 (129)
T COG3677          51 HQRYKCKSCGSTF   63 (129)
T ss_pred             ccccccCCcCcce
Confidence            7889998886543


No 302
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=28.35  E-value=27  Score=30.49  Aligned_cols=22  Identities=23%  Similarity=-0.005  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|+|++.-
T Consensus        47 ~~~~e~~~l~~l~h~~i~~~~~   68 (290)
T cd05580          47 HVLNEKRILQSIRHPFLVNLYG   68 (290)
T ss_pred             HHHHHHHHHHhCCCCCccceee
Confidence            4678999999999999999853


No 303
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=28.27  E-value=31  Score=23.58  Aligned_cols=21  Identities=19%  Similarity=0.139  Sum_probs=15.4

Q ss_pred             ccCCCceecCcCCcchhcccc
Q psy3210          18 SRGLRPLCSQACYLACHKQCI   38 (272)
Q Consensus        18 g~~~qg~~c~~c~~~~h~~c~   38 (272)
                      +++..-+.|..||..+...|.
T Consensus        20 ~~~~rrhhCr~CG~~vC~~Cs   40 (69)
T PF01363_consen   20 SLFRRRHHCRNCGRVVCSSCS   40 (69)
T ss_dssp             BSSS-EEE-TTT--EEECCCS
T ss_pred             CCceeeEccCCCCCEECCchh
Confidence            788999999999999999884


No 304
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=28.16  E-value=25  Score=32.47  Aligned_cols=22  Identities=23%  Similarity=0.126  Sum_probs=19.2

Q ss_pred             cchhhhhhhccC-CCCCccccee
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~~  268 (272)
                      .+..|+++|+++ .|+|||++.-
T Consensus        87 ~~~~E~~il~~l~~h~nIv~~~~  109 (374)
T cd05106          87 ALMSELKILSHLGQHKNIVNLLG  109 (374)
T ss_pred             HHHHHHHHHHhhccCCceeeEee
Confidence            467899999999 8999999874


No 305
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=28.15  E-value=27  Score=30.44  Aligned_cols=24  Identities=13%  Similarity=0.148  Sum_probs=20.7

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++|+.++|+|+|++.+.
T Consensus        45 ~~~~~E~~il~~l~~~~i~~~~~~   68 (285)
T cd05632          45 SMALNEKQILEKVNSQFVVNLAYA   68 (285)
T ss_pred             HHHHHHHHHHHHcCCcCceeEEEE
Confidence            346789999999999999998764


No 306
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=27.91  E-value=26  Score=31.48  Aligned_cols=21  Identities=5%  Similarity=-0.012  Sum_probs=18.5

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+++|++++++++|+|||++.
T Consensus        49 ~~~~E~~~l~~l~h~niv~~~   69 (336)
T cd07849          49 RTLREIKILRRFKHENIIGIL   69 (336)
T ss_pred             HHHHHHHHHHhCCCCCcCchh
Confidence            467799999999999999985


No 307
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=27.84  E-value=27  Score=30.46  Aligned_cols=24  Identities=17%  Similarity=0.173  Sum_probs=20.6

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..++.|+++|+++.|+|+|++.+.
T Consensus        45 ~~~~~E~~il~~l~~~~iv~~~~~   68 (285)
T cd05631          45 AMALNEKRILEKVNSRFVVSLAYA   68 (285)
T ss_pred             HHHHHHHHHHHhcCCCcEEEEEEE
Confidence            357789999999999999998753


No 308
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=27.53  E-value=27  Score=29.89  Aligned_cols=21  Identities=19%  Similarity=-0.067  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++.++|+|||++.
T Consensus        51 ~~~~e~~~l~~l~h~~iv~~~   71 (268)
T cd06624          51 PLHEEIALHSYLKHRNIVQYL   71 (268)
T ss_pred             HHHHHHHHHHhcCCCCeeeee
Confidence            466799999999999999986


No 309
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=27.50  E-value=26  Score=31.69  Aligned_cols=22  Identities=14%  Similarity=0.126  Sum_probs=19.1

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+++++++.|+|||++.
T Consensus        59 ~~~~~e~~~l~~l~h~niv~~~   80 (342)
T cd07879          59 KRAYRELTLLKHMQHENVIGLL   80 (342)
T ss_pred             hHHHHHHHHHHhcCCCCccchh
Confidence            3467899999999999999875


No 310
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=27.44  E-value=31  Score=21.01  Aligned_cols=11  Identities=18%  Similarity=0.428  Sum_probs=9.1

Q ss_pred             CCCceecCcCC
Q psy3210          20 GLRPLCSQACY   30 (272)
Q Consensus        20 ~~qg~~c~~c~   30 (272)
                      ..|-|+|+.|.
T Consensus        26 G~qryrC~~C~   36 (36)
T PF03811_consen   26 GHQRYRCKDCR   36 (36)
T ss_pred             CCEeEecCcCC
Confidence            47889999994


No 311
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=27.35  E-value=25  Score=31.86  Aligned_cols=21  Identities=10%  Similarity=0.045  Sum_probs=18.5

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+.+|+.+.|+|||++.
T Consensus        62 ~~~~E~~~l~~l~h~niv~~~   82 (355)
T cd07874          62 RAYRELVLMKCVNHKNIISLL   82 (355)
T ss_pred             HHHHHHHHHHHhCCCchhcee
Confidence            466799999999999999985


No 312
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=27.17  E-value=19  Score=30.45  Aligned_cols=24  Identities=21%  Similarity=0.074  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++++++.|+|++++...
T Consensus        38 ~~~~~e~~~l~~~~h~~i~~~~~~   61 (265)
T cd05579          38 DQVLTERDILSQAQSPYVVKLYYS   61 (265)
T ss_pred             HHHHHHHHHHHhCCCcchhHHHHh
Confidence            457788999999999999998653


No 313
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=27.14  E-value=27  Score=31.10  Aligned_cols=21  Identities=5%  Similarity=0.014  Sum_probs=18.9

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++++.|+|+|++.
T Consensus        71 ~~~~e~~~l~~l~h~~iv~~~   91 (317)
T cd06635          71 DIIKEVKFLQRIKHPNSIEYK   91 (317)
T ss_pred             HHHHHHHHHHhCCCCCEEEEE
Confidence            577899999999999999976


No 314
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=27.14  E-value=27  Score=30.01  Aligned_cols=21  Identities=14%  Similarity=0.132  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .|..|+++|+.+.|+|+|++.
T Consensus        55 ~~~~e~~~l~~~~~~~i~~~~   75 (277)
T cd05032          55 EFLNEASVMKEFNCHHVVRLL   75 (277)
T ss_pred             HHHHHHHHHHhCCCCceeEEE
Confidence            577899999999999999975


No 315
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=27.10  E-value=24  Score=30.30  Aligned_cols=24  Identities=25%  Similarity=0.032  Sum_probs=20.6

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ...+..|+++++++.|+|++++.-
T Consensus        42 ~~~~~~e~~~l~~l~~~~i~~~~~   65 (287)
T cd07840          42 PITAIREIKLLQKLRHPNIVRLKE   65 (287)
T ss_pred             hHHHHHHHHHHHhccCCCeeehee
Confidence            456888999999999999998763


No 316
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=27.06  E-value=26  Score=31.41  Aligned_cols=21  Identities=5%  Similarity=0.025  Sum_probs=18.1

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+.+|+++.|+|||+++
T Consensus        50 ~~~~e~~~l~~l~h~~iv~~~   70 (334)
T cd07855          50 RTLRELKILRHFKHDNIIAIR   70 (334)
T ss_pred             HHHHHHHHHHhcCCCCccCHH
Confidence            456789999999999999875


No 317
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=26.92  E-value=75  Score=28.71  Aligned_cols=21  Identities=10%  Similarity=-0.002  Sum_probs=18.1

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++++.|+|+|++.
T Consensus        61 ~~~~E~~~l~~l~h~~iv~~~   81 (353)
T cd07850          61 RAYRELVLMKLVNHKNIIGLL   81 (353)
T ss_pred             HHHHHHHHHHhcCCCCCccee
Confidence            355799999999999999875


No 318
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=26.90  E-value=23  Score=32.04  Aligned_cols=23  Identities=9%  Similarity=-0.025  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+.+|+++|+++.|+|||++..
T Consensus        47 ~~~~~Ei~~l~~l~h~~i~~~~~   69 (342)
T cd07854          47 KHALREIKIIRRLDHDNIVKVYE   69 (342)
T ss_pred             HHHHHHHHHHHhcCCCcchhhHh
Confidence            34778999999999999999864


No 319
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=26.72  E-value=30  Score=30.92  Aligned_cols=22  Identities=5%  Similarity=-0.251  Sum_probs=18.6

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+.+|+.+++.+.|+|||+++
T Consensus        44 ~~~~~e~~~~~~l~h~niv~~~   65 (328)
T cd08226          44 KALQNEVVLSHFFRHPNIMTSW   65 (328)
T ss_pred             HHHHHHHHHHHhCCCCCcceEe
Confidence            3567788999999999999975


No 320
>PHA00626 hypothetical protein
Probab=26.71  E-value=33  Score=23.17  Aligned_cols=17  Identities=12%  Similarity=0.055  Sum_probs=13.6

Q ss_pred             CCceecCcCCcchhccc
Q psy3210          21 LRPLCSQACYLACHKQC   37 (272)
Q Consensus        21 ~qg~~c~~c~~~~h~~c   37 (272)
                      .|-|.|+.||...-|.-
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            48899999998776654


No 321
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=26.54  E-value=27  Score=29.60  Aligned_cols=22  Identities=14%  Similarity=0.095  Sum_probs=19.4

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+.+++++.|+|+|++.-
T Consensus        46 ~~~~e~~~l~~l~~~~i~~~~~   67 (256)
T cd05039          46 AFLAEASVMTTLRHPNLVQLLG   67 (256)
T ss_pred             HHHHHHHHHHhcCCcceeeeEE
Confidence            5778999999999999999863


No 322
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=26.48  E-value=26  Score=30.21  Aligned_cols=22  Identities=14%  Similarity=-0.224  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++++.|+|||++.-
T Consensus        48 ~~~~e~~~l~~l~h~~i~~~~~   69 (277)
T cd06642          48 DIQQEITVLSQCDSPYITRYYG   69 (277)
T ss_pred             HHHHHHHHHHcCCCCccHhhhc
Confidence            4678999999999999999864


No 323
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=26.29  E-value=28  Score=31.57  Aligned_cols=21  Identities=19%  Similarity=0.180  Sum_probs=18.2

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|++++++++|+|||++.
T Consensus        62 ~~~~Ei~~l~~l~h~~iv~~~   82 (345)
T cd07877          62 RTYRELRLLKHMKHENVIGLL   82 (345)
T ss_pred             HHHHHHHHHHHcCCCccccee
Confidence            356799999999999999975


No 324
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=26.16  E-value=30  Score=29.60  Aligned_cols=22  Identities=18%  Similarity=0.037  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++++.|+|||++.-
T Consensus        50 ~~~~E~~~l~~l~h~~i~~~~~   71 (265)
T cd06652          50 ALECEIQLLKNLLHERIVQYYG   71 (265)
T ss_pred             HHHHHHHHHHhcCCCCeeeEEe
Confidence            4667999999999999999764


No 325
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=26.12  E-value=30  Score=29.31  Aligned_cols=23  Identities=9%  Similarity=-0.103  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|+|++..
T Consensus        45 ~~~~~e~~~l~~~~h~~i~~~~~   67 (262)
T cd06613          45 EIIQQEISMLKECRHPNIVAYFG   67 (262)
T ss_pred             HHHHHHHHHHHhCCCCChhceEE
Confidence            45778999999999999999864


No 326
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=26.09  E-value=30  Score=31.75  Aligned_cols=23  Identities=22%  Similarity=-0.015  Sum_probs=19.7

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++|+++.|+|||++...
T Consensus        47 ~~~~E~~il~~~~h~~iv~~~~~   69 (382)
T cd05625          47 HVKAERDILAEADNEWVVRLYYS   69 (382)
T ss_pred             HHHHHHHHHHhCCCCcCCeEEEE
Confidence            46679999999999999999753


No 327
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=25.98  E-value=34  Score=30.60  Aligned_cols=23  Identities=17%  Similarity=-0.023  Sum_probs=19.7

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .++.|+++|+++.|+|||++...
T Consensus        41 ~~~~e~~~l~~~~hp~i~~~~~~   63 (325)
T cd05594          41 HTLTENRVLQNSRHPFLTALKYS   63 (325)
T ss_pred             HHHHHHHHHHhCCCCCCCceEEE
Confidence            46789999999999999998653


No 328
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=25.87  E-value=29  Score=30.02  Aligned_cols=22  Identities=9%  Similarity=-0.242  Sum_probs=19.3

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|++++++++|+|+|++..
T Consensus        48 ~~~~e~~~l~~l~h~~iv~~~~   69 (277)
T cd06641          48 DIQQEITVLSQCDSPYVTKYYG   69 (277)
T ss_pred             HHHHHHHHHHhcCCCCEeEEEE
Confidence            5677999999999999999864


No 329
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=25.80  E-value=30  Score=30.14  Aligned_cols=23  Identities=17%  Similarity=-0.038  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|+|++.-
T Consensus        47 ~~~~~e~~~l~~~~h~~i~~~~~   69 (298)
T cd07841          47 FTALREIKLLQELKHPNIIGLLD   69 (298)
T ss_pred             HHHHHHHHHHhhcCCCCChhhhh
Confidence            34678999999999999999864


No 330
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=25.69  E-value=28  Score=30.20  Aligned_cols=22  Identities=5%  Similarity=-0.046  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++++.++|+|||++.
T Consensus        48 ~~~~~E~~~l~~l~h~~i~~~~   69 (284)
T cd06620          48 KQILRELQIMHECRSPYIVSFY   69 (284)
T ss_pred             HHHHHHHHHHHHcCCCCcceEe
Confidence            4577899999999999999986


No 331
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=25.59  E-value=30  Score=30.95  Aligned_cols=21  Identities=5%  Similarity=0.048  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+++++++.|+|+|++.
T Consensus        66 ~~~~E~~~l~~l~h~~iv~~~   86 (335)
T PTZ00024         66 TTLRELKIMNEIKHENIMGLV   86 (335)
T ss_pred             hHHHHHHHHHhCCCcceeeee
Confidence            578899999999999999976


No 332
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=25.53  E-value=31  Score=31.18  Aligned_cols=21  Identities=19%  Similarity=0.175  Sum_probs=18.4

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++|+++.|+|||++.
T Consensus        60 ~~~~E~~~l~~l~h~~iv~~~   80 (343)
T cd07880          60 RAYRELRLLKHMKHENVIGLL   80 (343)
T ss_pred             HHHHHHHHHHhcCCCCcccee
Confidence            466799999999999999875


No 333
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=25.52  E-value=31  Score=29.56  Aligned_cols=22  Identities=18%  Similarity=-0.032  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|++++++++|+||+++.-
T Consensus        50 ~~~~e~~~l~~l~h~~i~~~~~   71 (266)
T cd06651          50 ALECEIQLLKNLQHERIVQYYG   71 (266)
T ss_pred             HHHHHHHHHHHcCCCCeeeEEE
Confidence            3667899999999999999763


No 334
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=25.49  E-value=33  Score=29.27  Aligned_cols=23  Identities=13%  Similarity=-0.129  Sum_probs=19.6

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+.+++++.|+|+|++..+
T Consensus        52 ~~~~e~~~l~~~~h~~ii~~~~~   74 (267)
T cd06646          52 LIQQEIFMVKECKHCNIVAYFGS   74 (267)
T ss_pred             HHHHHHHHHHhcCCCCeeeeeEE
Confidence            35679999999999999998764


No 335
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=25.28  E-value=31  Score=29.67  Aligned_cols=23  Identities=13%  Similarity=-0.165  Sum_probs=20.0

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++++++.|+|++++...
T Consensus        45 ~~~~e~~~l~~l~h~~i~~~~~~   67 (274)
T cd06609          45 DIQQEIQFLSQCRSPYITKYYGS   67 (274)
T ss_pred             HHHHHHHHHHHcCCCCeeeeeEE
Confidence            56789999999999999998754


No 336
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=25.20  E-value=36  Score=31.23  Aligned_cols=22  Identities=14%  Similarity=-0.135  Sum_probs=18.9

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+++.|+|||++..
T Consensus        47 ~~~~E~~il~~l~hp~iv~~~~   68 (377)
T cd05629          47 HVKAERDVLAESDSPWVVSLYY   68 (377)
T ss_pred             HHHHHHHHHHhCCCCCcceEEE
Confidence            4567999999999999999864


No 337
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=25.18  E-value=32  Score=30.59  Aligned_cols=22  Identities=9%  Similarity=-0.028  Sum_probs=19.3

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++.++|+|+|++.-
T Consensus        67 ~~~~E~~~l~~l~h~~iv~~~~   88 (313)
T cd06633          67 DIIKEVKFLQQLKHPNTIEYKG   88 (313)
T ss_pred             HHHHHHHHHHhCCCCCCccEEE
Confidence            4678999999999999999874


No 338
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=25.15  E-value=29  Score=29.90  Aligned_cols=23  Identities=13%  Similarity=-0.068  Sum_probs=20.4

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      +..+..|+.+++++.|+|++++.
T Consensus        43 ~~~~~~e~~~l~~~~~~~i~~~~   65 (286)
T cd07832          43 PNQALREIKALQACQHPYVVKLL   65 (286)
T ss_pred             hHHHHHHHHHHHhCCCCCCccee
Confidence            45788999999999999999875


No 339
>KOG0580|consensus
Probab=25.08  E-value=38  Score=30.20  Aligned_cols=23  Identities=17%  Similarity=0.039  Sum_probs=19.4

Q ss_pred             eeccchhhhhhhccCCCCCcccc
Q psy3210         244 FFQLYWGNFRLLSSLFIVPPVRL  266 (272)
Q Consensus       244 fP~~yVeE~~~mk~l~h~~~v~~  266 (272)
                      ++...-+|+.|=..|+||||.||
T Consensus        65 v~~qlrREiEIqs~L~hpnilrl   87 (281)
T KOG0580|consen   65 VEHQLRREIEIQSHLRHPNILRL   87 (281)
T ss_pred             chhhhhheeEeecccCCccHHhh
Confidence            45566779999999999999997


No 340
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=25.06  E-value=33  Score=28.95  Aligned_cols=21  Identities=10%  Similarity=-0.077  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++.+.|+|+++++
T Consensus        45 ~~~~e~~~l~~~~~~~i~~~~   65 (256)
T cd08220          45 AAQNECQVLKLLSHPNIIEYY   65 (256)
T ss_pred             HHHHHHHHHhhCCCCchhhee
Confidence            577899999999999999876


No 341
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=25.03  E-value=32  Score=30.39  Aligned_cols=23  Identities=17%  Similarity=0.179  Sum_probs=19.3

Q ss_pred             cchhhhhhhccC-CCCCcccceec
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~~~  269 (272)
                      .+.+|+++++++ .|+|||+++..
T Consensus        53 ~~~~Ei~~l~~l~~h~~iv~~~~~   76 (303)
T cd05088          53 DFAGELEVLCKLGHHPNIINLLGA   76 (303)
T ss_pred             HHHHHHHHHHHhcCCCCcceEEEE
Confidence            466799999999 89999998754


No 342
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=25.00  E-value=32  Score=29.46  Aligned_cols=23  Identities=13%  Similarity=-0.073  Sum_probs=19.6

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++|+++.|+|+|++...
T Consensus        54 ~~~~e~~~l~~l~h~~i~~~~~~   76 (272)
T cd06629          54 ALRSEIETLKDLDHLNIVQYLGF   76 (272)
T ss_pred             HHHHHHHHHHhcCCCCcceEEEE
Confidence            46679999999999999998754


No 343
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=24.86  E-value=34  Score=29.53  Aligned_cols=23  Identities=26%  Similarity=0.059  Sum_probs=19.8

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..|..|+++|+++.|+|++++.-
T Consensus        53 ~~~~~ei~~l~~l~h~~i~~~~~   75 (283)
T cd05048          53 QEFRQEAELMSDLQHPNIVCLLG   75 (283)
T ss_pred             HHHHHHHHHHHhcCCcccceEEE
Confidence            34778999999999999999874


No 344
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=24.79  E-value=33  Score=29.65  Aligned_cols=24  Identities=13%  Similarity=-0.168  Sum_probs=20.7

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..+..|+++++++.|+|+|++...
T Consensus        47 ~~~~~e~~~l~~l~h~~i~~~~~~   70 (277)
T cd06640          47 EDIQQEITVLSQCDSPYVTKYYGS   70 (277)
T ss_pred             HHHHHHHHHHHhCCCCCEeeEEEE
Confidence            357789999999999999998764


No 345
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=24.76  E-value=28  Score=31.21  Aligned_cols=23  Identities=4%  Similarity=-0.075  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccC-CCCCccccee
Q psy3210         246 QLYWGNFRLLSSL-FIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l-~h~~~v~~~~  268 (272)
                      ..+..|+++|+++ .|+|||++.-
T Consensus        62 ~~~~~E~~~l~~l~~h~~iv~~~~   85 (334)
T cd05100          62 SDLVSEMEMMKMIGKHKNIINLLG   85 (334)
T ss_pred             HHHHHHHHHHHhhcCCCCeeeeeE
Confidence            3577899999999 8999999764


No 346
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=24.64  E-value=38  Score=29.57  Aligned_cols=24  Identities=17%  Similarity=0.045  Sum_probs=20.4

Q ss_pred             ccchhhhhhhccCCCCCcccceec
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      ..|..|+++++++.|+|+|++...
T Consensus        52 ~~~~~e~~~l~~l~h~~i~~~~~~   75 (291)
T cd05094          52 KDFQREAELLTNLQHEHIVKFYGV   75 (291)
T ss_pred             HHHHHHHHHHhcCCCCCcceEEEE
Confidence            357789999999999999998753


No 347
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=24.50  E-value=26  Score=30.33  Aligned_cols=23  Identities=9%  Similarity=-0.125  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|+|++.-
T Consensus        44 ~~~~~e~~~l~~~~~~~i~~~~~   66 (286)
T cd06622          44 NQIIMELDILHKAVSPYIVDFYG   66 (286)
T ss_pred             HHHHHHHHHHHhcCCCcHHhhhh
Confidence            35778999999999999999863


No 348
>PF00630 Filamin:  Filamin/ABP280 repeat;  InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod. Whereas their actin-binding domains consist of two calponin homology domains (see IPR001715 from INTERPRO), their rods fall into three families. The rod domain of the family including the Dictyostelium discoideum (Slime mould) gelation factor (ABP120) and human filamin (ABP280) is constructed from tandem repeats of a 100-residue motif that is glycine and proline rich []. The gelation factor's rod contains 6 copies of the repeat, whereas filamin has a rod constructed from 24 repeats. The resolution of the 3D structure of rod repeats from the gelation factor has shown that they consist of a beta-sandwich, formed by two beta-sheets arranged in an immunoglobulin-like fold [, ]. Because conserved residues that form the core of the repeats are preserved in filamin, the repeat structure should be common to the members of the gelation factor/filamin family. The head to tail homodimerisation is crucial to the function of the ABP120 and ABP280 proteins. This interaction involves a small portion at the distal end of the rod domains. For the gelation factor it has been shown that the carboxy-terminal repeat 6 dimerises through a double edge-to-edge extension of the beta-sheet and that repeat 5 contributes to dimerisation to some extent [, , ].; PDB: 2DI9_A 2EEC_A 2DIC_A 2EEA_A 2DMC_A 2EE9_A 2D7O_A 2D7N_A 2K7P_A 2NQC_A ....
Probab=24.46  E-value=70  Score=23.17  Aligned_cols=29  Identities=28%  Similarity=0.486  Sum_probs=21.6

Q ss_pred             ccCCCceEEEEeCCCCCCCCCCCceEEEEeeCCe
Q psy3210         105 EREADGTYLLRIRPQGPTHPNETIYALSLKTDEK  138 (272)
Q Consensus       105 ~~~~~G~FLVR~s~~~~~~~~~~~y~LSv~~~~~  138 (272)
                      .+..+|+|.|+-....     .|.|.|+|+.++.
T Consensus        65 ~~~~~G~y~v~y~p~~-----~G~y~i~V~~~g~   93 (101)
T PF00630_consen   65 IDNGDGTYTVSYTPTE-----PGKYKISVKINGQ   93 (101)
T ss_dssp             EEESSSEEEEEEEESS-----SEEEEEEEEESSE
T ss_pred             EECCCCEEEEEEEeCc-----cEeEEEEEEECCE
Confidence            3456799999877643     5889999888763


No 349
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=24.34  E-value=32  Score=29.04  Aligned_cols=23  Identities=13%  Similarity=-0.104  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|++++++++|+|+|++.-
T Consensus        44 ~~~~~E~~~l~~~~h~~i~~~~~   66 (257)
T cd08225          44 EASKKEVILLAKMKHPNIVTFFA   66 (257)
T ss_pred             HHHHHHHHHHHhCCCCChhhhhh
Confidence            35668999999999999999863


No 350
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=24.28  E-value=37  Score=31.05  Aligned_cols=23  Identities=13%  Similarity=-0.078  Sum_probs=19.6

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++|+++.|+|||++..
T Consensus        46 ~~~~~E~~il~~l~h~~iv~~~~   68 (376)
T cd05598          46 AHVKAERDILAEADNEWVVKLYY   68 (376)
T ss_pred             HHHHHHHHHHHhCCCCCcceEEE
Confidence            34667999999999999999864


No 351
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=24.27  E-value=38  Score=18.73  Aligned_cols=11  Identities=18%  Similarity=0.377  Sum_probs=8.5

Q ss_pred             CCceecCcCCc
Q psy3210          21 LRPLCSQACYL   31 (272)
Q Consensus        21 ~qg~~c~~c~~   31 (272)
                      .--|.|+.||.
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            45689999983


No 352
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=24.24  E-value=31  Score=30.40  Aligned_cols=21  Identities=10%  Similarity=-0.152  Sum_probs=18.7

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++|+.+.|+|||++.
T Consensus        45 ~~~~Ei~~l~~l~h~~i~~~~   65 (314)
T cd08216          45 LLQQEIITSRQLQHPNILPYV   65 (314)
T ss_pred             HHHHHHHHHHhcCCcchhhhh
Confidence            577899999999999999975


No 353
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=24.12  E-value=35  Score=29.72  Aligned_cols=22  Identities=14%  Similarity=0.083  Sum_probs=19.2

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+.+|+.+.|+|+++++-
T Consensus        55 ~~~~e~~~l~~l~~~~i~~~~~   76 (288)
T cd05061          55 EFLNEASVMKGFTCHHVVRLLG   76 (288)
T ss_pred             HHHHHHHHHHhCCCCCeeeEEE
Confidence            4677899999999999999874


No 355
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=24.11  E-value=31  Score=29.06  Aligned_cols=23  Identities=13%  Similarity=-0.055  Sum_probs=20.2

Q ss_pred             eccchhhhhhhccCCCCCcccce
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ...+.+|+++++++.|+|++++.
T Consensus        42 ~~~~~~e~~~~~~l~~~~i~~~~   64 (256)
T cd06612          42 LQEIIKEISILKQCDSPYIVKYY   64 (256)
T ss_pred             HHHHHHHHHHHHhCCCCcEeeee
Confidence            35688999999999999999875


No 356
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=23.99  E-value=26  Score=30.24  Aligned_cols=24  Identities=21%  Similarity=0.080  Sum_probs=20.1

Q ss_pred             eccchhhhhhhccCCCCCccccee
Q psy3210         245 FQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       245 P~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ...+.+|+++|+.+.|+|++++.-
T Consensus        44 ~~~~~~e~~~l~~l~h~~i~~~~~   67 (286)
T cd07846          44 KKIAMREIRMLKQLRHENLVNLIE   67 (286)
T ss_pred             hHHHHHHHHHHHhcCCcchhhHHH
Confidence            345778999999999999998753


No 357
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=23.89  E-value=39  Score=31.09  Aligned_cols=21  Identities=14%  Similarity=0.313  Sum_probs=18.7

Q ss_pred             chhhhhhhccCCCCCccccee
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      +.+|+++|+.++|+|||++..
T Consensus        90 ~~~e~~il~~~~h~~iv~~~~  110 (370)
T cd05596          90 FWEERDIMAHANSEWIVQLHY  110 (370)
T ss_pred             HHHHHHHHHhCCCCCcceEEE
Confidence            567999999999999999974


No 358
>KOG4718|consensus
Probab=23.85  E-value=25  Score=30.29  Aligned_cols=22  Identities=18%  Similarity=0.517  Sum_probs=19.4

Q ss_pred             cccCCCceecCcCCcchhcccc
Q psy3210          17 KSRGLRPLCSQACYLACHKQCI   38 (272)
Q Consensus        17 ~g~~~qg~~c~~c~~~~h~~c~   38 (272)
                      +-|.-||-+|..|||.-|-.|+
T Consensus       188 h~LvIqg~rCg~c~i~~h~~c~  209 (235)
T KOG4718|consen  188 HCLVIQGIRCGSCNIQYHRGCI  209 (235)
T ss_pred             HHHhheeeccCcccchhhhHHH
Confidence            4577899999999999999993


No 359
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=23.82  E-value=37  Score=29.91  Aligned_cols=23  Identities=13%  Similarity=-0.148  Sum_probs=20.1

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+.+|+++++.+.|+|||++...
T Consensus        47 ~~~~e~~~l~~~~~~~i~~~~~~   69 (305)
T cd05609          47 QVFVERDILTFAENPFVVSMFCS   69 (305)
T ss_pred             HHHHHHHHHHhCCCCCeeeeEEE
Confidence            57789999999999999998754


No 360
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=23.78  E-value=34  Score=22.69  Aligned_cols=24  Identities=17%  Similarity=0.177  Sum_probs=13.2

Q ss_pred             ehhcccCCCceecCcCCcchhccc
Q psy3210          14 VTLKSRGLRPLCSQACYLACHKQC   37 (272)
Q Consensus        14 ~~~~g~~~qg~~c~~c~~~~h~~c   37 (272)
                      .--+....|+-+|+.|++.+-..+
T Consensus        15 ~k~~~~S~~PatCP~C~a~~~~sr   38 (54)
T PF09237_consen   15 PKSKSQSEQPATCPICGAVIRQSR   38 (54)
T ss_dssp             -CCCCTTS--EE-TTT--EESSHH
T ss_pred             HHHhhccCCCCCCCcchhhccchh
Confidence            334677899999999998776544


No 361
>COG3168 PilP Tfp pilus assembly protein PilP [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=23.72  E-value=60  Score=26.68  Aligned_cols=47  Identities=26%  Similarity=0.521  Sum_probs=25.3

Q ss_pred             CCcceeecCccCcCCccccc----EeeeeCCHHHHHHhcccCCCceEEEEe
Q psy3210          70 GGNEWTAKSWADHENLSEYL----WFVGEMGREKATSLLEREADGTYLLRI  116 (272)
Q Consensus        70 ~~~g~~P~~~~~~~~l~~~~----Wf~g~isR~~Ae~lL~~~~~G~FLVR~  116 (272)
                      ++++|-|.......-|+.++    -+.|.|+|-+-...|...++|+|-||.
T Consensus        75 ~~n~~~Pdp~r~kepLE~fpLe~~rlvGtm~~g~~~~A~i~~~~~v~~V~v  125 (170)
T COG3168          75 GENDWAPDPKRRKEPLEKFPLETFRLVGTLKSGQGVSALIEAPGGVYRVRV  125 (170)
T ss_pred             ccCCCCCCcccccCchhhCChhheeeEEEecCCCceEEEEEcCCceEEEee
Confidence            44567776665555555543    356666655544444444455544444


No 362
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=23.68  E-value=34  Score=29.42  Aligned_cols=23  Identities=17%  Similarity=0.184  Sum_probs=19.7

Q ss_pred             ccchhhhhhhccC-CCCCccccee
Q psy3210         246 QLYWGNFRLLSSL-FIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l-~h~~~v~~~~  268 (272)
                      ..|..|+++++++ .|+|+|++..
T Consensus        40 ~~~~~E~~~l~~l~~h~~iv~~~~   63 (270)
T cd05047          40 RDFAGELEVLCKLGHHPNIINLLG   63 (270)
T ss_pred             HHHHHHHHHHHhhccCCCeeeEEE
Confidence            3577899999999 8999999864


No 363
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=23.65  E-value=38  Score=29.41  Aligned_cols=22  Identities=23%  Similarity=-0.064  Sum_probs=18.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ++..|+.+++++.|+|||++.-
T Consensus        55 ~~~~~~~~l~~l~h~~iv~~~~   76 (279)
T cd05111          55 EITDHMLAMGSLDHAYIVRLLG   76 (279)
T ss_pred             HHHHHHHHHhcCCCCCcceEEE
Confidence            4666777899999999999863


No 364
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=23.64  E-value=36  Score=29.10  Aligned_cols=22  Identities=18%  Similarity=-0.056  Sum_probs=19.3

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++++.|+||+++..
T Consensus        50 ~~~~ei~~l~~l~h~~i~~~~~   71 (264)
T cd06653          50 ALECEIQLLKNLRHDRIVQYYG   71 (264)
T ss_pred             HHHHHHHHHHHcCCCCcceEEE
Confidence            5677999999999999999874


No 365
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=23.56  E-value=34  Score=29.47  Aligned_cols=23  Identities=17%  Similarity=0.039  Sum_probs=20.2

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++|+++.|+|++++..
T Consensus        45 ~~~~~e~~~l~~l~~~~i~~~~~   67 (288)
T cd07833          45 KTALREVKVLRQLRHENIVNLKE   67 (288)
T ss_pred             hHHHHHHHHHHhcCCCCeeehhh
Confidence            46788999999999999999864


No 366
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=23.19  E-value=39  Score=29.26  Aligned_cols=22  Identities=23%  Similarity=0.049  Sum_probs=19.6

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++++.+.|+||+++..
T Consensus        53 ~~~~e~~~l~~l~h~~i~~~~~   74 (280)
T cd05092          53 DFQREAELLTVLQHQHIVRFYG   74 (280)
T ss_pred             HHHHHHHHHhcCCCCCCceEEE
Confidence            5778999999999999999864


No 367
>KOG1829|consensus
Probab=23.11  E-value=22  Score=35.36  Aligned_cols=21  Identities=19%  Similarity=0.485  Sum_probs=18.3

Q ss_pred             ceecCcCCcchhcccccCCCC
Q psy3210          23 PLCSQACYLACHKQCIPHTGR   43 (272)
Q Consensus        23 g~~c~~c~~~~h~~c~~~~~~   43 (272)
                      -.+|..|+.-.|++|+.+...
T Consensus       531 ~~rC~~C~avfH~~C~~r~s~  551 (580)
T KOG1829|consen  531 TRRCSTCLAVFHKKCLRRKSP  551 (580)
T ss_pred             ceeHHHHHHHHHHHHHhccCC
Confidence            468999999999999888666


No 368
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=23.07  E-value=37  Score=31.28  Aligned_cols=21  Identities=14%  Similarity=0.164  Sum_probs=18.7

Q ss_pred             chhhhhhhccCCCCCccccee
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      +.+|+.+|+.+.|||||++.-
T Consensus        90 ~~~e~~i~~~~~hp~iv~~~~  110 (370)
T cd05621          90 FWEERDIMAFANSPWVVQLFC  110 (370)
T ss_pred             HHHHHHHHHhCCCCCEeeEEE
Confidence            668999999999999999874


No 369
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=22.94  E-value=37  Score=28.71  Aligned_cols=23  Identities=13%  Similarity=-0.049  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|++++.-
T Consensus        44 ~~~~~e~~~l~~l~~~~i~~~~~   66 (256)
T cd08218          44 EESRKEVAVLSNMKHPNIVQYQE   66 (256)
T ss_pred             HHHHHHHHHHHhCCCCCeeeeEe
Confidence            36788999999999999999763


No 371
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=22.86  E-value=33  Score=28.82  Aligned_cols=22  Identities=14%  Similarity=-0.024  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+.+|+++++++.|+|++++.-
T Consensus        45 ~~~~e~~~l~~l~~~~i~~~~~   66 (256)
T cd08530          45 DAVNEIRILASVNHPNIISYKE   66 (256)
T ss_pred             HHHHHHHHHHhCCCCCchhhhh
Confidence            5678999999999999999863


No 372
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=22.82  E-value=39  Score=32.25  Aligned_cols=15  Identities=7%  Similarity=0.171  Sum_probs=9.6

Q ss_pred             CceecCcCCcchhcc
Q psy3210          22 RPLCSQACYLACHKQ   36 (272)
Q Consensus        22 qg~~c~~c~~~~h~~   36 (272)
                      .||+|++||..+...
T Consensus       366 ~g~rC~kCg~~~~~~  380 (421)
T COG1571         366 NGFRCKKCGTRARET  380 (421)
T ss_pred             CCcccccccccCCcc
Confidence            377777777665543


No 373
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=22.58  E-value=37  Score=28.84  Aligned_cols=23  Identities=13%  Similarity=0.001  Sum_probs=20.1

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|++++..
T Consensus        38 ~~~~~e~~~l~~l~h~~i~~~~~   60 (262)
T cd05572          38 EHIFSEKEILEECNHPFIVKLYR   60 (262)
T ss_pred             HHHHHHHHHHHhCCCCCEeeeee
Confidence            45888999999999999999864


No 374
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=22.53  E-value=37  Score=29.81  Aligned_cols=21  Identities=10%  Similarity=-0.092  Sum_probs=18.4

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+.+++++.|+|+|++.
T Consensus        62 ~~~~e~~~l~~l~hp~i~~~~   82 (293)
T cd06647          62 LIINEILVMRENKHPNIVNYL   82 (293)
T ss_pred             HHHHHHHHHhhcCCCCeeehh
Confidence            467789999999999999976


No 375
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=22.32  E-value=39  Score=29.27  Aligned_cols=23  Identities=13%  Similarity=0.070  Sum_probs=19.9

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++++.|+|++++.-
T Consensus        51 ~~~~~e~~~l~~l~h~~i~~~~~   73 (284)
T cd05079          51 ADLKKEIEILRNLYHENIVKYKG   73 (284)
T ss_pred             HHHHHHHHHHHhCCCCCeeeeee
Confidence            45778999999999999999763


No 376
>PRK11823 DNA repair protein RadA; Provisional
Probab=22.28  E-value=50  Score=31.74  Aligned_cols=26  Identities=15%  Similarity=0.276  Sum_probs=21.1

Q ss_pred             CCceecCcCCcchhcccccCCCCCCCC
Q psy3210          21 LRPLCSQACYLACHKQCIPHTGRCGTG   47 (272)
Q Consensus        21 ~qg~~c~~c~~~~h~~c~~~~~~C~~~   47 (272)
                      +-.|+|..||...+ ++...++.|+.=
T Consensus         5 ~~~y~C~~Cg~~~~-~~~g~Cp~C~~w   30 (446)
T PRK11823          5 KTAYVCQECGAESP-KWLGRCPECGAW   30 (446)
T ss_pred             CCeEECCcCCCCCc-ccCeeCcCCCCc
Confidence            45799999999876 578888999753


No 377
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=22.16  E-value=39  Score=28.80  Aligned_cols=23  Identities=26%  Similarity=0.062  Sum_probs=19.6

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+.+|+++++++.|+|||++.-.
T Consensus        48 ~~~~e~~~l~~l~~~~i~~~~~~   70 (265)
T cd06631          48 KLQEEVDLLKSLKHVNIVQYLGT   70 (265)
T ss_pred             HHHHHHHHHHhcCCCCEeeEeeE
Confidence            46779999999999999998743


No 378
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=22.10  E-value=41  Score=28.31  Aligned_cols=22  Identities=14%  Similarity=0.081  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++++++.|+||+++.
T Consensus        37 ~~~~~e~~~l~~l~~~~i~~~~   58 (251)
T cd05041          37 RKFLQEAEILKQYDHPNIVKLI   58 (251)
T ss_pred             HHHHHHHHHHHhCCCCCeEEEE
Confidence            3688899999999999999875


No 379
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=21.98  E-value=39  Score=30.78  Aligned_cols=21  Identities=10%  Similarity=0.033  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+.+|+.+.|+|+|++.
T Consensus        69 ~~~~E~~~l~~l~h~~ii~~~   89 (364)
T cd07875          69 RAYRELVLMKCVNHKNIIGLL   89 (364)
T ss_pred             HHHHHHHHHHhcCCCCccccc
Confidence            567899999999999999975


No 380
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=21.97  E-value=40  Score=29.59  Aligned_cols=21  Identities=10%  Similarity=-0.102  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+..|+++++.+.|+|+|++.
T Consensus        63 ~~~~e~~~l~~~~h~~v~~~~   83 (296)
T cd06654          63 LIINEILVMRENKNPNIVNYL   83 (296)
T ss_pred             HHHHHHHHHHhCCCCCEeeEE
Confidence            467799999999999999986


No 381
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=21.80  E-value=45  Score=30.69  Aligned_cols=22  Identities=14%  Similarity=0.250  Sum_probs=19.0

Q ss_pred             chhhhhhhccCCCCCcccceec
Q psy3210         248 YWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       248 yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      +.+|+.+|+.+.|+|||++...
T Consensus        90 ~~~e~~i~~~~~hp~iv~~~~~  111 (371)
T cd05622          90 FWEERDIMAFANSPWVVQLFYA  111 (371)
T ss_pred             HHHHHHHHHhCCCCCCCeEEEE
Confidence            5678999999999999998743


No 382
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=21.77  E-value=43  Score=30.36  Aligned_cols=22  Identities=14%  Similarity=-0.049  Sum_probs=18.8

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+..|+++|+.+.|+|||++..
T Consensus        47 ~~~~E~~il~~l~h~~iv~~~~   68 (364)
T cd05599          47 HVRAERDILAEADNPWVVKLYY   68 (364)
T ss_pred             HHHHHHHHHHhCCCCCCcceEE
Confidence            3557999999999999999864


No 383
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=21.74  E-value=37  Score=20.72  Aligned_cols=13  Identities=8%  Similarity=-0.148  Sum_probs=7.3

Q ss_pred             CCceecCcCCcch
Q psy3210          21 LRPLCSQACYLAC   33 (272)
Q Consensus        21 ~qg~~c~~c~~~~   33 (272)
                      .|-|+|..||--|
T Consensus         4 ~~~YkC~~CGniV   16 (36)
T PF06397_consen    4 GEFYKCEHCGNIV   16 (36)
T ss_dssp             TEEEE-TTT--EE
T ss_pred             ccEEEccCCCCEE
Confidence            4669999997554


No 384
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=21.73  E-value=49  Score=31.95  Aligned_cols=26  Identities=12%  Similarity=0.101  Sum_probs=20.8

Q ss_pred             CCceecCcCCcchhcccccCCCCCCCC
Q psy3210          21 LRPLCSQACYLACHKQCIPHTGRCGTG   47 (272)
Q Consensus        21 ~qg~~c~~c~~~~h~~c~~~~~~C~~~   47 (272)
                      +-.|+|..||...+ ++...++.|+.=
T Consensus         5 ~~~y~C~~Cg~~~~-~~~g~Cp~C~~w   30 (454)
T TIGR00416         5 KSKFVCQHCGADSP-KWQGKCPACHAW   30 (454)
T ss_pred             CCeEECCcCCCCCc-cccEECcCCCCc
Confidence            34699999998876 578889999753


No 385
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=21.65  E-value=37  Score=29.46  Aligned_cols=21  Identities=5%  Similarity=-0.023  Sum_probs=18.2

Q ss_pred             cchhhhhhhccC-CCCCcccce
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~  267 (272)
                      .+..|+++|+++ .|+|+|++.
T Consensus        61 ~~~~E~~~l~~l~~h~~i~~~~   82 (293)
T cd05053          61 DLVSEMEMMKMIGKHKNIINLL   82 (293)
T ss_pred             HHHHHHHHHHhhcCCCCeeeEE
Confidence            367799999999 899999875


No 386
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=21.59  E-value=45  Score=31.33  Aligned_cols=23  Identities=13%  Similarity=0.313  Sum_probs=18.8

Q ss_pred             eecCcCCcchhcccccCCCCCCCC
Q psy3210          24 LCSQACYLACHKQCIPHTGRCGTG   47 (272)
Q Consensus        24 ~~c~~c~~~~h~~c~~~~~~C~~~   47 (272)
                      |+|..||.... ++++.++.|+.=
T Consensus         1 ~~c~~cg~~~~-~~~g~cp~c~~w   23 (372)
T cd01121           1 YVCSECGYVSP-KWLGKCPECGEW   23 (372)
T ss_pred             CCCCCCCCCCC-CccEECcCCCCc
Confidence            89999998765 578888999753


No 387
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=21.58  E-value=43  Score=28.86  Aligned_cols=23  Identities=17%  Similarity=0.170  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++|++++|+|+|++..
T Consensus        38 ~~~~~e~~~l~~l~~~~i~~~~~   60 (277)
T cd05577          38 QMALNEKKILEKVSSRFIVSLAY   60 (277)
T ss_pred             HHHHHHHHHHHhCCCCCEeeeee
Confidence            34677999999999999999864


No 388
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=21.48  E-value=50  Score=21.49  Aligned_cols=23  Identities=13%  Similarity=0.193  Sum_probs=18.8

Q ss_pred             ccCCCceecCcCCcchhcccccC
Q psy3210          18 SRGLRPLCSQACYLACHKQCIPH   40 (272)
Q Consensus        18 g~~~qg~~c~~c~~~~h~~c~~~   40 (272)
                      |++...+.|..||..+...|...
T Consensus        13 ~~~~rk~~Cr~Cg~~~C~~C~~~   35 (57)
T cd00065          13 TLTRRRHHCRNCGRIFCSKCSSN   35 (57)
T ss_pred             cCCccccccCcCcCCcChHHcCC
Confidence            45778899999999999988543


No 389
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=21.45  E-value=44  Score=28.49  Aligned_cols=23  Identities=9%  Similarity=-0.151  Sum_probs=19.5

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+.+|+.+++.+.|+|++++..+
T Consensus        52 ~~~~e~~~~~~l~h~~ii~~~~~   74 (267)
T cd06645          52 VVQQEIIMMKDCKHSNIVAYFGS   74 (267)
T ss_pred             HHHHHHHHHHhCCCCCeeeEEEE
Confidence            45678999999999999998753


No 390
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=21.43  E-value=42  Score=29.26  Aligned_cols=22  Identities=9%  Similarity=0.066  Sum_probs=19.1

Q ss_pred             cchhhhhhhccCCCCCccccee
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      .+.+|+.+++.+.|+|||++.-
T Consensus        62 ~~~~e~~~l~~~~h~~vv~~~~   83 (285)
T cd06648          62 LLFNEVVIMRDYQHPNIVEMYS   83 (285)
T ss_pred             HHHHHHHHHHHcCCCChheEEE
Confidence            3678999999999999999863


No 391
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=21.26  E-value=42  Score=29.66  Aligned_cols=21  Identities=14%  Similarity=0.078  Sum_probs=18.6

Q ss_pred             cchhhhhhhccCCCCCcccce
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      .+.+|+++++.+.|+|++++.
T Consensus        61 ~~~~e~~~l~~l~h~~i~~~~   81 (308)
T cd06634          61 DIIKEVRFLQKLRHPNTIQYR   81 (308)
T ss_pred             HHHHHHHHHHhCCCCCcccEE
Confidence            467899999999999999875


No 392
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=21.23  E-value=40  Score=28.51  Aligned_cols=23  Identities=13%  Similarity=-0.120  Sum_probs=19.5

Q ss_pred             ccchhhhhhhccCCCCCccccee
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ..+..|+++++.+.|+|+|++.-
T Consensus        43 ~~~~~e~~~l~~l~h~~i~~~~~   65 (255)
T cd08219          43 EDSRKEAVLLAKMKHPNIVAFKE   65 (255)
T ss_pred             HHHHHHHHHHHhCCCCCcceEEE
Confidence            35677899999999999999864


No 393
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=20.96  E-value=42  Score=28.26  Aligned_cols=23  Identities=22%  Similarity=-0.013  Sum_probs=19.7

Q ss_pred             cchhhhhhhccCCCCCcccceec
Q psy3210         247 LYWGNFRLLSSLFIVPPVRLSWS  269 (272)
Q Consensus       247 ~yVeE~~~mk~l~h~~~v~~~~~  269 (272)
                      .+..|+++++++.|+|++++...
T Consensus        48 ~~~~e~~~l~~~~h~~i~~~~~~   70 (258)
T cd06632          48 QLEQEIALLSKLQHPNIVQYLGT   70 (258)
T ss_pred             HHHHHHHHHHhcCCCCchheeee
Confidence            46789999999999999998743


No 394
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=20.89  E-value=34  Score=29.30  Aligned_cols=25  Identities=20%  Similarity=-0.021  Sum_probs=21.1

Q ss_pred             eeccchhhhhhhccCCCCCccccee
Q psy3210         244 FFQLYWGNFRLLSSLFIVPPVRLSW  268 (272)
Q Consensus       244 fP~~yVeE~~~mk~l~h~~~v~~~~  268 (272)
                      ++..+..|+++++++.|+|++++.-
T Consensus        41 ~~~~~~~e~~~l~~~~~~~i~~~~~   65 (282)
T cd07829          41 IPSTALREISLLKELKHPNIVKLLD   65 (282)
T ss_pred             ccHHHHHHHHHHHhcCCCCHHHHHh
Confidence            4566788999999999999999763


No 395
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=20.89  E-value=60  Score=31.11  Aligned_cols=24  Identities=17%  Similarity=0.416  Sum_probs=20.8

Q ss_pred             CceecCcCCcchhcccccCCCCCCC
Q psy3210          22 RPLCSQACYLACHKQCIPHTGRCGT   46 (272)
Q Consensus        22 qg~~c~~c~~~~h~~c~~~~~~C~~   46 (272)
                      --|.|..||+ .|.++++.++.|+.
T Consensus         6 t~f~C~~CG~-~s~KW~GkCp~Cg~   29 (456)
T COG1066           6 TAFVCQECGY-VSPKWLGKCPACGA   29 (456)
T ss_pred             cEEEcccCCC-CCccccccCCCCCC
Confidence            4599999986 68999999999984


No 396
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=20.88  E-value=39  Score=29.28  Aligned_cols=22  Identities=9%  Similarity=-0.022  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+++|+++.|+|++++.
T Consensus        60 ~~~~~e~~~l~~l~~~~i~~~~   81 (286)
T cd06614          60 ELIINEILIMKDCKHPNIVDYY   81 (286)
T ss_pred             HHHHHHHHHHHHCCCCCeeEEE
Confidence            4577899999999999999875


No 397
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=20.81  E-value=42  Score=28.75  Aligned_cols=22  Identities=14%  Similarity=0.071  Sum_probs=19.3

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..|..|+++++++.|+|++++.
T Consensus        51 ~~~~~ei~~l~~l~~~~i~~~~   72 (284)
T cd05038          51 SDFEREIEILRTLDHENIVKYK   72 (284)
T ss_pred             HHHHHHHHHHHhCCCCChheEE
Confidence            3578899999999999999975


No 398
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=20.25  E-value=73  Score=27.43  Aligned_cols=21  Identities=14%  Similarity=0.097  Sum_probs=17.2

Q ss_pred             cchhhhhhhccC-CCCCcccce
Q psy3210         247 LYWGNFRLLSSL-FIVPPVRLS  267 (272)
Q Consensus       247 ~yVeE~~~mk~l-~h~~~v~~~  267 (272)
                      .+..|+++++++ .|+|+|++.
T Consensus        60 ~~~~e~~~l~~l~~h~~i~~~~   81 (286)
T cd06638          60 EIEAEYNILKALSDHPNVVKFY   81 (286)
T ss_pred             HHHHHHHHHHHHhcCCCeeeee
Confidence            345688999999 699999985


No 399
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=20.15  E-value=65  Score=26.12  Aligned_cols=24  Identities=21%  Similarity=0.499  Sum_probs=16.2

Q ss_pred             ceecCcCCcchhccc---ccCCCCCCC
Q psy3210          23 PLCSQACYLACHKQC---IPHTGRCGT   46 (272)
Q Consensus        23 g~~c~~c~~~~h~~c---~~~~~~C~~   46 (272)
                      -|+|..||..+|-.=   |..++.|+.
T Consensus       112 ~l~C~~Cg~~~~~~~~~~l~~Cp~C~~  138 (146)
T PF07295_consen  112 TLVCENCGHEVELTHPERLPPCPKCGH  138 (146)
T ss_pred             eEecccCCCEEEecCCCcCCCCCCCCC
Confidence            389999998887554   444555554


No 400
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=20.02  E-value=42  Score=28.20  Aligned_cols=22  Identities=18%  Similarity=0.170  Sum_probs=19.4

Q ss_pred             ccchhhhhhhccCCCCCcccce
Q psy3210         246 QLYWGNFRLLSSLFIVPPVRLS  267 (272)
Q Consensus       246 ~~yVeE~~~mk~l~h~~~v~~~  267 (272)
                      ..+..|+.+++.+.|+|+|++.
T Consensus        46 ~~~~~e~~~l~~l~~~~i~~~~   67 (258)
T smart00219       46 EEFLREARIMRKLDHPNIVKLL   67 (258)
T ss_pred             HHHHHHHHHHHhcCCCchheEE
Confidence            4677899999999999999976


Done!