RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy3210
         (272 letters)



>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the
           Vav family.  Vav proteins are involved in several
           processes that require cytoskeletal reorganization, such
           as the formation of the immunological synapse (IS),
           phagocytosis, platelet aggregation, spreading, and
           transformation.  Vavs function as guanine nucleotide
           exchange factors (GEFs) for the Rho/Rac family of
           GTPases.  Vav family members have several conserved
           motifs/domains including: a leucine-rich region, a
           leucine-zipper, a calponin homology (CH) domain, an
           acidic domain, a Dbl-homology (DH) domain, a pleckstrin
           homology (PH) domain, a cysteine-rich domain, 2 SH3
           domains,  a proline-rich region, and a SH2 domain.  Vavs
           are the only known Rho GEFs that have both the DH/PH
           motifs and SH2/SH3 domains in the same protein. The
           leucine-rich helix-loop-helix (HLH) domain is thought to
           be involved in protein heterodimerization with other HLH
           proteins and it may function as a negative regulator by
           forming inactive heterodimers. The CH domain  is usually
           involved in the association with filamentous actin, but
           in Vav it controls NFAT stimulation, Ca2+ mobilization,
           and its transforming activity. Acidic domains are
           involved in protein-protein interactions and contain
           regulatory tyrosines. The DH domain is a GDP-GTP
           exchange factor on Rho/Rac GTPases. The PH domain in
           involved in interactions with GTP-binding proteins,
           lipids and/or phosphorylated serine/threonine residues.
           The SH3 domain is involved in localization of proteins
           to specific sites within the cell interacting with
           protein with proline-rich sequences.  The SH2 domain
           mediates a high affinity interaction with tyrosine
           phosphorylated proteins.  There are three Vav mammalian
           family members: Vav1 which is expressed in the
           hematopoietic system, Vav2 and Vav3 are more
           ubiquitously expressed. The members here include insect
           and amphibian Vavs. In general SH2 domains are involved
           in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 102

 Score =  148 bits (377), Expect = 9e-46
 Identities = 59/109 (54%), Positives = 78/109 (71%), Gaps = 8/109 (7%)

Query: 85  LSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV 144
           LSE+LWFVGEM R+ A + LE   DGTYL+R+RPQG     ET YALS+K +  VKHMK+
Sbjct: 2   LSEFLWFVGEMERDTAENRLENRPDGTYLVRVRPQG-----ETQYALSIKYNGDVKHMKI 56

Query: 145 YEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPF 193
            ++       Y+LS+SR+F+S+VEL+  YERNSL ENF GL+  L+ P+
Sbjct: 57  EQRSDGL---YYLSESRHFKSLVELVNYYERNSLGENFAGLDTTLKWPY 102


>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains.  Src homology 2 domains
           bind phosphotyrosine-containing polypeptides via 2
           surface pockets. Specificity is provided via interaction
           with residues that are distinct from the
           phosphotyrosine. Only a single occurrence of a SH2
           domain has been found in S. cerevisiae.
          Length = 84

 Score = 80.7 bits (200), Expect = 1e-19
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM 149
           W+ G + RE+A  LL+ E DG +L+R     P       Y LS++   KVKH ++   E 
Sbjct: 3   WYHGFISREEAEKLLKNEGDGDFLVRDSESSPGD-----YVLSVRVKGKVKHYRIRRNED 57

Query: 150 DGVPQYFLSQSRYFRSIVELICCYERNSL 178
               +++L   R F S+VEL+  Y++NSL
Sbjct: 58  G---KFYLEGGRKFPSLVELVEHYQKNSL 83


>gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1
           proteins.  Proto-oncogene vav is a member of the Dbl
           family of guanine nucleotide exchange factors (GEF) for
           the Rho family of GTP binding proteins.  All vavs are
           activated by tyrosine phosphorylation leading to their
           activation. There are three Vav mammalian family
           members: Vav1 which is expressed in the hematopoietic
           system, and Vav2 and Vav3 are more ubiquitously
           expressed. Vav1 plays a role in T-cell and B-cell
           development and activation.  It has been identified as
           the specific binding partner of Nef proteins from HIV-1,
           resulting in morphological changes, cytoskeletal
           rearrangements, and the JNK/SAPK signaling cascade,
           leading to increased levels of viral transcription and
           replication. Vav1 has been shown to interact with Ku70,
           PLCG1, Lymphocyte cytosolic protein 2, Janus kinase 2,
           SIAH2, S100B, Abl gene, ARHGDIB, SHB, PIK3R1, PRKCQ,
           Grb2, MAPK1, Syk, Linker of activated T cells, Cbl gene
           and EZH2. Vav proteins are involved in several processes
           that require cytoskeletal reorganization, such as the
           formation of the immunological synapse (IS),
           phagocytosis, platelet aggregation, spreading, and
           transformation.  Vavs function as guanine nucleotide
           exchange factors (GEFs) for the Rho/Rac family of
           GTPases. Vav family members have several conserved
           motifs/domains including: a leucine-rich region, a
           leucine-zipper, a calponin homology (CH) domain, an
           acidic domain, a Dbl-homology (DH) domain, a pleckstrin
           homology (PH) domain, a cysteine-rich domain, 2 SH3
           domains, a proline-rich region, and a SH2 domain.  Vavs
           are the only known Rho GEFs that have both the DH/PH
           motifs and SH2/SH3 domains in the same protein. The
           leucine-rich helix-loop-helix (HLH) domain is thought to
           be involved in protein heterodimerization with other HLH
           proteins and it may function as a negative regulator by
           forming inactive heterodimers. The CH domain  is usually
           involved in the association with filamentous actin, but
           in Vav it controls NFAT stimulation, Ca2+ mobilization,
           and its transforming activity. Acidic domains are
           involved in protein-protein interactions and contain
           regulatory tyrosines. The DH domain is a GDP-GTP
           exchange factor on Rho/Rac GTPases. The PH domain in
           involved in interactions with GTP-binding proteins,
           lipids and/or phosphorylated serine/threonine residues. 
           The SH3 domain is involved in localization of proteins
           to specific sites within the cell interacting with
           protein with proline-rich sequences. The SH2 domain
           mediates a high affinity interaction with tyrosine
           phosphorylated proteins. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 103

 Score = 79.3 bits (195), Expect = 8e-19
 Identities = 41/112 (36%), Positives = 68/112 (60%), Gaps = 9/112 (8%)

Query: 84  NLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMK 143
           +LS +LW+ G M R  A S+L   +DGTYL+R R +         +A+S+K + +VKH+K
Sbjct: 1   DLSVHLWYAGPMERAGAESILANRSDGTYLVRQRVKDAAE-----FAISIKYNVEVKHIK 55

Query: 144 VYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFRQ 195
           +   E  G+  Y +++ + FR + EL+  Y++NSL + F  L+  LQ PF++
Sbjct: 56  IMTAE--GL--YRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKE 103


>gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2
           proteins.  Proto-oncogene vav is a member of the Dbl
           family of guanine nucleotide exchange factors (GEF) for
           the Rho family of GTP binding proteins. All vavs are
           activated by tyrosine phosphorylation leading to their
           activation. There are three Vav mammalian family
           members: Vav1 which is expressed in the hematopoietic
           system, and Vav2 and Vav3 are more ubiquitously
           expressed. Vav2 is a GEF for RhoA, RhoB and RhoG and may
           activate Rac1 and Cdc42. Vav2 has been shown to interact
           with CD19 and Grb2. Alternatively spliced transcript
           variants encoding different isoforms have been found for
           Vav2. Vav proteins are involved in several processes
           that require cytoskeletal reorganization, such as the
           formation of the immunological synapse (IS),
           phagocytosis, platelet aggregation, spreading, and
           transformation. Vavs function as guanine nucleotide
           exchange factors (GEFs) for the Rho/Rac family of
           GTPases. Vav family members have several conserved
           motifs/domains including: a leucine-rich region, a
           leucine-zipper, a calponin homology (CH) domain, an
           acidic domain, a Dbl-homology (DH) domain, a pleckstrin
           homology (PH) domain, a cysteine-rich domain, 2 SH3
           domains, a proline-rich region, and a SH2 domain.  Vavs
           are the only known Rho GEFs that have both the DH/PH
           motifs and SH2/SH3 domains in the same protein. The
           leucine-rich helix-loop-helix (HLH) domain is thought to
           be involved in protein heterodimerization with other HLH
           proteins and it may function as a negative regulator by
           forming inactive heterodimers. The CH domain  is usually
           involved in the association with filamentous actin, but
           in Vav it controls NFAT stimulation, Ca2+ mobilization,
           and its transforming activity. Acidic domains are
           involved in protein-protein interactions and contain
           regulatory tyrosines. The DH domain is a GDP-GTP
           exchange factor on Rho/Rac GTPases. The PH domain in
           involved in interactions with GTP-binding proteins,
           lipids and/or phosphorylated serine/threonine residues.
           The SH3 domain is involved in localization of proteins
           to specific sites within the cell interacting with
           protein with proline-rich sequences. The SH2 domain
           mediates a high affinity interaction with tyrosine
           phosphorylated proteins. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 103

 Score = 72.4 bits (177), Expect = 2e-16
 Identities = 38/109 (34%), Positives = 67/109 (61%), Gaps = 9/109 (8%)

Query: 86  SEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVY 145
           + Y WF G M R++  +LL+  A GTYL+R RP          +A+S+K +++VKH+KV 
Sbjct: 3   TAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAER-----FAISIKFNDEVKHIKVV 57

Query: 146 EKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFR 194
           EK+        +++++ F S++EL+  Y+ +SL E+F  L+  L+ P++
Sbjct: 58  EKD----NWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYK 102


>gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3
           proteins.  Proto-oncogene vav is a member of the Dbl
           family of guanine nucleotide exchange factors (GEF) for
           the Rho family of GTP binding proteins. All vavs are
           activated by tyrosine phosphorylation leading to their
           activation. There are three Vav mammalian family
           members: Vav1 which is expressed in the hematopoietic
           system, and Vav2 and Vav3 are more ubiquitously
           expressed. Vav3 preferentially activates RhoA, RhoG and,
           to a lesser extent, Rac1.  Alternatively spliced
           transcript variants encoding different isoforms have
           been described for this gene.  VAV3 has been shown to
           interact with Grb2. Vav proteins are involved in several
           processes that require cytoskeletal reorganization, such
           as the formation of the immunological synapse (IS),
           phagocytosis, platelet aggregation, spreading, and
           transformation. Vavs function as guanine nucleotide
           exchange factors (GEFs) for the Rho/Rac family of
           GTPases. Vav family members have several conserved
           motifs/domains including: a leucine-rich region, a
           leucine-zipper, a calponin homology (CH) domain, an
           acidic domain, a Dbl-homology (DH) domain, a pleckstrin
           homology (PH) domain, a cysteine-rich domain, 2 SH3
           domains,  a proline-rich region, and a SH2 domain. Vavs
           are the only known Rho GEFs that have both the DH/PH
           motifs and SH2/SH3 domains in the same protein. The
           leucine-rich helix-loop-helix (HLH) domain is thought to
           be involved in protein heterodimerization with other HLH
           proteins and it may function as a negative regulator by
           forming inactive heterodimers. The CH domain  is usually
           involved in the association with filamentous actin, but
           in Vav it controls NFAT stimulation, Ca2+ mobilization,
           and its transforming activity. Acidic domains are
           involved in protein-protein interactions and contain
           regulatory tyrosines.  The DH domain is a GDP-GTP
           exchange factor on Rho/Rac GTPases. The PH domain in
           involved in interactions with GTP-binding proteins,
           lipids and/or phosphorylated serine/threonine residues. 
           The SH3 domain is involved in localization of proteins
           to specific sites within the cell interacting with
           protein with proline-rich sequences. The SH2 domain
           mediates a high affinity interaction with tyrosine
           phosphorylated proteins. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 103

 Score = 70.4 bits (172), Expect = 2e-15
 Identities = 36/110 (32%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query: 86  SEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVY 145
           S   W+ G M R +A + L    + TYL+R R +         YA+S+K + +VKH+K+ 
Sbjct: 3   SCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGE-----YAISIKYNNEVKHIKIL 57

Query: 146 EKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFRQ 195
            +  DG   + ++++R F+S++EL+  Y+ +SL E F  L+  LQ P+++
Sbjct: 58  TR--DGF--FHIAENRKFKSLMELVEYYKHHSLKEGFRSLDTTLQFPYKE 103


>gnl|CDD|215658 pfam00017, SH2, SH2 domain. 
          Length = 77

 Score = 64.1 bits (157), Expect = 1e-13
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 9/82 (10%)

Query: 90  WFVGEMGREKATSLL-EREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           W+ G++ RE+A  LL   + DGT+L+R      + P +  Y LS++ D +VKH ++   +
Sbjct: 1   WYHGKISREEAERLLLNPKPDGTFLVRESE---SKPGD--YTLSVRDDGRVKHYRIQSLD 55

Query: 149 MDGVPQYFLSQSRYFRSIVELI 170
             G   Y++S    F S+ EL+
Sbjct: 56  NGG---YYISGGVTFNSLPELV 74


>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain.  In general, SH2 domains
           are involved in signal transduction; they bind
           pTyr-containing polypeptide ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites. They are present in a wide array
           of proteins including: adaptor proteins (Nck1, Crk,
           Grb2), scaffolds (Slp76, Shc, Dapp1), kinases (Src, Syk,
           Fps, Tec), phosphatases (Shp-1, Shp-2), transcription
           factors (STAT1),  Ras signaling molecules (Ras-Gap),
           ubiquitination factors (c-Cbl), cytoskeleton regulators
           (Tensin), signal regulators (SAP), and phospholipid
           second messengers (PLCgamma), amongst others.
          Length = 79

 Score = 63.2 bits (154), Expect = 3e-13
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDE-KVKHMKVYEKE 148
           WF G + RE+A  LL  + DGT+L+R     P       Y LS+++ + KVKH  +   E
Sbjct: 2   WFHGSISREEAERLLRGKPDGTFLVRESSSEPGD-----YVLSVRSGDGKVKHYLIERNE 56

Query: 149 MDGVPQYFLSQSRYFRSIVELI 170
                       R F S+ EL+
Sbjct: 57  GGY--YLLGGSGRTFPSLPELV 76


>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain
           found in p85.  Phosphoinositide 3-kinases (PI3Ks) are
           essential for cell growth, migration, and survival.
           p110, the catalytic subunit, is composed of an
           adaptor-binding domain, a Ras-binding domain, a C2
           domain, a helical domain, and a kinase domain.  The
           regulatory unit is called p85 and is composed of an SH3
           domain, a RhoGap domain, a N-terminal SH2 (nSH2) domain,
           an internal SH2 (iSH2) domain, and C-terminal (cSH2)
           domain.  There are 2 inhibitory interactions between
           p110alpha and p85 of P13K: (1) p85 nSH2 domain with the
           C2, helical, and kinase domains of p110alpha and (2) p85
           iSH2 domain with C2 domain of p110alpha. There are 3
           inhibitory interactions between p110beta and p85 of
           P13K: (1) p85 nSH2 domain with the C2, helical, and
           kinase domains of p110beta, (2) p85 iSH2 domain with C2
           domain of p110alpha, and (3) p85 cSH2 domain with the
           kinase domain of p110alpha. It is interesting to note
           that p110beta is oncogenic as a wild type protein while
           p110alpha lacks this ability. One explanation is the
           idea that the regulation of p110beta by p85 is unique
           because of the addition of inhibitory contacts from the
           cSH2 domain and the loss of contacts in the iSH2 domain.
           In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 110

 Score = 55.0 bits (133), Expect = 6e-10
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 9/110 (8%)

Query: 85  LSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV 144
           L E  W+ G++ RE+    +    DGT+L+R      T   +  Y L+L+     K +K+
Sbjct: 4   LQEAEWYWGDISREEVNEKMRDTPDGTFLVR---DASTMKGD--YTLTLRKGGNNKLIKI 58

Query: 145 YEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFR 194
           + +  DG  +Y  S    F S+VELI  Y  NSL E    L+V+L  P  
Sbjct: 59  FHR--DG--KYGFSDPLTFNSVVELINYYRNNSLAEYNRKLDVKLLYPVS 104


>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2
           (N-SH2) domain in Phospholipase C gamma.  Phospholipase
           C gamma is a signaling molecule that is recruited to the
           C-terminal tail of the receptor upon autophosphorylation
           of a highly conserved tyrosine.  PLCgamma is composed of
           a Pleckstrin homology (PH) domain followed by an
           elongation factor (EF) domain, 2 catalytic regions of
           PLC domains that flank 2 tandem SH2 domains (N-SH2,
           C-SH2), and ending with a SH3 domain and C2 domain.
           N-SH2 SH2 domain-mediated interactions represent a
           crucial step in transmembrane signaling by receptor
           tyrosine kinases. SH2 domains recognize phosphotyrosine
           (pY) in the context of particular sequence motifs in
           receptor phosphorylation sites. Both N-SH2 and C-SH2
           have a very similar binding affinity to pY. But in
           growth factor stimulated cells these domains bind to
           different target proteins. N-SH2 binds to pY containing
           sites in the C-terminal tails of tyrosine kinases and
           other receptors. Recently it has been shown that this
           interaction is mediated by phosphorylation-independent
           interactions between a secondary binding site found
           exclusively on the N-SH2 domain and a region of the
           FGFR1 tyrosine kinase domain. This secondary site on the
           SH2 cooperates with the canonical pY site to regulate
           selectivity in mediating a specific cellular process.
           C-SH2 binds to an intramolecular site on PLCgamma itself
           which allows it to hydrolyze
           phosphatidylinositol-4,5-bisphosphate into
           diacylglycerol and inositol triphosphate. These then
           activate protein kinase C and release calcium. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 99

 Score = 53.1 bits (128), Expect = 3e-09
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 10/94 (10%)

Query: 90  WFVGEM--GREKATSLLEREA---DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV 144
           WF G++  GR++A  LL       DGT+L+R   +  T   +  Y LS   + KV+H ++
Sbjct: 6   WFHGKLGDGRDEAEKLLLEYCEGGDGTFLVR---ESETFVGD--YTLSFWRNGKVQHCRI 60

Query: 145 YEKEMDGVPQYFLSQSRYFRSIVELICCYERNSL 178
             ++ +G  +Y+L+ +  F S+ ELI  Y +N L
Sbjct: 61  RSRQENGEKKYYLTDNLVFDSLYELIDYYRQNPL 94


>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain
           found in Ras GTPase-activating protein 1 (GAP).  RasGAP
           is part of the GAP1 family of GTPase-activating
           proteins. The protein is located in the cytoplasm and
           stimulates the GTPase activity of normal RAS p21, but
           not its oncogenic counterpart. Acting as a suppressor of
           RAS function, the protein enhances the weak intrinsic
           GTPase activity of RAS proteins resulting in RAS
           inactivation, thereby allowing control of cellular
           proliferation and differentiation. Mutations leading to
           changes in the binding sites of either protein are
           associated with basal cell carcinomas. Alternative
           splicing results in two isoforms. The shorter isoform
           which lacks the N-terminal hydrophobic region, has the
           same activity, and is expressed in placental tissues.
           In general longer isoform contains 2 SH2 domains, a SH3
           domain, a pleckstrin homology (PH) domain, and a
           calcium-dependent phospholipid-binding C2 domain. The
           C-terminus contains the catalytic domain of RasGap which
           catalyzes the activation of Ras by hydrolyzing GTP-bound
           active Ras into an inactive GDP-bound form of Ras. This
           model contains the C-terminal SH2 domain. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 77

 Score = 50.1 bits (120), Expect = 2e-08
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 10/85 (11%)

Query: 90  WFVGEMGREKATSLLEREA-DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           WF G++ RE+A ++L +    G++L+R   +    P +  Y+LS + +E +KH K+    
Sbjct: 2   WFHGKISREEAYNMLVKVGGPGSFLVR---ESDNTPGD--YSLSFRVNEGIKHFKI---I 53

Query: 149 MDGVPQYFLSQSRYFRSIVELICCY 173
             G  Q+ +   RYF S+ ++I  Y
Sbjct: 54  PTGNNQFMMG-GRYFSSLDDVIDRY 77


>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of
           VAV proteins.  VAV proteins function both as cytoplasmic
           guanine nucleotide exchange factors (GEFs) for Rho
           GTPases and scaffold proteins and they play important
           roles in cell signaling by coupling cell surface
           receptors to various effector functions. They play key
           roles in processes that require cytoskeletal
           reorganization including immune synapse formation,
           phagocytosis, cell spreading, and platelet aggregation,
           among others. Vertebrates have three VAV proteins (VAV1,
           VAV2, and VAV3). VAV proteins contain several domains
           that enable their function: N-terminal calponin homology
           (CH), acidic, RhoGEF (also called Dbl-homologous or DH),
           Pleckstrin Homology (PH), C1 (zinc finger), SH2, and two
           SH3 domains. The SH3 domain of VAV is involved in the
           localization of proteins to specific sites within the
           cell, by interacting with proline-rich sequences within
           target proteins. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 54

 Score = 49.6 bits (118), Expect = 2e-08
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
            A A +DFC  +  +L LK+G  V + +K+G+Q GWW+G+I+ R+ +F   Y
Sbjct: 1   TAKARYDFCARDMRELSLKEGDVVKIYNKKGQQ-GWWRGEINGRIGWFPSTY 51


>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain
           found in p85.  Phosphoinositide 3-kinases (PI3Ks) are
           essential for cell growth, migration, and survival.
           p110, the catalytic subunit, is composed of an
           adaptor-binding domain, a Ras-binding domain, a C2
           domain, a helical domain, and a kinase domain.  The
           regulatory unit is called p85 and is composed of an SH3
           domain, a RhoGap domain, a N-terminal SH2 (nSH2) domain,
           a inter SH2 (iSH2) domain, and C-terminal (cSH2) domain.
            There are 2 inhibitory interactions between p110alpha
           and p85 of P13K: 1) p85 nSH2 domain with the C2,
           helical, and kinase domains of p110alpha and 2) p85 iSH2
           domain with C2 domain of p110alpha. There are 3
           inhibitory interactions between p110beta and p85 of
           P13K: 1) p85 nSH2 domain with the C2, helical, and
           kinase domains of p110beta, 2) p85 iSH2 domain with C2
           domain of p110alpha, and 3) p85 cSH2 domain with the
           kinase domain of p110alpha. It is interesting to note
           that p110beta is oncogenic as a wild type protein while
           p110alpha lacks this ability. One explanation is the
           idea that the regulation of p110beta by p85 is unique
           because of the addition of inhibitory contacts from the
           cSH2 domain and the loss of contacts in the iSH2 domain.
           In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 104

 Score = 50.9 bits (122), Expect = 2e-08
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 13/108 (12%)

Query: 87  EYLWFVGEMGREKATSLLEREADGTYLLRIRP-QGPTHPNETIYALSLKTDEKVKHMKVY 145
           E  W VG++ R +A  LL  + DGT+L+R    QG        YA S+  + +VKH  +Y
Sbjct: 5   ERTWLVGDINRTQAEELLRGKPDGTFLIRESSTQGC-------YACSVVCNGEVKHCVIY 57

Query: 146 EKEMDGVPQY-FLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
           + E      Y F      + S+ EL+  Y  NSL ++   L V L  P
Sbjct: 58  KTETG----YGFAEPYNLYESLKELVLHYAHNSLEQHNDSLTVTLAYP 101


>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain
           found in alpha2-chimerin and beta2-chimerin proteins.
           Chimerins are a family of phorbol ester- and
           diacylglycerol-responsive GTPase-activating proteins.
           Alpha1-chimerin (formerly known as n-chimerin) and
           alpha2-chimerin are alternatively spliced products of a
           single gene, as are beta1- and beta2-chimerin. alpha1-
           and beta1-chimerin have a relatively short N-terminal
           region that does not encode any recognizable domains,
           whereas alpha2- and beta2-chimerin both include a
           functional SH2 domain that can bind to phosphotyrosine
           motifs within receptors. All of the isoforms contain a
           GAP domain with specificity in vitro for Rac1 and a
           diacylglycerol (DAG)-binding C1 domain which allows them
           to translocate to membranes in response to DAG signaling
           and anchors them in close proximity to activated Rac.
           Other C1 domain-containing diacylglycerol receptors
           including: PKC, Munc-13 proteins, phorbol ester binding
           scaffolding proteins involved in Ca2+-stimulated
           exocytosis, and RasGRPs, diacylglycerol-activated
           guanine-nucleotide exchange factors (GEFs) for Ras and
           Rap1. In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 91

 Score = 49.3 bits (118), Expect = 5e-08
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 12/93 (12%)

Query: 91  FVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEMD 150
           + G + RE+A  LL   +DG+YL+R   +   +     Y LSL+ + KVK+ K+Y    D
Sbjct: 9   YHGLISREEAEQLLSGASDGSYLIRESSRDDGY-----YTLSLRFNGKVKNYKLY---YD 60

Query: 151 GVPQYFLSQSRYFRSIVELICCYERNSLIENFI 183
           G   Y     + F +I +L+     + LI  ++
Sbjct: 61  GKNHYHYVGEKRFDTIHDLV----ADGLITLYM 89


>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain
           of VAV1 protein.  VAV1 is expressed predominantly in the
           hematopoietic system and it plays an important role in
           the development and activation of B and T cells. It is
           activated by tyrosine phosphorylation to function as a
           guanine nucleotide exchange factor (GEF) for Rho GTPases
           following cell surface receptor activation, triggering
           various effects such as cytoskeletal reorganization,
           transcription regulation, cell cycle progression, and
           calcium mobilization. It also serves as a scaffold
           protein and has been shown to interact with Ku70, Socs1,
           Janus kinase 2, SIAH2, S100B, Abl gene, ZAP-70, SLP76,
           and Syk, among others. VAV proteins contain several
           domains that enable their function: N-terminal calponin
           homology (CH), acidic, RhoGEF (also called
           Dbl-homologous or DH), Pleckstrin Homology (PH), C1
           (zinc finger), SH2, and two SH3 domains. The C-terminal
           SH3 domain of Vav1 interacts with a wide variety of
           proteins including cytoskeletal regulators (zyxin),
           RNA-binding proteins (Sam68), transcriptional
           regulators, viral proteins, and dynamin 2. SH3 domains
           are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 54

 Score = 47.6 bits (113), Expect = 8e-08
 Identities = 21/48 (43%), Positives = 34/48 (70%), Gaps = 1/48 (2%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
            A A +DFC  + ++L LK+G  + +L+K+G Q+GWW+G+I  RV +F
Sbjct: 1   TAKARYDFCARDRSELSLKEGDIIKILNKKG-QQGWWRGEIYGRVGWF 47


>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2
           (C-SH2) domain in Phospholipase C gamma.  Phospholipase
           C gamma is a signaling molecule that is recruited to the
           C-terminal tail of the receptor upon autophosphorylation
           of a highly conserved tyrosine. PLCgamma is composed of
           a Pleckstrin homology (PH) domain followed by an
           elongation factor (EF) domain, 2 catalytic regions of
           PLC domains that flank 2 tandem SH2 domains (N-SH2,
           C-SH2), and ending with a SH3 domain and C2 domain.
           N-SH2 SH2 domain-mediated interactions represent a
           crucial step in transmembrane signaling by receptor
           tyrosine kinases. SH2 domains recognize phosphotyrosine
           (pY) in the context of particular sequence motifs in
           receptor phosphorylation sites. Both N-SH2 and C-SH2
           have a very similar binding affinity to pY. But in
           growth factor stimulated cells these domains bind to
           different target proteins. N-SH2 binds to pY containing
           sites in the C-terminal tails of tyrosine kinases and
           other receptors. Recently it has been shown that this
           interaction is mediated by phosphorylation-independent
           interactions between a secondary binding site found
           exclusively on the N-SH2 domain and a region of the
           FGFR1 tyrosine kinase domain. This secondary site on the
           SH2 cooperates with the canonical pY site to regulate
           selectivity in mediating a specific cellular process.
           C-SH2 binds to an intramolecular site on PLCgamma itself
           which allows it to hydrolyze
           phosphatidylinositol-4,5-bisphosphate into
           diacylglycerol and inositol triphosphate. These then
           activate protein kinase C and release calcium. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 104

 Score = 48.8 bits (117), Expect = 9e-08
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 14/98 (14%)

Query: 82  HENLSEYLWFVGEMGREKATSLLER-EADGTYLLRIRPQGPTHPNETIYALSLKTDEKVK 140
           HE+     WF   + RE+A  +L R   DG +L+R     P       +A+S + + K+K
Sbjct: 1   HESKE---WFHANLTREQAEEMLMRVPRDGAFLVRPSETDPN-----SFAISFRAEGKIK 52

Query: 141 HMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSL 178
           H ++   + +G  + F+  +  F S+VEL+  YE++ L
Sbjct: 53  HCRI---KQEG--RLFVIGTSQFESLVELVSYYEKHPL 85


>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of
           CD2-associated protein and similar proteins.  This
           subfamily is composed of the third SH3 domain (SH3C) of
           CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
           similar domains. CD2AP and CIN85 are adaptor proteins
           that bind to protein partners and assemble complexes
           that have been implicated in T cell activation, kidney
           function, and apoptosis of neuronal cells. They also
           associate with endocytic proteins, actin cytoskeleton
           components, and other adaptor proteins involved in
           receptor tyrosine kinase (RTK) signaling. CD2AP and the
           main isoform of CIN85 contain three SH3 domains, a
           proline-rich region, and a C-terminal coiled-coil
           domain. All of these domains enable CD2AP and CIN85 to
           bind various protein partners and assemble complexes
           that have been implicated in many different functions.
           SH3C of both proteins have been shown to bind to
           ubiquitin. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 55

 Score = 47.3 bits (113), Expect = 1e-07
 Identities = 17/43 (39%), Positives = 28/43 (65%)

Query: 202 FDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           FD+     ++L L++G  V +LSK+ E KGWWKG+++ +   F
Sbjct: 6   FDYEAENEDELTLREGDIVTILSKDCEDKGWWKGELNGKRGVF 48


>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and
           similar fungal proteins.  This family is composed of the
           Saccharomyces cerevisiae proteins, Ysc84p (also called
           LAS17-binding protein 4, Lsb4p) and Lsb3p, and similar
           fungal proteins. They contain an N-terminal SYLF domain
           (also called DUF500) and a C-terminal SH3 domain. Ysc84p
           localizes to actin patches and plays an important in
           actin polymerization during endocytosis. The N-terminal
           domain of both Ysc84p and Lsb3p can bind and bundle
           actin filaments. A study of the yeast SH3 domain
           interactome predicts that the SH3 domains of Lsb3p and
           Lsb4p may function as molecular hubs for the assembly of
           endocytic complexes. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 45.9 bits (109), Expect = 3e-07
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           AVA +DF   +   L  ++G  + +L K   Q  WW G+I  R   F
Sbjct: 2   AVALYDFAGEQPGDLAFQKGDIITILKKSDSQNDWWTGRIGGREGIF 48


>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor
           proteins.  Nck adaptor proteins regulate actin
           cytoskeleton dynamics by linking proline-rich effector
           molecules to protein tyrosine kinases and phosphorylated
           signaling intermediates. They contain three SH3 domains
           and a C-terminal SH2 domain. They function downstream of
           the PDGFbeta receptor and are involved in Rho GTPase
           signaling and actin dynamics. Vertebrates contain two
           Nck adaptor proteins: Nck1 (also called Nckalpha) and
           Nck2 (also called Nckbeta or Growth factor
           receptor-bound protein 4, Grb4), which show partly
           overlapping functions but also bind distinct targets.
           Their SH3 domains are involved in recruiting downstream
           effector molecules, such as the N-WASP/Arp2/3 complex,
           which when activated induces actin polymerization that
           results in the production of pedestals, or protrusions
           of the plasma membrane. The second SH3 domain of Nck
           appears to prefer ligands containing the APxxPxR motif.
           SH3 domains are protein interaction domains that usually
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially a PxxP motif. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 45.7 bits (109), Expect = 4e-07
 Identities = 16/48 (33%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
            AV +F++     ++L L++G +V+VL K  +  GWW+G+ + +V +F
Sbjct: 1   PAVVKFNYEAQREDELSLRKGDRVLVLEKSSD--GWWRGECNGQVGWF 46


>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in
           Tec-like proteins.  The Tec protein tyrosine kinase is
           the founding member of a family that includes Btk, Itk,
           Bmx, and Txk. The members have a PH domain, a
           zinc-binding motif, a SH3 domain, a SH2 domain, and a
           protein kinase catalytic domain. Btk is involved in
           B-cell receptor signaling with mutations in Btk
           responsible for X-linked agammaglobulinemia (XLA) in
           humans and X-linked immunodeficiency (xid) in mice. Itk
           is involved in T-cell receptor signaling. Tec is
           expressed in both T and B cells, and is thought to
           function in activated and effector T lymphocytes to
           induce the expression of genes regulated by NFAT
           transcription factors. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 104

 Score = 47.0 bits (112), Expect = 4e-07
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 19/115 (16%)

Query: 83  ENLSEYLWFVGEMGREKATSLLEREA-DGTYLLRIRPQGPTHPNETIYALSLKT----DE 137
            NL +Y W+VG+M R++A SLL++E  +G +++R      +     +Y +SL T      
Sbjct: 1   LNLEKYEWYVGDMSRQRAESLLKQEDKEGCFVVR----NSSTKG--LYTVSLFTKVPGSP 54

Query: 138 KVKHMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
            VKH  + +       +++L++   F +I ELI  ++ NS      GL  RL+ P
Sbjct: 55  HVKHYHIKQNARS---EFYLAEKHCFETIPELINYHQHNS-----GGLATRLKYP 101


>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson
           murine lymphosarcoma virus (ABL) proteins.  ABL-family
           proteins are highly conserved tyrosine kinases. Each ABL
           protein contains an SH3-SH2-TK (Src homology 3-Src
           homology 2-tyrosine kinase) domain cassette, which
           confers autoregulated kinase activity and is common
           among nonreceptor tyrosine kinases. Several types of
           posttranslational modifications control ABL catalytic
           activity, subcellular localization, and stability, with
           consequences for both cytoplasmic and nuclear ABL
           functions. Binding partners provide additional
           regulation of ABL catalytic activity, substrate
           specificity, and downstream signaling. By combining this
           cassette with actin-binding and -bundling domain, ABL
           proteins are capable of connecting phosphoregulation
           with actin-filament reorganization. Vertebrate paralogs,
           ABL1 and ABL2, have evolved to perform specialized
           functions. ABL1 includes nuclear localization signals
           and a DNA binding domain which is used to mediate DNA
           damage-repair functions, while ABL2 has additional
           binding capacity for actin and for microtubules to
           enhance its cytoskeletal remodeling functions.  SH2 is
           involved in several autoinhibitory mechanism that
           constrain the enzymatic activity of the ABL-family
           kinases. In one mechanism SH2 and SH3 cradle the kinase
           domain while a cap sequence stabilizes the inactive
           conformation resulting in a locked inactive state.
           Another involves phosphatidylinositol 4,5-bisphosphate
           (PIP2) which binds the SH2 domain through residues
           normally required for phosphotyrosine binding in the
           linker segment between the SH2 and kinase domains. The
           SH2 domain contributes to ABL catalytic activity and
           target site specificity. It is thought that the ABL
           catalytic site and SH2 pocket have coevolved to
           recognize the same sequences. Recent work now supports a
           hierarchical processivity model in which the substrate
           target site most compatible with ABL kinase domain
           preferences is phosphorylated with greatest efficiency.
           If this site is compatible with the ABL SH2 domain
           specificity, it will then reposition and dock in the SH2
           pocket. This mechanism also explains how ABL kinases
           phosphorylates poor targets on the same substrate if
           they are properly positioned and how relatively poor
           substrate proteins might be recruited to ABL through a
           complex with strong substrates that can also dock with
           the SH2 pocket. In general SH2 domains are involved in
           signal transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 94

 Score = 46.6 bits (111), Expect = 5e-07
 Identities = 23/90 (25%), Positives = 48/90 (53%), Gaps = 8/90 (8%)

Query: 88  YLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEK 147
           + W+ G + R  A  LL    +G++L+R     P       Y++SL+ D +V H ++  +
Sbjct: 3   HSWYHGPISRNAAEYLLSSGINGSFLVRESESSPGQ-----YSISLRYDGRVYHYRI-SE 56

Query: 148 EMDGVPQYFLSQSRYFRSIVELICCYERNS 177
           + DG  + +++Q   F ++ EL+  + +N+
Sbjct: 57  DSDG--KVYVTQEHRFNTLAELVHHHSKNA 84


>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and
           cysteine-rich domain-containing protein 2 (Stac2).  Stac
           proteins are putative adaptor proteins that contain a
           cysteine-rich C1 domain and one or two SH3 domains at
           the C-terminus. There are three mammalian members
           (Stac1, Stac2, and Stac3) of this family. Stac2 contains
           a single SH3 domain at the C-terminus unlike Stac1 and
           Stac3, which contain two C-terminal SH3 domains. Stac1
           and Stac2 have been found to be expressed differently in
           mature dorsal root ganglia (DRG) neurons. Stac1 is
           mainly expressed in peptidergic neurons while Stac2 is
           found in a subset of nonpeptidergic and all trkB+
           neurons. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 45.3 bits (107), Expect = 5e-07
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           VA + F P E N LPL+ G +V+V+    E   WWKGK  +RV +F
Sbjct: 3   VALYKFLPQENNDLPLQPGDRVMVVDDSNED--WWKGKSGDRVGFF 46


>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in
           SH2 domain-containing adapter proteins B, D, E, and F
           (SHB, SHD, SHE, SHF).  SHB, SHD, SHE, and SHF are SH2
           domain-containing proteins that play various roles
           throughout the cell.  SHB functions in generating
           signaling compounds in response to tyrosine kinase
           activation. SHB contains proline-rich motifs, a
           phosphotyrosine binding (PTB) domain, tyrosine
           phosphorylation sites, and a SH2 domain. SHB mediates
           certain aspects of platelet-derived growth factor (PDGF)
           receptor-, fibroblast growth factor (FGF) receptor-,
           neural growth factor (NGF) receptor TRKA-, T cell
           receptor-, interleukin-2 (IL-2) receptor- and focal
           adhesion kinase- (FAK) signaling. SRC-like FYN-Related
           Kinase FRK/RAK (also named BSK/IYK or GTK) and SHB
           regulate apoptosis, proliferation and differentiation.
           SHB promotes apoptosis and is also required for proper
           mitogenicity, spreading and tubular morphogenesis in
           endothelial cells. SHB also plays a role in preventing
           early cavitation of embryoid bodies and reduces
           differentiation to cells expressing albumin, amylase,
           insulin and glucagon. SHB is a multifunctional protein
           that has difference responses in different cells under
           various conditions. SHE is expressed in heart, lung,
           brain, and skeletal muscle, while expression of SHD is
           restricted to the brain. SHF is mainly expressed in
           skeletal muscle, brain, liver, prostate, testis, ovary,
           small intestine, and colon. SHD may be a physiological
           substrate of c-Abl and may function as an adapter
           protein in the central nervous system. It is also
           thought to be involved in apoptotic regulation.  SHD
           contains five YXXP motifs, a substrate sequence
           preferred by Abl tyrosine kinases, in addition to a
           poly-proline rich region and a C-terminal SH2 domain.
           SHE contains two pTry protein binding domains, protein
           interaction domain (PID) and a SH2 domain, followed by a
           glycine-proline rich region, all of which are N-terminal
           to the phosphotyrosine binding (PTB) domain. SHF
           contains  four putative tyrosine phosphorylation sites
           and an SH2 domain. In general SH2 domains are involved
           in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 98

 Score = 46.3 bits (110), Expect = 7e-07
 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM 149
           W+ G + R +A SLL    +G+YL+R      +   +  Y+LSLK+ +   HM++   E 
Sbjct: 3   WYHGAITRIEAESLLRPCKEGSYLVR---NSESTKQD--YSLSLKSAKGFMHMRIQRNET 57

Query: 150 DGVPQYFLSQ-SRYFRSIVELICCYERNSL 178
               QY L Q SR F +I E+I  Y  N L
Sbjct: 58  G---QYILGQFSRPFETIPEMIRHYCLNKL 84


>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the
           Src family of non-receptor tyrosine kinases.  The Src
           family kinases are nonreceptor tyrosine kinases that
           have been implicated in pathways regulating
           proliferation, angiogenesis, invasion and metastasis,
           and bone metabolism. It is thought that transforming
           ability of Src is linked to its ability to activate key
           signaling molecules in these pathways, rather than
           through direct activity. As such blocking Src activation
           has been a target for drug companies. Src family members
           can be divided into 3 groups based on their expression
           pattern: 1) Src, Fyn, and Yes; 2)  Blk, Fgr, Hck, Lck,
           and Lyn; and 3) Frk-related kinases Frk/Rak and Iyk/Bsk
           Of these, cellular c-Src is the best studied and most
           frequently implicated in oncogenesis. The c-Src contains
           five distinct regions: a unique N-terminal domain, an
           SH3 domain, an SH2 domain, a kinase domain and a
           regulatory tail, as do the other members of the family.
           Src exists in both active and inactive conformations.
           Negative regulation occurs through phosphorylation of
           Tyr, resulting in an intramolecular association between
           phosphorylated Tyr and the SH2 domain of SRC, which
           locks the protein in a closed conformation. Further
           stabilization of the inactive state occurs through
           interactions between the SH3 domain and a proline-rich
           stretch of residues within the kinase domain.
           Conversely, dephosphorylation of Tyr allows SRC to
           assume an open conformation. Full activity requires
           additional autophosphorylation of a Tyr residue within
           the catalytic domain. Loss of the negative-regulatory
           C-terminal segment has been shown to result in increased
           activity and transforming potential. Phosphorylation of
           the C-terminal Tyr residue by C-terminal Src kinase
           (Csk) and Csk homology kinase results in increased
           intramolecular interactions and consequent Src
           inactivation. Specific phosphatases, protein tyrosine
           phosphatase a (PTPa) and the SH-containing phosphatases
           SHP1/SHP2, have also been shown to take a part in Src
           activation. Src is also activated by direct binding of
           focal adhesion kinase (Fak) and Crk-associated substrate
           (Cas) to the SH2 domain. SRC activity can also be
           regulated by numerous receptor tyrosine kinases (RTKs),
           such as Her2, epidermal growth factor receptor (EGFR),
           fibroblast growth factor receptor, platelet-derived
           growth factor receptor (PDGFR), and vascular endothelial
           growth factor receptor (VEGFR). In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 101

 Score = 46.0 bits (110), Expect = 8e-07
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 20/110 (18%)

Query: 90  WFVGEMGREKATSLL--EREADGTYLLRIRPQGPTHPNETIYALSLKTDEK-----VKHM 142
           WF G++ R+ A  LL       GT+L+R   +  T P    Y+LS++  +      VKH 
Sbjct: 5   WFFGKIKRKDAEKLLLAPGNPRGTFLIR---ESETTPGA--YSLSVRDGDDARGDTVKHY 59

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
           ++ + +  G   Y+++    F ++ EL+  Y +++      GL  RL +P
Sbjct: 60  RIRKLDNGG---YYITTRATFPTLQELVQHYSKDAD-----GLCCRLTVP 101


>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2)
           domain found in SH2 domain Phosphatases (SHP) proteins. 
           The SH2 domain phosphatases (SHP-1, SHP-2/Syp,
           Drosophila corkscrew (csw), and Caenorhabditis elegans
           Protein Tyrosine Phosphatase (Ptp-2)) are cytoplasmic
           signaling enzymes. They are both targeted and regulated
           by interactions of their SH2 domains with
           phosphotyrosine docking sites. These proteins contain
           two SH2 domains (N-SH2, C-SH2) followed by a tyrosine
           phosphatase (PTP) domain, and a C-terminal extension.
           Shp1 and Shp2 have two tyrosyl phosphorylation sites in
           their C-tails, which are phosphorylated differentially
           by receptor and nonreceptor PTKs. Csw retains the
           proximal tyrosine and Ptp-2 lacks both sites.
           Shp-binding proteins include receptors, scaffolding
           adapters, and inhibitory receptors. Some of these bind
           both Shp1 and Shp2 while others bind only one. Most
           proteins that bind a Shp SH2 domain contain one or more
           immuno-receptor tyrosine-based inhibitory motifs
           (ITIMs): [SIVL]xpYxx[IVL].  Shp1 N-SH2 domain blocks the
           catalytic domain and keeps the enzyme in the inactive
           conformation, and is thus believed to regulate the
           phosphatase activity of SHP-1. Its C-SH2 domain is
           thought to be involved in searching for phosphotyrosine
           activators.  The SHP2 N-SH2 domain is a conformational
           switch; it either binds and inhibits the phosphatase, or
           it binds phosphoproteins and activates the enzyme. The
           C-SH2 domain contributes binding energy and specificity,
           but it does not have a direct role in activation. Csw
           SH2 domain function is essential, but either SH2 domain
           can fulfill this requirement. The role of the csw SH2
           domains during Sevenless receptor tyrosine kinase (SEV)
           signaling is to bind Daughter of Sevenless rather than
           activated SEV. Ptp-2 acts in oocytes downstream of
           sheath/oocyte gap junctions to promote major sperm
           protein (MSP)-induced MAP Kinase (MPK-1)
           phosphorylation. Ptp-2 functions in the oocyte
           cytoplasm, not at the cell surface to inhibit multiple
           RasGAPs, resulting in sustained Ras activation. It is
           thought that MSP triggers PTP-2/Ras activation and ROS
           production to stimulate MPK-1 activity essential for
           oocyte maturation and that secreted MSP domains and
           Cu/Zn superoxide dismutases function antagonistically to
           control ROS and MAPK signaling. In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 99

 Score = 46.1 bits (110), Expect = 9e-07
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 12/106 (11%)

Query: 90  WFVGEM-GREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDE-KVKHMKVYEK 147
           WF G + G+E    LLE+   G++L+R   +  + P +  + LS++TD+ KV H+ +  +
Sbjct: 2   WFHGHLSGKEAEKLLLEKGKPGSFLVR---ESQSKPGD--FVLSVRTDDDKVTHIMIRCQ 56

Query: 148 EMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPF 193
                 +Y +     F S+ +L+  Y++N ++E   G  V L+ P 
Sbjct: 57  GG----KYDVGGGEEFDSLTDLVEHYKKNPMVE-TSGTVVHLKQPL 97


>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily.  Src Homology 3
           (SH3) domains are protein interaction domains that bind
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. Thus, they
           are referred to as proline-recognition domains (PRDs).
           SH3 domains are less selective and show more diverse
           specificity compared to other PRDs. They have been shown
           to bind peptide sequences that lack the PxxP motif;
           examples include the PxxDY motif of Eps8 and the
           RKxxYxxY sequence in SKAP55. SH3 domain containing
           proteins play versatile and diverse roles in the cell,
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies, among others. Many members of this
           superfamily are adaptor proteins that associate with a
           number of protein partners, facilitating complex
           formation and signal transduction.
          Length = 51

 Score = 44.0 bits (105), Expect = 2e-06
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKI-DERVSYF 244
            A A +D+   + ++L  K+G  + VL K+ +  GWW+G++   R   F
Sbjct: 1   YARALYDYEAQDDDELSFKKGDIITVLEKDDD--GWWEGELNGGREGLF 47


>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain
           of VAV2 protein.  VAV2 is widely expressed and functions
           as a guanine nucleotide exchange factor (GEF) for RhoA,
           RhoB and RhoG and also activates Rac1 and Cdc42. It is
           implicated in many cellular and physiological functions
           including blood pressure control, eye development,
           neurite outgrowth and branching, EGFR endocytosis and
           degradation, and cell cluster morphology, among others.
           It has been reported to associate with Nek3. VAV
           proteins contain several domains that enable their
           function: N-terminal calponin homology (CH), acidic,
           RhoGEF (also called Dbl-homologous or DH), Pleckstrin
           Homology (PH), C1 (zinc finger), SH2, and two SH3
           domains. The SH3 domain of VAV is involved in the
           localization of proteins to specific sites within the
           cell, by interacting with proline-rich sequences within
           target proteins. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 58

 Score = 44.2 bits (104), Expect = 2e-06
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
           AVA ++F   +  +L L++G  V + S+ G  +GWWKG+ + R+ +F   Y
Sbjct: 3   AVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTY 53


>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain
           containing Ysc84-like 1 (SH3YL1) protein.  SH3YL1
           localizes to the plasma membrane and is required for
           dorsal ruffle formation. It binds phosphoinositides
           (PIs) with high affinity through its N-terminal SYLF
           domain (also called DUF500). In addition, SH3YL1
           contains a C-terminal SH3 domain which has been reported
           to bind to N-WASP, dynamin 2, and SHIP2 (a PI
           5-phosphatase). SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 54

 Score = 43.5 bits (103), Expect = 2e-06
 Identities = 13/48 (27%), Positives = 23/48 (47%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
              A + F   +   L  + G ++ VL++   Q  WW+G++  RV  F
Sbjct: 1   EVTALYSFEGQQPCDLSFQAGDRITVLTRTDSQFDWWEGRLRGRVGIF 48


>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases
           1, 2, and 3.  MLKs 1, 2, and 3 are Serine/Threonine
           Kinases (STKs), catalyzing the transfer of the
           gamma-phosphoryl group from ATP to S/T residues on
           protein substrates. MLKs act as mitogen-activated
           protein kinase kinase kinases (MAP3Ks, MKKKs, MAPKKKs),
           which phosphorylate and activate MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MLKs play roles in immunity and
           inflammation, as well as in cell death, proliferation,
           and cell cycle regulation. Little is known about the
           specific function of MLK1, also called MAP3K9. It is
           capable of activating the c-Jun N-terminal kinase
           pathway. Mice lacking both MLK1 and MLK2 are viable,
           fertile, and have normal life spans. MLK2, also called
           MAP3K10, is abundant in brain, skeletal muscle, and
           testis. It functions upstream of the MAPK, c-Jun
           N-terminal kinase. It binds hippocalcin, a
           calcium-sensor protein that protects neurons against
           calcium-induced cell death. Both MLK2 and hippocalcin
           may be associated with the pathogenesis of Parkinson's
           disease. MLK3, also called MAP3K11, is highly expressed
           in breast cancer cells and its signaling through c-Jun
           N-terminal kinase has been implicated in the migration,
           invasion, and malignancy of cancer cells. It also
           functions as a negative regulator of Inhibitor of
           Nuclear Factor-KappaB Kinase (IKK) and thus, impacts
           inflammation and immunity. MLKs contain an SH3 domain, a
           catalytic kinase domain, a leucine zipper, a
           proline-rich region, and a CRIB domain that mediates
           binding to GTP-bound Cdc42 and Rac. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 58

 Score = 43.6 bits (103), Expect = 2e-06
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGE---QKGWWKGKIDERVSYF 244
           A FD+  +  ++L L++G +V VLSK+      +GWW GKI++RV  F
Sbjct: 4   AVFDYEASAEDELTLRRGDRVEVLSKDSAVSGDEGWWTGKINDRVGIF 51


>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain
           of VAV3 protein.  VAV3 is ubiquitously expressed and
           functions as a phosphorylation-dependent guanine
           nucleotide exchange factor (GEF) for RhoA, RhoG, and
           Rac1. It has been implicated to function in the
           hematopoietic, bone, cerebellar, and cardiovascular
           systems. VAV3 is essential in axon guidance in neurons
           that control blood pressure and respiration. It is
           overexpressed in prostate cancer cells and it plays a
           role in regulating androgen receptor transcriptional
           activity. VAV proteins contain several domains that
           enable their function: N-terminal calponin homology
           (CH), acidic, RhoGEF (also called Dbl-homologous or DH),
           Pleckstrin Homology (PH), C1 (zinc finger), SH2, and two
           SH3 domains. The SH3 domain of VAV is involved in the
           localization of proteins to specific sites within the
           cell, by interacting with proline-rich sequences within
           target proteins. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 56

 Score = 43.5 bits (102), Expect = 3e-06
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
           IA+A +DFC  +  +L L +G  V + +K     GWW+G+++ RV +F   Y
Sbjct: 2   IAIARYDFCARDMRELSLLKGDVVKIYTKMSTN-GWWRGEVNGRVGWFPSTY 52


>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3
           and cysteine-rich domain-containing (Stac) proteins.
           Stac proteins are putative adaptor proteins that contain
           a cysteine-rich C1 domain and one or two SH3 domains at
           the C-terminus. There are three mammalian members
           (Stac1, Stac2, and Stac3) of this family. Stac1 and
           Stac3 contain two SH3 domains while Stac2 contains a
           single SH3 domain at the C-terminus. This model
           represents the first C-terminal SH3 domain of Stac1 and
           Stac3, and the single C-terminal SH3 domain of Stac2.
           Stac1 and Stac2 have been found to be expressed
           differently in mature dorsal root ganglia (DRG) neurons.
           Stac1 is mainly expressed in peptidergic neurons while
           Stac2 is found in a subset of nonpeptidergic and all
           trkB+ neurons. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 42.1 bits (99), Expect = 8e-06
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           VA + F P E   L ++ G ++ +L    E   WWKGKI++RV +F
Sbjct: 3   VALYKFKPQENEDLEMRPGDKITLLDDSNED--WWKGKIEDRVGFF 46


>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3
           domain-containing protein 21 (SH3D21) and similar
           proteins.  N-terminal SH3 domain of the uncharacterized
           protein SH3 domain-containing protein 21, and similar
           uncharacterized domains, it belongs to the CD2AP-like_3
           subfamily of proteins. The CD2AP-like_3 subfamily is
           composed of the third SH3 domain (SH3C) of CD2AP, CIN85
           (Cbl-interacting protein of 85 kDa), and similar
           domains. CD2AP and CIN85 are adaptor proteins that bind
           to protein partners and assemble complexes that have
           been implicated in T cell activation, kidney function,
           and apoptosis of neuronal cells. They also associate
           with endocytic proteins, actin cytoskeleton components,
           and other adaptor proteins involved in receptor tyrosine
           kinase (RTK) signaling. CD2AP and the main isoform of
           CIN85 contain three SH3 domains, a proline-rich region,
           and a C-terminal coiled-coil domain. All of these
           domains enable CD2AP and CIN85 to bind various protein
           partners and assemble complexes that have been
           implicated in many different functions. SH3C of both
           proteins have been shown to bind to ubiquitin. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 55

 Score = 42.1 bits (99), Expect = 8e-06
 Identities = 18/43 (41%), Positives = 30/43 (69%)

Query: 202 FDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           FD+ P   ++L LK+G  + V+SKE E +GWW+G+++ R  +F
Sbjct: 6   FDYNPVAPDELALKKGDVIEVISKETEDEGWWEGELNGRRGFF 48


>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain.  SH3 (Src homology 3) domains are
           often indicative of a protein involved in signal
           transduction related to cytoskeletal organisation. First
           described in the Src cytoplasmic tyrosine kinase. The
           structure is a partly opened beta barrel.
          Length = 47

 Score = 41.8 bits (99), Expect = 8e-06
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           VA +D+   E ++L  K+G  +IVL K  +  GWWKG+
Sbjct: 1   VALYDYTAREPDELSFKKGDIIIVLEKSDD--GWWKGR 36


>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine
           nucleotide exchange factors.  This subfamily is composed
           of the Saccharomyces cerevisiae guanine nucleotide
           exchange factors (GEFs) Sdc25 and Cdc25, and similar
           proteins. These GEFs regulate Ras by stimulating the
           GDP/GTP exchange on Ras. Cdc25 is involved in the
           Ras/PKA pathway that plays an important role in the
           regulation of metabolism, stress responses, and
           proliferation, depending on available nutrients and
           conditions. Proteins in this subfamily contain an
           N-terminal SH3 domain as well as REM (Ras exchanger
           motif) and RasGEF domains at the C-terminus. SH3 domains
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs; they play a
           role in the regulation of enzymes by intramolecular
           interactions, changing the subcellular localization of
           signal pathway components and mediate multiprotein
           complex assemblies.
          Length = 55

 Score = 41.9 bits (99), Expect = 8e-06
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVS 242
           + VA +DF P   NQL  K G  + VL+K  +  GWW G I     
Sbjct: 1   VVVALYDFTPKSKNQLSFKAGDIIYVLNK--DPSGWWDGVIISSSG 44


>gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found  in Tec
           protein, Bmx.  A member of the Tec protein tyrosine
           kinase Bmx is expressed in the endothelium of large
           arteries, fetal endocardium, adult endocardium of the
           left ventricle, bone marrow, lung, testis, granulocytes,
           myeloid cell lines, and prostate cell lines. Bmx is
           involved in the regulation of Rho and serum response
           factor (SRF). Bmx has been shown to interact with PAK1,
           PTK2, PTPN21, and RUFY1. Most of the Tec family members
           have a PH domain (Txk and the short (type 1) splice
           variant of Drosophila Btk29A are exceptions), a Tec
           homology (TH) domain, a SH3 domain, a SH2 domain, and a
           protein kinase catalytic domain.  The TH domain consists
           of a Zn2+-binding Btk motif and a proline-rich region.
           The Btk motif is found in Tec kinases, Ras GAP, and
           IGBP.  It is crucial for the function of Tec PH domains.
           It is not present in Txk and the type 1 splice form of
           the Drosophila homolog.  The proline-rich regions are
           highly conserved for the most part with the exception of
           Bmx whose residues surrounding the PXXP motif are not
           conserved (TH-like) and Btk29A  which is entirely unique
           with large numbers of glycine residues (TH-extended).
           Tec family members all lack a C-terminal tyrosine having
           an autoinhibitory function in its phosphorylated state.
           In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 106

 Score = 43.0 bits (101), Expect = 1e-05
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 83  ENLSEYLWFVGEMGREKATSLL-EREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKH 141
           ENL  Y WF G + R ++  LL ++  +G +++R   Q   +   T+   S   ++K   
Sbjct: 1   ENLDAYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMY---TVSLFSKAVNDKKGT 57

Query: 142 MKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNS 177
           +K Y    +   + +L+++  F SI +LI  ++ NS
Sbjct: 58  VKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNS 93


>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains.  Src homology 3 (SH3)
           domains bind to target proteins through sequences
           containing proline and hydrophobic amino acids.
           Pro-containing polypeptides may bind to SH3 domains in 2
           different binding orientations.
          Length = 56

 Score = 41.0 bits (97), Expect = 2e-05
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKI-DERVSYF 244
             A +D+   + ++L  K+G  + VL K  +  GWWKG++   +   F
Sbjct: 5   VRALYDYTAQDPDELSFKKGDIITVLEKSDD--GWWKGRLGRGKEGLF 50


>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in
           Carboxyl-Terminal Src Kinase (Csk).  Both the C-terminal
           Src kinase (CSK) and CSK-homologous kinase (CHK) are
           members of the CSK-family of protein tyrosine kinases.
           These proteins suppress activity of Src-family kinases
           (SFK) by selectively phosphorylating the conserved
           C-terminal tail regulatory tyrosine by a similar
           mechanism. CHK is also capable of inhibiting SFKs by a
           non-catalytic mechanism that involves binding of CHK to
           SFKs to form stable protein complexes. The
           unphosphorylated form of SFKs is inhibited by CSK and
           CHK by a two-step mechanism. The first step involves the
           formation of a complex of SFKs with CSK/CHK with the
           SFKs in the complex are inactive. The second step,
           involves the phosphorylation of the C-terminal tail
           tyrosine of SFKs, which then dissociates and adopt an
           inactive conformation. The structural basis of how the
           phosphorylated SFKs dissociate from CSK/CHK to adopt the
           inactive conformation is not known. The inactive
           conformation of SFKs is stabilized by two intramolecular
           inhibitory interactions: (a) the pYT:SH2 interaction in
           which the phosphorylated C-terminal tail tyrosine (YT)
           binds to the SH2 domain, and (b) the linker:SH3
           interaction of which the SH2-kinase domain linker binds
           to the SH3 domain. SFKs are activated by multiple
           mechanisms including binding of the ligands to the SH2
           and SH3 domains to displace the two inhibitory
           intramolecular interactions, autophosphorylation, and
           dephosphorylation of YT. By selective phosphorylation
           and the non-catalytic inhibitory mechanism CSK and CHK
           are able to inhibit the active forms of SFKs. CSK and
           CHK are regulated by phosphorylation and inter-domain
           interactions. They both contain SH3, SH2, and kinase
           domains separated by the SH3-SH2 connector and SH2
           kinase linker, intervening segments separating the three
           domains. They lack a conserved tyrosine phosphorylation
           site in the kinase domain and the C-terminal tail
           regulatory tyrosine phosphorylation site. The CSK SH2
           domain is crucial for stabilizing the kinase domain in
           the active conformation. A disulfide bond here regulates
           CSK kinase activity. The subcellular localization and
           activity of CSK are regulated by its SH2 domain. In
           general SH2 domains are involved in signal transduction.
            They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 98

 Score = 41.9 bits (99), Expect = 2e-05
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 14/103 (13%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM 149
           WF G++ RE+A  LL+   DG +L+R   +   +P +  Y L +  + KV+H +V  +  
Sbjct: 5   WFHGKISREEAERLLQPPEDGLFLVR---ESTNYPGD--YTLCVSFEGKVEHYRVIYRN- 58

Query: 150 DGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
               +  + +  YF ++++L+  Y +++      GL  RL  P
Sbjct: 59  ---GKLTIDEEEYFENLIQLVEHYTKDA-----DGLCTRLVKP 93


>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in
           feline sarcoma, Fujinami poultry sarcoma, and
           fes-related (Fes/Fps/Fer) proteins.  The Fps family
           consists of members Fps/Fes and Fer/Flk/Tyk3. They are
           cytoplasmic protein-tyrosine kinases implicated in
           signaling downstream from cytokines, growth factors and
           immune receptors.  Fes/Fps/Fer contains three
           coiled-coil regions, an SH2 (Src-homology-2) and a TK
           (tyrosine kinase catalytic) domain signature. Members
           here include: Fps/Fes, Fer, Kin-31, and  In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 90

 Score = 41.7 bits (99), Expect = 3e-05
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 83  ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHM 142
           ++L    ++ G + RE A  LL+   DG +L+R          +    LS++ D K++H 
Sbjct: 1   KDLENEPYYHGLLPREDAEELLKN--DGDFLVRKTEPKGGGKRK--LVLSVRWDGKIRHF 56

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSL 178
            +     DG  +Y++ + + F+SI ELI  Y++   
Sbjct: 57  VI--NRDDGG-KYYI-EGKSFKSISELINYYQKTKE 88


>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found  in Tec
           protein, Bruton's tyrosine kinase (Btk).  A member of
           the Tec protein tyrosine kinase Btk is expressed in bone
           marrow, spleen, all hematopoietic cells except T
           lymphocytes and plasma cells where it plays a  crucial
           role in B cell maturation and mast cell activation. Btk
           has been shown to interact with GNAQ, PLCG2, protein
           kinase D1, B-cell linker, SH3BP5, caveolin 1, ARID3A,
           and GTF2I. Most of the Tec family members have a PH
           domain (Txk and the short (type 1) splice variant of
           Drosophila Btk29A are exceptions), a Tec homology (TH)
           domain, a SH3 domain, a SH2 domain, and a protein kinase
           catalytic domain. Btk is implicated in the primary
           immunodeficiency disease X-linked agammaglobulinemia
           (Bruton's agammaglobulinemia).  The TH domain consists
           of a Zn2+-binding Btk motif and a proline-rich region.
           The Btk motif is found in Tec kinases, Ras GAP, and
           IGBP.  It is crucial for the function of Tec PH domains
           and it's lack of presence in Txk is not surprising since
           it lacks a PH domain. The type 1 splice form of the
           Drosophila homolog also lacks both the PH domain and the
           Btk motif.  The proline-rich regions are highly
           conserved for the most part with the exception of Bmx
           whose residues surrounding the PXXP motif are not
           conserved (TH-like) and Btk29A  which is entirely unique
           with large numbers of glycine residues (TH-extended).
           Tec family members all lack a C-terminal tyrosine having
           an autoinhibitory function in its phosphorylated state.
           Two tyrosine phosphorylation (pY) sites have been
           identified in Btk: one located in the activation loop of
           the catalytic domain which regulates the transition
           between open (active) and closed (inactive) states and
           the other in its SH3 domain.  In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 106

 Score = 41.7 bits (98), Expect = 4e-05
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 11/110 (10%)

Query: 85  LSEYLWFVGEMGREKATSLLEREA-DGTYLLRIRPQGPTHPNETIYALSLKTDE-KVKHM 142
           L  Y W+   M R +A  LL++E  +G +++R   +       +++A S    +  ++H 
Sbjct: 3   LEMYEWYSKNMTRSQAEQLLKQEGKEGGFIVRDSSK-AGKYTVSVFAKSAGDPQGVIRHY 61

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
            V         QY+L++   F +I ELI  ++ N+      GL  RL+ P
Sbjct: 62  VVCSTPQS---QYYLAEKHLFSTIPELINYHQHNA-----AGLISRLKYP 103


>gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec
           protein, IL2-inducible T-cell kinase (Itk).  A member of
           the Tec protein tyrosine kinase Itk is expressed thymus,
           spleen, lymph node, T lymphocytes, NK and mast cells. It
           plays a role in T-cell proliferation and
           differentiation, analogous to Tec family kinases Txk.
           Itk  has been shown to interact with Fyn,
           Wiskott-Aldrich syndrome protein, KHDRBS1, PLCG1,
           Lymphocyte cytosolic protein 2, Linker of activated T
           cells, Karyopherin alpha 2, Grb2, and Peptidylprolyl
           isomerase A. Most of the Tec family members have a PH
           domain (Txk and the short (type 1) splice variant of
           Drosophila Btk29A are exceptions), a Tec homology (TH)
           domain, a SH3 domain, a SH2 domain, and a protein kinase
           catalytic domain. The TH domain consists of a
           Zn2+-binding Btk motif and a proline-rich region. The
           Btk motif is found in Tec kinases, Ras GAP, and IGBP. It
           is crucial for the function of Tec PH domains and it's
           lack of presence in Txk is not surprising since it lacks
           a PH domain. The type 1 splice form of the Drosophila
           homolog also lacks both the PH domain and the Btk motif.
           The proline-rich regions are highly conserved for the
           most part with the exception of Bmx whose residues
           surrounding the PXXP motif are not conserved (TH-like)
           and Btk29A  which is entirely unique with large numbers
           of glycine residues (TH-extended).  Tec family members
           all lack a C-terminal tyrosine having an autoinhibitory
           function in its phosphorylated state. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 108

 Score = 41.3 bits (97), Expect = 4e-05
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 21/119 (17%)

Query: 83  ENLSEYLWFVGEMGREKATSLLEREA-DGTYLLRIRPQGPTHPNETIYALSLKT------ 135
            NL +Y W+   + R KA  LL  E  +G +++R   Q         Y +SL T      
Sbjct: 1   NNLDQYEWYNKNINRSKAEKLLRDEGKEGGFMVRDSSQPGL------YTVSLYTKAGGEG 54

Query: 136 DEKVKHMKVYEKEMDGVP-QYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPF 193
           +  ++H  +  KE +  P +Y+L++   F SI ELI  ++ N+      GL  RL+ P 
Sbjct: 55  NPCIRHYHI--KETNDSPKKYYLAEKHVFNSIPELIEYHKHNA-----AGLVTRLRYPV 106


>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found  in Tec
           protein, Txk.  A member of the Tec protein tyrosine
           kinase Txk is expressed in thymus, spleen, lymph node, T
           lymphocytes, NK cells, mast cell lines, and myeloid cell
           line. Txk plays a role in TCR signal transduction, T
           cell development, and selection which is analogous to
           the function of Itk. Txk has been shown to interact with
           IFN-gamma. Unlike most of the Tec family members Txk
           lacks a  PH domain. Instead Txk has a unique region
           containing a palmitoylated cysteine string which has a
           similar membrane tethering function as the PH domain.
           Txk also has a zinc-binding motif, a SH3 domain, a SH2
           domain, and a protein kinase catalytic domain. The TH
           domain consists of a Zn2+-binding Btk motif and a
           proline-rich region. The Btk motif is found in Tec
           kinases, Ras GAP, and IGBP and crucial to the function
           of the PH domain. It is not present in Txk which is not
           surprising since it lacks a PH domain. The type 1 splice
           form of the Drosophila homolog also lacks both the PH
           domain and the Btk motif. The proline-rich regions are
           highly conserved for the most part with the exception of
           Bmx whose residues surrounding the PXXP motif are not
           conserved (TH-like) and Btk29A  which is entirely unique
           with large numbers of glycine residues (TH-extended).
           Tec family members all lack a C-terminal tyrosine having
           an autoinhibitory function in its phosphorylated state.
           In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 106

 Score = 41.1 bits (96), Expect = 6e-05
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 17/116 (14%)

Query: 84  NLSEYLWFVGEMGREKATSLLEREA-DGTYLLR-IRPQGPTHPNETIYALSLKTDEKVKH 141
           NL  Y W+   + R +A  LL +E+ +G +++R  R  G        Y +S+ T  +   
Sbjct: 2   NLEIYEWYHKNITRNQAERLLRQESKEGAFIVRDSRHLG-------SYTISVFTRARRST 54

Query: 142 ---MKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLPFR 194
              +K Y+ + +   Q+++++   F+SI ELI  ++ N+      GL  RL+ P  
Sbjct: 55  EASIKHYQIKKNDSGQWYVAERHLFQSIPELIQYHQHNA-----AGLMSRLRYPVG 105


>gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth
           factor receptor bound, subclass 10 (Grb10) proteins.
           The Grb family binds to the epidermal growth factor
           receptor (EGFR, erbB1) via their SH2 domains. Grb10 is
           part of the Grb7 family of proteins which also includes
           Grb7, and Grb14. They are composed of an N-terminal
           Proline-rich domain, a Ras Associating-like (RA) domain,
           a Pleckstrin Homology (PH) domain, a phosphotyrosine
           interaction region (PIR, BPS) and a C-terminal SH2
           domain. The SH2 domains of Grb7, Grb10 and Grb14
           preferentially bind to a different RTK. Grb10 has been
           shown to interact with many different proteins,
           including the insulin and IGF1 receptors,
           platelet-derived growth factor (PDGF) receptor-beta,
           Ret, Kit, Raf1 and MEK1, and Nedd4. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 108

 Score = 40.4 bits (94), Expect = 1e-04
 Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 12/93 (12%)

Query: 89  LWFVGEMGREKATSLLEREA--DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYE 146
            WF G + RE++  +++++   DG +LLR      +  N   + L+L   +K+K+ ++  
Sbjct: 6   HWFHGRISREESHRIIKQQGLVDGLFLLR-----DSQSNPKAFVLTLCHHQKIKNFQILP 60

Query: 147 KEMDGVPQYFLS---QSRYFRSIVELICCYERN 176
            E DG  Q F S    +  F  +++L+  Y+ N
Sbjct: 61  CEDDG--QTFFSLDDGNTKFSDLIQLVDFYQLN 91


>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the
           Nck family.  Nck proteins are adaptors that modulate
           actin cytoskeleton dynamics by linking proline-rich
           effector molecules to tyrosine kinases or phosphorylated
           signaling intermediates. There are two members known in
           this family: Nck1 (Nckalpha) and Nck2 (Nckbeta and
           Growth factor receptor-bound protein 4 (Grb4)).  They
           are characterized by having 3 SH3 domains and a
           C-terminal SH2 domain. Nck1 and Nck2 have overlapping
           functions as determined by gene knockouts. Both bind
           receptor tyrosine kinases and other
           tyrosine-phosphorylated proteins through their SH2
           domains. In addition they also bind distinct targets.
           Neuronal signaling proteins: EphrinB1, EphrinB2, and
           Disabled-1 (Dab-1) all bind to Nck-2 exclusively. And in
           the case of PDGFR, Tyr(P)751 binds to  Nck1 while
           Tyr(P)1009 binds to Nck2. Nck1 and Nck2 have a role in
           the infection process of enteropathogenic Escherichia
           coli (EPEC). Their SH3 domains are involved in
           recruiting and activating the N-WASP/Arp2/3 complex
           inducing actin polymerization resulting in the
           production of pedestals, dynamic bacteria-presenting
           protrusions of the plasma membrane. A similar thing
           occurs in the vaccinia virus where motile plasma
           membrane projections are formed beneath the virus.
           Recently it has been shown that the SH2 domains of both
           Nck1 and Nck2 bind the G-protein coupled receptor
           kinase-interacting protein 1 (GIT1) in a
           phosphorylation-dependent manner. In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 93

 Score = 39.8 bits (93), Expect = 1e-04
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 11/93 (11%)

Query: 90  WFVGEMGREKA-TSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           W+ G + R +A T L E   +G +L+R      ++P +  Y++SLK   + KH KV    
Sbjct: 3   WYYGRITRHQAETLLNEHGHEGDFLIR---DSESNPGD--YSVSLKAPGRNKHFKVQVV- 56

Query: 149 MDGVPQYFLSQSRYFRSIVELICCYERNSLIEN 181
            D V  Y + Q R F ++ EL+  Y++  +  +
Sbjct: 57  -DNV--YCIGQ-RKFHTMDELVEHYKKAPIFTS 85


>gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2
           domain-bearing protein kinases D and E (ShkD and ShkE). 
           SH2-bearing genes cloned from Dictyostelium include two
           transcription factors, STATa and STATc, and a signaling
           factor, SHK1 (shkA). A database search of the
           Dictyostelium discoideum genome revealed two additional
           putative STAT sequences, dd-STATb and dd-STATd, and four
           additional putative SHK genes, dd-SHK2 (shkB), dd-SHK3
           (shkC), dd-SHK4 (shkD), and dd-SHK5 (shkE). This model
           contains members of shkD and shkE. All of the SHK
           members are most closely related to the protein kinases
           found in plants.  However these kinases in plants are
           not conjugated to any SH2 or SH2-like sequences.
           Alignment data indicates that the SHK SH2 domains carry
           some features of the STAT SH2 domains in Dictyostelium.
           When STATc's linker domain was used for a BLAST search,
           the sequence between the protein kinase domain and the
           SH2 domain (the linker) of SHK was recovered, suggesting
           a close relationship among these molecules within this
           region. SHK's linker domain is predicted to contain an
           alpha-helix which is indeed homologous to that of STAT.
           Based on the phylogenetic alignment, SH2 domains can be
           grouped into two categories, STAT-type and Src-type. SHK
           family members are in between, but are closer to the
           STAT-type which indicates a close relationship between
           SHK and STAT families in their SH2 domains and further
           supports the notion that SHKs linker-SH2 domain evolved
           from STAT or STATL (STAT-like Linker-SH2) domain found
           in plants. In SHK, STAT, and SPT6, the linker-SH2
           domains all reside exclusively in the C-terminal
           regions.  In general SH2 domains are involved in signal
           transduction.  They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 87

 Score = 39.4 bits (92), Expect = 2e-04
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 85  LSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV 144
           L    WF G++ R++A   L    +GT+L+R+     T P +T + +S K   K  H ++
Sbjct: 7   LLAKSWFHGDISRDEAEKRLRGRPEGTFLIRL---SSTDPKKTPFTISKKKKSKPVHKRI 63

Query: 145 YEKEMDGVPQY 155
                  V  Y
Sbjct: 64  ---SRIDVNNY 71


>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
           Growth factor receptor-bound protein 2 (GRB2) and
           related proteins.  This family includes the adaptor
           protein GRB2 and related proteins including Drosophila
           melanogaster Downstream of receptor kinase (DRK),
           Caenorhabditis elegans Sex muscle abnormal protein 5
           (Sem-5), GRB2-related adaptor protein (GRAP), GRAP2, and
           similar proteins. Family members contain an N-terminal
           SH3 domain, a central SH2 domain, and a C-terminal SH3
           domain. GRB2/Sem-5/DRK is a critical signaling molecule
           that regulates the Ras pathway by linking tyrosine
           kinases to the Ras guanine nucleotide releasing protein
           Sos (son of sevenless), which converts Ras to the active
           GTP-bound state. GRAP2 plays an important role in T cell
           receptor (TCR) signaling by promoting the formation of
           the SLP-76:LAT complex, which couples the TCR to the Ras
           pathway. GRAP acts as a negative regulator of T cell
           receptor (TCR)-induced lymphocyte proliferation by
           downregulating the signaling to the Ras/ERK pathway. The
           C-terminal SH3 domains (SH3c) of GRB2 and GRAP2 have
           been shown to bind to classical PxxP motif ligands, as
           well as to non-classical motifs. GRB2 SH3c binds Gab2
           (Grb2-associated binder 2) through epitopes containing
           RxxK motifs, while the SH3c of GRAP2 binds to the
           phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
           domains are protein interaction domains that typically
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 38.4 bits (90), Expect = 2e-04
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A +DF P E  +L  ++G  + VL        WWKG++  RV  F
Sbjct: 4   ALYDFNPQEPGELEFRRGDIITVLDSSDPD--WWKGELRGRVGIF 46


>gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in
           suppressor of cytokine signaling (SOCS) proteins.  SH2
           domain found in SOCS proteins. SOCS was first recognized
           as a group of cytokine-inducible SH2 (CIS) domain
           proteins comprising eight family members in human (CIS
           and SOCS1-SOCS7). In addition to the SH2 domain, SOCS
           proteins have a variable N-terminal domain and a
           conserved SOCS box in the C-terminal domain. SOCS
           proteins bind to a substrate via their SH2 domain. The
           prototypical members, CIS and SOCS1-SOCS3, have been
           shown to regulate growth hormone signaling in vitro and
           in a classic negative feedback response compete for
           binding at phosphotyrosine sites in JAK kinase and
           receptor pathways to displace effector proteins and
           target bound receptors for proteasomal degradation. Loss
           of SOCS activity results in excessive cytokine signaling
           associated with a variety of hematopoietic, autoimmune,
           and inflammatory diseases and certain cancers. Members
           (SOCS4-SOCS7) were identified by their conserved SOCS
           box, an adapter motif of 3 helices that associates
           substrate binding domains, such as the SOCS SH2 domain,
           ankryin, and WD40 with ubiquitin ligase components.
           These show limited cytokine induction. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 101

 Score = 38.9 bits (91), Expect = 3e-04
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 11/91 (12%)

Query: 83  ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHM 142
             L +  W+ G M  E A  +L  + DG++L+R       +    I++LS ++   V H 
Sbjct: 5   RELKDCGWYWGPMSWEDAEKVLSNKPDGSFLVR-DSSDDRY----IFSLSFRSQGSVHHT 59

Query: 143 KVYEKEMD---GVPQYFLSQSRYFRSIVELI 170
           ++ + +     G    F+ +S   +S+VE I
Sbjct: 60  RIEQYQGTFSLGSRNKFVDRS---QSLVEFI 87


>gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases.
           MLKs are Serine/Threonine Kinases (STKs), catalyzing the
           transfer of the gamma-phosphoryl group from ATP to S/T
           residues on protein substrates. MLKs act as
           mitogen-activated protein kinase kinase kinases (MAP3Ks,
           MKKKs, MAPKKKs), which phosphorylate and activate MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. MLKs play roles in
           immunity and inflammation, as well as in cell death,
           proliferation, and cell cycle regulation. Mammals have
           four MLKs (MLK1-4), mostly conserved in vertebrates,
           which contain an SH3 domain, a catalytic kinase domain,
           a leucine zipper, a proline-rich region, and a CRIB
           domain that mediates binding to GTP-bound Cdc42 and Rac.
           SH3 domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 58

 Score = 37.9 bits (88), Expect = 3e-04
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGE---QKGWWKGKIDERVSYF 244
            A FD+     ++L L++G  V VLSK+      +GWW GKI ++V  F
Sbjct: 3   TALFDYDARGEDELTLRRGQPVEVLSKDAAVSGDEGWWTGKIGDKVGIF 51


>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
           GRB2-related adaptor protein.  GRAP is a GRB-2 like
           adaptor protein that is highly expressed in lymphoid
           tissues. It acts as a negative regulator of T cell
           receptor (TCR)-induced lymphocyte proliferation by
           downregulating the signaling to the Ras/ERK pathway. It
           has been identified as a regulator of TGFbeta signaling
           in diabetic kidney tubules and may have a role in the
           pathogenesis of the disease. GRAP contains an N-terminal
           SH3 domain, a central SH2 domain, and a C-terminal SH3
           domain. The C-terminal SH3 domains (SH3c) of the related
           proteins, GRB2 and GRAP2, have been shown to bind to
           classical PxxP motif ligands, as well as to
           non-classical motifs. GRB2 SH3c binds Gab2
           (Grb2-associated binder 2) through epitopes containing
           RxxK motifs, while the SH3c of GRAP2 binds to the
           phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
           domains are protein interaction domains that typically
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 37.5 bits (87), Expect = 3e-04
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
           A++DF   + +QL  ++G  + VL  +     WW+G+I  RV +F + Y
Sbjct: 4   AQYDFSAEDPSQLSFRRGDIIEVL--DCPDPNWWRGRISGRVGFFPRNY 50


>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal
           peroxisomal membrane protein Pex13p.  Pex13p, located in
           the peroxisomal membrane, contains two transmembrane
           regions and a C-terminal SH3 domain. It binds to the
           peroxisomal targeting type I (PTS1) receptor Pex5p and
           the docking factor Pex14p through its SH3 domain. It is
           essential for both PTS1 and PTS2 protein import pathways
           into the peroxisomal matrix. Pex13p binds Pex14p, which
           contains a PxxP motif, in a classical fashion to the
           proline-rich ligand binding site of its SH3 domain. It
           binds the WxxxF/Y motif of Pex5p in a novel site that
           does not compete with Pex14p binding. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 60

 Score = 37.6 bits (88), Expect = 3e-04
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 200 AEFDFCP-TEANQLPLKQGCQVIVLSK---EGEQKGWWKGKI-DERVSYF 244
           A +DF P     +L LK+G  V VLSK    G    WWKG+  D R+ +F
Sbjct: 4   ALYDFTPENPEMELSLKKGDIVAVLSKTDPLGRDSEWWKGRTRDGRIGWF 53


>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the
           Src oncogene at 42A (Src42).  Src42 is a member of the
           Src non-receptor type tyrosine kinase family of
           proteins. The integration of receptor tyrosine
           kinase-induced RAS and Src42 signals by Connector
           eNhancer of KSR (CNK) as a two-component input is
           essential for RAF activation in Drosophila. Src42 is
           present in a wide variety of organisms including:
           California sea hare, pea aphid, yellow fever mosquito,
           honey bee, Panamanian leafcutter ant, and sea urchin.
           Src42 has a unique N-terminal domain, an SH3 domain, an
           SH2 domain, a kinase domain and a regulatory tail, as do
           the other members of the family. Like the other members
           of the Src family the SH2 domain in addition to binding
           the target, also plays an autoinhibitory role by binding
           to its C-terminal tail.  In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 96

 Score = 38.6 bits (90), Expect = 3e-04
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 15/105 (14%)

Query: 90  WFVGEMGREKATS--LLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEK 147
           W+ G++ R +A    LL     G +L+R      +      Y+LS++  + VKH ++ + 
Sbjct: 5   WYFGKIKRIEAEKKLLLPENEHGAFLIR-----DSESRHNDYSLSVRDGDTVKHYRIRQL 59

Query: 148 EMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
           +  G   +F+++   FR++ EL+  Y ++S      GL V L+ P
Sbjct: 60  DEGG---FFIARRTTFRTLQELVEHYSKDS-----DGLCVNLRKP 96


>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the
           Fyn-related kinase (Frk).  Frk is a member of the Src
           non-receptor type tyrosine kinase family of proteins.
           The Frk subfamily is composed of Frk/Rak and
           Iyk/Bsk/Gst. It is expressed primarily epithelial cells.
            Frk is a nuclear protein and may function during G1 and
           S phase of the cell cycle and suppress growth. Unlike
           the other Src members it lacks a glycine at position 2
           of SH4 which is important for addition of a myristic
           acid moiety that is involved in targeting Src PTKs to
           cellular membranes. FRK and SHB exert similar effects
           when overexpressed in rat phaeochromocytoma (PC12) and
           beta-cells, where both induce PC12 cell differentiation
           and beta-cell proliferation. Under conditions that cause
           beta-cell degeneration these proteins augment beta-cell
           apoptosis. The FRK-SHB responses involve FAK and insulin
           receptor substrates (IRS) -1 and -2. Frk has been
           demonstrated to interact with retinoblastoma protein.
           Frk regulates PTEN protein stability by phosphorylating
           PTEN, which in turn prevents PTEN degradation. Frk also
           plays a role in regulation of embryonal pancreatic beta
           cell formation. Frk has a unique N-terminal domain, an
           SH3 domain, an SH2 domain, a kinase domain and a
           regulatory tail, as do the other members of the family. 
           Like the other members of the Src family the SH2 domain
           in addition to binding the target, also plays an
           autoinhibitory role by binding to its activation loop.
           The tryosine involved is at the same site as the
           tyrosine involved in the autophosphorylation of Src. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 96

 Score = 38.7 bits (90), Expect = 3e-04
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 15/105 (14%)

Query: 90  WFVGEMGREKATS--LLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEK 147
           WF G + R  A    L      G +L+R      +   +  ++LS+     VKH ++   
Sbjct: 5   WFFGAIKRADAEKQLLYSENQTGAFLIR-----ESESQKGEFSLSVLDGGVVKHYRIRRL 59

Query: 148 EMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
           +  G   +FL++ + F ++ E +  Y   S      GL V+L  P
Sbjct: 60  DEGG---FFLTRRKTFSTLNEFVNYYTTTS-----DGLCVKLGKP 96


>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck.  Nck
           proteins are adaptors that modulate actin cytoskeleton
           dynamics by linking proline-rich effector molecules to
           tyrosine kinases or phosphorylated signaling
           intermediates. There are two members known in this
           family: Nck1 (Nckalpha) and Nck2 (Nckbeta and Growth
           factor receptor-bound protein 4 (Grb4)). They are
           characterized by having 3 SH3 domains and a C-terminal
           SH2 domain. Nck1 and Nck2 have overlapping functions as
           determined by gene knockouts. Both bind receptor
           tyrosine kinases and other tyrosine-phosphorylated
           proteins through their SH2 domains. In addition they
           also bind distinct targets.  Neuronal signaling
           proteins: EphrinB1, EphrinB2, and Disabled-1 (Dab-1) all
           bind to Nck-2 exclusively. And in the case of PDGFR,
           Tyr(P)751 binds to  Nck1 while Tyr(P)1009 binds to Nck2.
           Nck1 and Nck2 have a role in the infection process of
           enteropathogenic Escherichia coli (EPEC). Their SH3
           domains are involved in recruiting and activating the
           N-WASP/Arp2/3 complex inducing actin polymerization
           resulting in the production of pedestals, dynamic
           bacteria-presenting protrusions of the plasma membrane.
           A similar thing occurs in the vaccinia virus where
           motile plasma membrane projections are formed beneath
           the virus. Recently it has been shown that the SH2
           domains of both Nck1 and Nck2 bind the G-protein coupled
           receptor kinase-interacting protein 1 (GIT1) in a
           phosphorylation-dependent manner. In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 97

 Score = 38.5 bits (89), Expect = 4e-04
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 11/87 (12%)

Query: 90  WFVGEMGREKA-TSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           W+ G++ R +A  +L ER  +G +L+R      + PN+  +++SLK   K KH KV  KE
Sbjct: 3   WYYGKVTRHQAEMALNERGNEGDFLIR---DSESSPND--FSVSLKAQGKNKHFKVQLKE 57

Query: 149 MDGVPQYFLSQSRYFRSIVELICCYER 175
                 Y + Q R F S+ EL+  Y++
Sbjct: 58  C----VYCIGQ-RKFSSMEELVEHYKK 79


>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein
           Tyrosine Kinases.  The Tec (Tyrosine kinase expressed in
           hepatocellular carcinoma) subfamily is composed of Tec,
           Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar
           proteins. They are cytoplasmic (or nonreceptor) tyr
           kinases containing Src homology protein interaction
           domains (SH3, SH2) N-terminal to the catalytic tyr
           kinase domain. Most Tec subfamily members (except Rlk)
           also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. In addition, some
           members contain the Tec homology (TH) domain, which
           contains proline-rich and zinc-binding regions. Tec
           kinases are expressed mainly by haematopoietic cells,
           although Tec and Bmx are also found in endothelial
           cells. B-cells express Btk and Tec, while T-cells
           express Itk, Txk, and Tec. Collectively, Tec kinases are
           expressed in a variety of myeloid cells such as mast
           cells, platelets, macrophages, and dendritic cells. Each
           Tec kinase shows a distinct cell-type pattern of
           expression. The function of Tec kinases in lymphoid
           cells have been studied extensively. They play important
           roles in the development, differentiation, maturation,
           regulation, survival, and function of B-cells and
           T-cells. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 54

 Score = 37.3 bits (87), Expect = 4e-04
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           I VA +DF P E   LPL++G + +VL    E   WW+ +
Sbjct: 1   IVVALYDFQPIEPGDLPLEKGEEYVVLDDSNEH--WWRAR 38


>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine
           Kinase.  Blk is a member of the Src subfamily of
           proteins, which are cytoplasmic (or non-receptor) PTKs.
           It is expressed specifically in B-cells and is involved
           in pre-BCR (B-cell receptor) signaling. Src kinases
           contain an N-terminal SH4 domain with a myristoylation
           site, followed by SH3 and SH2 domains, a tyr kinase
           domain, and a regulatory C-terminal region containing a
           conserved tyr. They are activated by autophosphorylation
           at the tyr kinase domain, but are negatively regulated
           by phosphorylation at the C-terminal tyr by Csk
           (C-terminal Src Kinase). The SH3 domain of Src kinases
           contributes to substrate recruitment by binding adaptor
           proteins/substrates, and regulation of kinase activity
           through an intramolecular interaction. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 54

 Score = 35.9 bits (83), Expect = 0.001
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           +A++DF P+    L LK+G ++ VL  +GE   WW  K
Sbjct: 3   IAQYDFVPSNERDLQLKKGEKLQVLKSDGE---WWLAK 37


>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal
           Myosins.  Type I myosins (myosin-I) are actin-dependent
           motors in endocytic actin structures and actin patches.
           They play roles in membrane traffic in endocytic and
           secretory pathways, cell motility, and mechanosensing.
           Saccharomyces cerevisiae has two myosins-I, Myo3 and
           Myo5, which are involved in endocytosis and the
           polarization of the actin cytoskeleton. Myosin-I
           contains an N-terminal actin-activated ATPase, a
           phospholipid-binding TH1 (tail homology 1) domain, and a
           C-terminal extension which includes an F-actin-binding
           TH2 domain, an SH3 domain, and an acidic peptide that
           participates in activating the Arp2/3complex. The SH3
           domain of myosin-I is required for myosin-I-induced
           actin polymerization. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 35.8 bits (83), Expect = 0.001
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           A +DF  + AN+L LK+   V ++ KE    GWW  K
Sbjct: 4   ALYDFAGSVANELSLKKDDIVYIVQKEDN--GWWLAK 38


>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the
           growth factor receptor bound, subclass 7 (Grb7)
           proteins.  The Grb family binds to the epidermal growth
           factor receptor (EGFR, erbB1) via their SH2 domains.
           There are 3 members of the Grb7 family of proteins:
           Grb7, Grb10, and Grb14. They are composed of an
           N-terminal Proline-rich domain, a Ras Associating-like
           (RA) domain, a Pleckstrin Homology (PH) domain, a
           phosphotyrosine interaction region (PIR, BPS) and a
           C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
           and Grb14 preferentially bind to a different RTK. Grb7
           binds strongly to the erbB2 receptor, unlike Grb10 and
           Grb14 which bind weakly to it. Grb14 binds to Fibroblast
           Growth Factor Receptor (FGFR). Grb10 has been shown to
           interact with many different proteins, including the
           insulin and IGF1 receptors, platelet-derived growth
           factor (PDGF) receptor-beta, Ret, Kit, Raf1 and MEK1,
           and Nedd4.  Grb7 family proteins are phosphorylated on
           serine/threonine as well as tyrosine residues. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 108

 Score = 37.0 bits (86), Expect = 0.001
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 89  LWFVGEMGREKATSLLEREA--DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYE 146
            WF G + R++A  L+ ++   DG +L+R      +  N   + LSLK  +K+KH ++  
Sbjct: 6   PWFHGGISRDEAARLIRQQGLVDGVFLVR-----ESQSNPGAFVLSLKHGQKIKHYQIIP 60

Query: 147 KEMDG 151
            E +G
Sbjct: 61  IEDEG 65


>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in
           cancer-related signaling adaptor protein CRK.  SH2
           domain in the CRK proteins.  CRKI (SH2-SH3) and CRKII
           (SH2-SH3-SH3) are splicing isoforms of the oncoprotein
           CRK.  CRKs regulate transcription and cytoskeletal
           reorganization for cell growth and motility by linking
           tyrosine kinases to small G proteins. The SH2 domain of
           CRK associates with tyrosine-phosphorylated receptors or
           components of focal adhesions, such as p130Cas and
           paxillin. CRK transmits signals to small G proteins
           through effectors that bind its SH3 domain, such as C3G,
           the guanine-nucleotide exchange factor (GEF) for Rap1
           and R-Ras, and DOCK180, the GEF for Rac6. The binding of
           p130Cas to the CRK-C3G complex activates Rap1, leading
           to regulation of cell adhesion, and activates R-Ras,
           leading to JNK-mediated activation of cell
           proliferation, whereas the binding of CRK DOCK180
           induces Rac1-mediated activation of cellular migration.
           The activity of the different splicing isoforms varies
           greatly with CRKI displaying substantial transforming
           activity, CRKII less so, and phosphorylated CRKII with
           no biological activity whatsoever.  CRKII has a linker
           region with a phosphorylated Tyr and an additional
           C-terminal SH3 domain. The phosphorylated Tyr creates a
           binding site for its SH2 domain which disrupts the
           association between CRK and its SH2 target proteins.  In
           general SH2 domains are involved in signal transduction.
            They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 106

 Score = 37.1 bits (86), Expect = 0.002
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 10/74 (13%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM 149
           W+ G M R++A  LL+ +  G +L+R      T P +  Y LS+  + +V H  +     
Sbjct: 9   WYFGPMSRQEAQELLQGQRHGVFLVR---DSSTIPGD--YVLSVSENSRVSHYII----- 58

Query: 150 DGVPQYFLSQSRYF 163
           + + Q   +QSRY 
Sbjct: 59  NSLGQPAPNQSRYR 72


>gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth
           factor receptor bound, subclass 14 (Grb14) proteins.
           The Grb family binds to the epidermal growth factor
           receptor (EGFR, erbB1) via their SH2 domains. Grb14 is
           part of the Grb7 family of proteins which also includes
           Grb7, and Grb14. They are composed of an N-terminal
           Proline-rich domain, a Ras Associating-like (RA) domain,
           a Pleckstrin Homology (PH) domain, a phosphotyrosine
           interaction region (PIR, BPS) and a C-terminal SH2
           domain. The SH2 domains of Grb7, Grb10 and Grb14
           preferentially bind to a different RTK. Grb14 binds to
           Fibroblast Growth Factor Receptor (FGFR) and weakly to
           the erbB2 receptor. In general SH2 domains are involved
           in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 108

 Score = 37.2 bits (86), Expect = 0.002
 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 90  WFVGEMGREKATSLLEREA--DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEK 147
           WF  ++ R++A  L+ ++   DG +L+R      +  N   + LS+   +K+KH ++   
Sbjct: 7   WFHHKISRDEAQRLIIQQGLVDGVFLVR-----DSQSNPRTFVLSMSHGQKIKHFQIIPV 61

Query: 148 EMDGVPQYFLSQSRY-FRSIVELICCYERN 176
           E DG   + L      F  +++L+  Y+ N
Sbjct: 62  EDDGELFHTLDDGHTRFTDLIQLVEFYQLN 91


>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase
           expressed in hepatocellular carcinoma).  Tec is a
           cytoplasmic (or nonreceptor) tyr kinase containing Src
           homology protein interaction domains (SH3, SH2)
           N-terminal to the catalytic tyr kinase domain. It also
           contains an N-terminal pleckstrin homology (PH) domain,
           which binds the products of PI3K and allows membrane
           recruitment and activation, and the Tec homology (TH)
           domain, which contains proline-rich and zinc-binding
           regions. It is more widely-expressed than other Tec
           subfamily kinases. Tec is found in endothelial cells,
           both B- and T-cells, and a variety of myeloid cells
           including mast cells, erythroid cells, platelets,
           macrophages and neutrophils. Tec is a key component of
           T-cell receptor (TCR) signaling, and is important in
           TCR-stimulated proliferation, IL-2 production and
           phospholipase C-gamma1 activation. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 56

 Score = 35.2 bits (81), Expect = 0.002
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           I VA +DF PTE + L L+ G + ++L K      WWK +
Sbjct: 2   IVVAMYDFQPTEPHDLRLETGEEYVILEK--NDVHWWKAR 39


>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual
           adaptor for phosphotyrosine and 3-phosphoinositides (
           DAPP1)/B lymphocyte adaptor molecule of 32 kDa
           (Bam32)-like proteins.  DAPP1/Bam32 contains a putative
           myristoylation site at its N-terminus, followed by a SH2
           domain, and a pleckstrin homology (PH) domain at its
           C-terminus. DAPP1 could potentially be recruited to the
           cell membrane by any of these domains. Its putative
           myristoylation site could facilitate the interaction of
           DAPP1 with the lipid bilayer. Its SH2 domain may also
           interact with phosphotyrosine residues on
           membrane-associated proteins such as activated tyrosine
           kinase receptors. And finally its PH domain exhibits a
           high-affinity interaction with the PtdIns(3,4,5)P(3)
           PtdIns(3,4)P(2) second messengers produced at the cell
           membrane following the activation of PI 3-kinases. DAPP1
           is thought to interact with both tyrosine phosphorylated
           proteins and 3-phosphoinositides and therefore may play
           a role in regulating the location and/or activity of
           such proteins(s) in response to agonists that elevate
           PtdIns(3,4,5)P(3) and PtdIns(3,4)P(2). This protein is
           likely to play an important role in triggering signal
           transduction pathways that lie downstream from receptor
           tyrosine kinases and PI 3-kinase. It is likely that
           DAPP1 functions as an adaptor to recruit other proteins
           to the plasma membrane in response to extracellular
           signals. In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 92

 Score = 35.9 bits (83), Expect = 0.002
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 83  ENLSEYLWFVGEMGREKA-TSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKH 141
           E L    W+ G + R  A   LL    DG+YLLR   +G       +++LS++  + VKH
Sbjct: 1   ELLQSLGWYHGNLTRHAAEALLLSNGVDGSYLLRNSNEGT-----GLFSLSVRAKDSVKH 55

Query: 142 MKV 144
             V
Sbjct: 56  FHV 58


>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and
           Casein kinase Substrate in Neurons (PACSIN) proteins.
           PACSINs, also called Synaptic dynamin-associated
           proteins (Syndapins), act as regulators of cytoskeletal
           and membrane dynamics. They bind both dynamin and
           Wiskott-Aldrich syndrome protein (WASP), and may provide
           direct links between the actin cytoskeletal machinery
           through WASP and dynamin-dependent endocytosis.
           Vetebrates harbor three isoforms with distinct
           expression patterns and specific functions. PACSINs
           contain an N-terminal F-BAR domain and a C-terminal SH3
           domain. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 35.1 bits (81), Expect = 0.003
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNF 252
           A +D+   E+++L  K G  +  L +E EQ GW KG++D RV     LY  N+
Sbjct: 4   ALYDYEGQESDELSFKAGDILTKLEEEDEQ-GWCKGRLDGRVG----LYPANY 51


>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3
           and cysteine-rich domain-containing protein 3 (Stac3).
           Stac proteins are putative adaptor proteins that contain
           a cysteine-rich C1 domain and one or two SH3 domains at
           the C-terminus. There are three mammalian members
           (Stac1, Stac2, and Stac3) of this family. Stac1 and
           Stac3 contain two SH3 domains while Stac2 contains a
           single SH3 domain at the C-terminus. Stac1 and Stac2
           have been found to be expressed differently in mature
           dorsal root ganglia (DRG) neurons. Stac1 is mainly
           expressed in peptidergic neurons while Stac2 is found in
           a subset of nonpeptidergic and all trkB+ neurons. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 34.9 bits (80), Expect = 0.003
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           VA + F   E + L    G ++ V+    E+  WW+GKI E+  YF
Sbjct: 3   VALYRFKALEKDDLDFHPGERITVIDDSNEE--WWRGKIGEKTGYF 46


>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of
           GRB2-related adaptor protein.  GRAP is a GRB-2 like
           adaptor protein that is highly expressed in lymphoid
           tissues. It acts as a negative regulator of T cell
           receptor (TCR)-induced lymphocyte proliferation by
           downregulating the signaling to the Ras/ERK pathway. It
           has been identified as a regulator of TGFbeta signaling
           in diabetic kidney tubules and may have a role in the
           pathogenesis of the disease. GRAP contains an N-terminal
           SH3 domain, a central SH2 domain, and a C-terminal SH3
           domain. The N-terminal SH3 domain of the related protein
           GRB2 binds to Sos and Sos-derived proline-rich peptides.
           SH3 domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 54

 Score = 34.8 bits (80), Expect = 0.004
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
           AVA + F  TE+++LP ++G  + +L+ E +Q  W+K ++  R  Y  + Y
Sbjct: 2   AVALYSFQATESDELPFQKGDILKILNMEDDQ-NWYKAELQGREGYIPKNY 51


>gnl|CDD|212799 cd11865, SH3_Nbp2-like, Src Homology 3 domain of Saccharomyces
           cerevisiae Nap1-binding protein 2 and similar fungal
           proteins.  This subfamily includes Saccharomyces
           cerevisiae Nbp2 (Nucleosome assembly protein 1
           (Nap1)-binding protein 2), Schizosaccharomyces pombe
           Skb5, and similar proteins. Nbp2 interacts with Nap1,
           which is essential for maintaining proper nucleosome
           structures in transcription and replication. It is also
           the binding partner of the yeast type II protein
           phosphatase Ptc1p and serves as a scaffolding protein
           that brings seven kinases in close contact to Ptc1p.
           Nbp2 plays a role many cell processes including
           organelle inheritance, mating hormone response, cell
           wall stress, mitotic cell growth at elevated
           temperatures, and high osmolarity. Skb5 interacts with
           the p21-activated kinase (PAK) homolog Shk1, which is
           critical for fission yeast cell viability. Skb5
           activates Shk1 and plays a role in regulating cell
           morphology and growth under hypertonic conditions. Nbp2
           and Skb5 contain an SH3 domain. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 34.4 bits (79), Expect = 0.004
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGW 232
           AVA +DF P   N+L   +G  + +L K G+  GW
Sbjct: 2   AVALYDFEPEHDNELGFAEGQILFILYKHGQ--GW 34


>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of
           Cbl-interacting protein of 85 kDa.  CIN85, also called
           SH3 domain-containing kinase-binding protein 1 (SH3KBP1)
           or CD2-binding protein 3 (CD2BP3) or Ruk, is an adaptor
           protein that is involved in the downregulation of
           receptor tyrosine kinases by facilitating endocytosis
           through interaction with endophilin-associated ubiquitin
           ligase Cbl proteins. It is also important in many other
           cellular processes including vesicle-mediated transport,
           cytoskeletal remodelling, apoptosis, cell adhesion and
           migration, and viral infection, among others. CIN85
           exists as multiple variants from alternative splicing;
           the main variant contains three SH3 domains, a
           proline-rich region, and a C-terminal coiled-coil
           domain. All of these domains enable CIN85 to bind
           various protein partners and assemble complexes that
           have been implicated in many different functions. This
           alignment model represents the first SH3 domain (SH3A)
           of CIN85; SH3A binds to internal proline-rich motifs
           within the proline-rich region. This intramolecular
           interaction serves as a regulatory mechanism to keep
           CIN85 in a closed conformation, preventing the
           recruitment of other proteins. SH3A has also been shown
           to bind ubiquitin and to an atypical PXXXPR motif at the
           C-terminus of Cbl and the cytoplasmic end of the cell
           adhesion protein CD2. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 34.1 bits (78), Expect = 0.005
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A+ EFD+     ++L +  G  +  + K+    GWW+G+I  R   F
Sbjct: 2   AIVEFDYKAQHEDELTITVGDIITKIKKD--DGGWWEGEIKGRRGLF 46


>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of
           CD2-associated protein.  CD2AP, also called CMS (Cas
           ligand with Multiple SH3 domains) or METS1
           (Mesenchyme-to-Epithelium Transition protein with SH3
           domains), is a cytosolic adaptor protein that plays a
           role in regulating the cytoskeleton. It is critical in
           cell-to-cell union necessary for kidney function. It
           also stabilizes the contact between a T cell and
           antigen-presenting cells. It is primarily expressed in
           podocytes at the cytoplasmic face of the slit diaphragm
           and serves as a linker anchoring podocin and nephrin to
           the actin cytoskeleton. CD2AP contains three SH3
           domains, a proline-rich region, and a C-terminal
           coiled-coil domain. All of these domains enable CD2AP to
           bind various protein partners and assemble complexes
           that have been implicated in many different functions.
           This alignment model represents the third SH3 domain
           (SH3C) of CD2AP. SH3C has been shown to bind ubiquitin.
           SH3 domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 57

 Score = 34.4 bits (79), Expect = 0.005
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A F +  T  ++L  K+G  ++++SK+  + GWWKG+++ +   F
Sbjct: 6   ALFHYEGTNEDELDFKEGEIILIISKDTGEPGWWKGELNGKEGVF 50


>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor
           protein C (SHC).  SHC is involved in a wide variety of
           pathways including regulating proliferation,
           angiogenesis, invasion and metastasis, and bone
           metabolism. An adapter protein, SHC has been implicated
           in Ras activation following the stimulation of a number
           of different receptors, including growth factors
           [insulin, epidermal growth factor (EGF), nerve growth
           factor, and platelet derived growth factor (PDGF)],
           cytokines [interleukins 2, 3, and 5], erythropoietin,
           and granulocyte/macrophage colony-stimulating factor,
           and antigens [T-cell and B-cell receptors]. SHC has been
           shown to bind to tyrosine-phosphorylated receptors, and
           receptor stimulation leads to tyrosine phosphorylation
           of SHC. Upon phosphorylation, SHC interacts with another
           adapter protein, Grb2, which binds to the Ras GTP/GDP
           exchange factor mSOS which leads to Ras activation. SHC
           is composed of an N-terminal domain that interacts with
           proteins containing phosphorylated tyrosines, a
           (glycine/proline)-rich collagen-homology domain that
           contains the phosphorylated binding site, and a
           C-terminal SH2 domain. SH2 has been shown to interact
           with the tyrosine-phosphorylated receptors of EGF and
           PDGF and with the tyrosine-phosphorylated C chain of the
           T-cell receptor, providing one of the mechanisms of
           T-cell-mediated Ras activation. In general SH2 domains
           are involved in signal transduction.  They typically
           bind pTyr-containing ligands via two surface pockets, a
           pTyr and hydrophobic binding pocket, allowing proteins
           with SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 104

 Score = 35.4 bits (82), Expect = 0.005
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 12/96 (12%)

Query: 83  ENLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHM 142
           E L    W+ G+M R  A SLL+   DG +L+R   +  T P +  Y L+   + + KH+
Sbjct: 2   EQLRGEPWYHGKMSRRDAESLLQT--DGDFLVR---ESTTTPGQ--YVLTGMQNGQPKHL 54

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNSL 178
            + + E  GV +   ++ R F SI  LI  +  N L
Sbjct: 55  LLVDPE--GVVR---TKDRVFESISHLINYHVTNGL 85


>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of
           Growth factor receptor-bound protein 2 (GRB2) and
           related proteins.  This family includes the adaptor
           protein GRB2 and related proteins including Drosophila
           melanogaster Downstream of receptor kinase (DRK),
           Caenorhabditis elegans Sex muscle abnormal protein 5
           (Sem-5), GRB2-related adaptor protein (GRAP), GRAP2, and
           similar proteins. Family members contain an N-terminal
           SH3 domain, a central SH2 domain, and a C-terminal SH3
           domain. GRB2/Sem-5/DRK is a critical signaling molecule
           that regulates the Ras pathway by linking tyrosine
           kinases to the Ras guanine nucleotide releasing protein
           Sos (son of sevenless), which converts Ras to the active
           GTP-bound state. GRAP2 plays an important role in T cell
           receptor (TCR) signaling by promoting the formation of
           the SLP-76:LAT complex, which couples the TCR to the Ras
           pathway. GRAP acts as a negative regulator of T cell
           receptor (TCR)-induced lymphocyte proliferation by
           downregulating the signaling to the Ras/ERK pathway. The
           N-terminal SH3 domain of GRB2 binds to Sos and
           Sos-derived proline-rich peptides. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 52

 Score = 33.9 bits (78), Expect = 0.005
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSY 243
           AVA+ DF  T  ++L  K+G  + VL+ E +   W+K ++D +   
Sbjct: 2   AVAKHDFKATAEDELSFKKGSILKVLNME-DDPNWYKAELDGKEGL 46


>gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src
           Kinase-Associated Phosphoprotein 1 and similar proteins.
            This subfamily is composed of SKAP1, SKAP2, and similar
           proteins. SKAP1 and SKAP2 are immune cell-specific
           adaptor proteins that play roles in T- and B-cell
           adhesion, respectively, and are thus important in the
           migration of T- and B-cells to sites of inflammation and
           for movement during T-cell conjugation with
           antigen-presenting cells. Both SKAP1 and SKAP2 bind to
           ADAP (adhesion and degranulation-promoting adaptor
           protein), among many other binding partners. They
           contain a pleckstrin homology (PH) domain, a C-terminal
           SH3 domain, and several tyrosine phosphorylation sites.
           The SH3 domain of SKAP1 is necessary for its ability to
           regulate T-cell conjugation with antigen-presenting
           cells and the formation of LFA-1 clusters. SKAP1 binds
           primarily to a proline-rich region of ADAP through its
           SH3 domain; its degradation is regulated by ADAP. A
           secondary interaction occurs via the ADAP SH3 domain and
           the RKxxYxxY motif in SKAP1. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 33.9 bits (78), Expect = 0.006
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 202 FDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERV 241
           +D    E ++L  K+G  + ++SKE +  GWW G+++ +V
Sbjct: 6   WDCSGNEPDELSFKRGDLIYIISKEYDSFGWWVGELNGKV 45


>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of
           CD2-associated protein and similar proteins.  This
           subfamily is composed of the first SH3 domain (SH3A) of
           CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
           similar domains. CD2AP and CIN85 are adaptor proteins
           that bind to protein partners and assemble complexes
           that have been implicated in T cell activation, kidney
           function, and apoptosis of neuronal cells. They also
           associate with endocytic proteins, actin cytoskeleton
           components, and other adaptor proteins involved in
           receptor tyrosine kinase (RTK) signaling. CD2AP and the
           main isoform of CIN85 contain three SH3 domains, a
           proline-rich region, and a C-terminal coiled-coil
           domain. All of these domains enable CD2AP and CIN85 to
           bind various protein partners and assemble complexes
           that have been implicated in many different functions.
           SH3A of both proteins bind to an atypical PXXXPR motif
           at the C-terminus of Cbl and the cytoplasmic domain of
           the cell adhesion protein CD2. CIN85 SH3A binds to
           internal proline-rich motifs within the proline-rich
           region; this intramolecular interaction serves as a
           regulatory mechanism to keep CIN85 in a closed
           conformation, preventing the recruitment of other
           proteins. CIN85 SH3A has also been shown to bind
           ubiquitin. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 34.2 bits (79), Expect = 0.006
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
            + EFD+   E ++L LK G  +  + K  E  GWW+G ++ +   F
Sbjct: 2   VIVEFDYDAEEPDELTLKVGDIITNVKKMEE--GWWEGTLNGKRGMF 46


>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2
           domain-containing adapter protein F (SHF).  SHF is
           thought to play a role in PDGF-receptor signaling and
           regulation of apoptosis. SHF is mainly expressed in
           skeletal muscle, brain, liver, prostate, testis, ovary,
           small intestine, and colon. SHF contains  four putative
           tyrosine phosphorylation sites and an SH2 domain. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 98

 Score = 35.0 bits (80), Expect = 0.006
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 89  LWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           +W+ G + R  A +LL    + +YL+R      +  ++  ++LSLK+ +   HMK+   +
Sbjct: 2   VWYHGAISRTDAENLLRLCKEASYLVR-----NSETSKNDFSLSLKSSQGFMHMKLSRTK 56

Query: 149 MDGVPQYFLSQ-SRYFRSIVELICCYERNSL 178
                +Y L Q S  F S+ E+I  Y    L
Sbjct: 57  EH---KYVLGQNSPPFSSVPEIIHHYASRKL 84


>gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth
           factor receptor bound, subclass 7 (Grb7) proteins.  The
           Grb family binds to the epidermal growth factor receptor
           (EGFR, erbB1) via their SH2 domains. Grb7 is part of the
           Grb7 family of proteins which also includes Grb10, and
           Grb14. They are composed of an N-terminal Proline-rich
           domain, a Ras Associating-like (RA) domain, a Pleckstrin
           Homology (PH) domain, a phosphotyrosine interaction
           region (PIR, BPS) and a C-terminal SH2 domain. The SH2
           domains of Grb7, Grb10 and Grb14 preferentially bind to
           a different RTK. Grb7 binds strongly to the erbB2
           receptor, unlike Grb10 and Grb14 which bind weakly to
           it. Grb7 family proteins are phosphorylated on
           serine/threonine as well as tyrosine residues. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 108

 Score = 35.3 bits (81), Expect = 0.006
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 10/86 (11%)

Query: 89  LWFVGEMGREKATSLLEREA--DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYE 146
            WF G + RE++  L+ ++   DG +L+R   + P       + LSL   +KVKH  +  
Sbjct: 6   PWFHGRISREESQRLIGQQGLVDGVFLVRESQRNPQG-----FVLSLCHLQKVKHYLILP 60

Query: 147 KEMDGVPQYFLS--QSRYFRSIVELI 170
            E +G   + +   Q+R F  +++L+
Sbjct: 61  SEEEGRLYFSMDDGQTR-FTDLLQLV 85


>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C)
           of Intersectin-2.  Intersectin-2 (ITSN2) is an adaptor
           protein that functions in exo- and endocytosis, actin
           cytoskeletal reorganization, and signal transduction. It
           plays a role in clathrin-coated pit (CCP) formation. It
           binds to many proteins through its multidomain structure
           and facilitate the assembly of multimeric complexes.
           ITSN2 also functions as a specific GEF for Cdc42
           activation in epithelial morphogenesis, and is required
           in mitotic spindle orientation. It exists in
           alternatively spliced short and long isoforms. The short
           isoform contains two Eps15 homology domains (EH1 and
           EH2), a coiled-coil region and five SH3 domains
           (SH3A-E), while the long isoform, in addition, contains
           RhoGEF (also called Dbl-homologous or DH), Pleckstrin
           homology (PH) and C2 domains. The third SH3 domain
           (SH3C) of ITSN2 has been shown to bind the K15 protein
           of Kaposi's sarcoma-associated herpesvirus. SH3 domains
           are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 52

 Score = 33.8 bits (77), Expect = 0.007
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           +A + +  +E   L   +G +++V  K+GE   WW G I++R   F
Sbjct: 3   IALYPYSSSEPGDLTFNEGEEILVTQKDGE---WWTGSIEDRTGIF 45


>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor
           protein.  Nck1 (also called Nckalpha) plays a crucial
           role in connecting signaling pathways of tyrosine kinase
           receptors and important effectors in actin dynamics and
           cytoskeletal remodeling. It binds and activates RasGAP,
           resulting in the downregulation of Ras. It is also
           involved in the signaling of endothilin-mediated
           inhibition of cell migration. Nck adaptor proteins
           regulate actin cytoskeleton dynamics by linking
           proline-rich effector molecules to protein tyrosine
           kinases and phosphorylated signaling intermediates. They
           contain three SH3 domains and a C-terminal SH2 domain.
           They function downstream of the PDGFbeta receptor and
           are involved in Rho GTPase signaling and actin dynamics.
           Vertebrates contain two Nck adaptor proteins: Nck1 (also
           called Nckalpha) and Nck2, which show partly overlapping
           functions but also bind distinct targets. The second SH3
           domain of Nck appears to prefer ligands containing the
           APxxPxR motif. SH3 domains are protein interaction
           domains that usually bind to proline-rich ligands with
           moderate affinity and selectivity, preferentially a PxxP
           motif. They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 33.9 bits (77), Expect = 0.007
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A  +F++     ++L L +G +VIV+ K  +  GWW+G  + +V +F
Sbjct: 4   AYVKFNYTAEREDELSLVKGTKVIVMEKCSD--GWWRGSYNGQVGWF 48


>gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4.
            MLK4 is a Serine/Threonine Kinase (STK), catalyzing the
           transfer of the gamma-phosphoryl group from ATP to S/T
           residues on protein substrates. MLKs act as
           mitogen-activated protein kinase kinase kinases (MAP3Ks,
           MKKKs, MAPKKKs), which phosphorylate and activate MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. MLKs play roles in
           immunity and inflammation, as well as in cell death,
           proliferation, and cell cycle regulation. The specific
           function of MLK4 is yet to be determined. Mutations in
           the kinase domain of MLK4 have been detected in
           colorectal cancers. MLK4 contains an SH3 domain, a
           catalytic kinase domain, a leucine zipper, a
           proline-rich region, and a CRIB domain that mediates
           binding to GTP-bound Cdc42 and Rac. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 58

 Score = 33.8 bits (77), Expect = 0.007
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGE---QKGWWKGKIDERVSYF 244
           A +D+  +  ++L L++G  V VLS++       GWW GKI  R+  F
Sbjct: 4   ALYDYEASGEDELSLRRGDVVEVLSQDAAVSGDDGWWAGKIRHRLGIF 51


>gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain
           containing protein 4B (SH2D4B).  SH2D4B contains a
           single SH2 domain. In general SH2 domains are involved
           in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 103

 Score = 34.9 bits (80), Expect = 0.007
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETI--YALSLKTDEKVKHMKV 144
           WF G + RE+A +LL    +G++L+R+        +E I  Y LS +     KH  V
Sbjct: 9   WFHGIISREEAEALLMNATEGSFLVRV--------SEKIWGYTLSYRLQSGFKHFLV 57


>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of
           ASPP protein (iASPP).  iASPP, also called
           RelA-associated inhibitor (RAI), is an oncoprotein that
           inhibits the apoptotic transactivation potential of p53.
           It is upregulated in human breast cancers expressing
           wild-type p53, in acute leukemias regardless of the p53
           mutation status, as well as in ovarian cancer where it
           is associated with poor patient outcome and
           chemoresistance. iASPP is also a binding partner and
           negative regulator of p65RelA, which promotes cell
           proliferation and inhibits apoptosis; p65RelA has the
           opposite effect on cell growth compared to the p53
           family. It contains a proline-rich region, four ankyrin
           (ANK) repeats, and an SH3 domain at its C-terminal half.
           The SH3 domain and the ANK repeats of iASPP contribute
           to the p53 binding site; they bind to the DNA binding
           domain of p53. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 56

 Score = 33.7 bits (77), Expect = 0.008
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWG 250
           A +D+     ++L  K+G  V VL K+GE   WW   +  R  Y  + Y+G
Sbjct: 5   ALWDYSAEFPDELSFKEGDMVTVLRKDGEGTDWWWASLCGREGYVPRNYFG 55


>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2
           domain-containing adapter protein B (SHB).  SHB
           functions in generating signaling compounds in response
           to tyrosine kinase activation. SHB contains proline-rich
           motifs, a phosphotyrosine binding (PTB) domain, tyrosine
           phosphorylation sites, and a SH2 domain. SHB mediates
           certain aspects of platelet-derived growth factor (PDGF)
           receptor-, fibroblast growth factor (FGF) receptor-,
           neural growth factor (NGF) receptor TRKA-, T cell
           receptor-, interleukin-2 (IL-2) receptor- and focal
           adhesion kinase- (FAK) signaling. SRC-like FYN-Related
           Kinase FRK/RAK (also named BSK/IYK or GTK) and SHB
           regulate apoptosis, proliferation and differentiation.
           SHB promotes apoptosis and is also required for proper
           mitogenicity, spreading and tubular morphogenesis in
           endothelial cells. SHB also plays a role in preventing
           early cavitation of embryoid bodies and reduces
           differentiation to cells expressing albumin, amylase,
           insulin and glucagon. SHB is a multifunctional protein
           that has difference responses in different cells under
           various conditions. In general SH2 domains are involved
           in signal transduction.  They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 97

 Score = 34.7 bits (79), Expect = 0.009
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 10/91 (10%)

Query: 89  LWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           +W+ G + R  A +LL    + +YL+R   Q   H     Y+LSLK+++   HMK+ + +
Sbjct: 2   IWYHGAISRGDAENLLRLCKECSYLVR-NSQTSKHD----YSLSLKSNQGFMHMKLAKTK 56

Query: 149 MDGVPQYFLSQ-SRYFRSIVELICCYERNSL 178
                +Y L Q S  F S+ E+I  Y    L
Sbjct: 57  ----EKYVLGQNSPPFDSVPEVIHYYTTRKL 83


>gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2
           domain-containing adapter protein E (SHE).  SHE is
           expressed in heart, lung, brain, and skeletal muscle.
           SHE contains two pTry protein binding domains, protein
           interaction domain (PID) and a SH2 domain, followed by a
           glycine-proline rich region, all of which are N-terminal
           to the phosphotyrosine binding (PTB) domain. In general
           SH2 domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 98

 Score = 34.5 bits (79), Expect = 0.010
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 9/90 (10%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM 149
           W+ G + R +A S L+   + +YL+R    G +      Y+++LKT +   H+ V + + 
Sbjct: 3   WYHGSISRAEAESRLQPCKEASYLVRNSESGNSK-----YSIALKTSQGCVHIIVAQTKD 57

Query: 150 DGVPQYFLSQ-SRYFRSIVELICCYERNSL 178
           +    Y L+Q S  F SI E++  Y    L
Sbjct: 58  NK---YTLNQTSAVFDSIPEVVHYYSNEKL 84


>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of
           CD2-associated protein and similar proteins.  This
           subfamily is composed of the second SH3 domain (SH3B) of
           CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
           similar domains. CD2AP and CIN85 are adaptor proteins
           that bind to protein partners and assemble complexes
           that have been implicated in T cell activation, kidney
           function, and apoptosis of neuronal cells. They also
           associate with endocytic proteins, actin cytoskeleton
           components, and other adaptor proteins involved in
           receptor tyrosine kinase (RTK) signaling. CD2AP and the
           main isoform of CIN85 contain three SH3 domains, a
           proline-rich region, and a C-terminal coiled-coil
           domain. All of these domains enable CD2AP and CIN85 to
           bind various protein partners and assemble complexes
           that have been implicated in many different functions.
           SH3B of both proteins have been shown to bind to Cbl. In
           the case of CD2AP, its SH3B binds to Cbl at a site
           distinct from the c-Cbl/SH3A binding site. The CIN85
           SH3B also binds ubiquitin. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 33.1 bits (76), Expect = 0.011
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
             F + P   ++L LK G  + VL +  E  GWW+GK++ +V  F
Sbjct: 4   VLFSYTPQNEDELELKVGDTIEVLGEVEE--GWWEGKLNGKVGVF 46


>gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C
           (PLC) gamma 2.  PLCgamma2 is primarily expressed in
           haematopoietic cells, specifically in B cells. It is
           activated by tyrosine phosphorylation by B cell receptor
           (BCR) kinases and is recruited to the plasma membrane
           where its substrate is located. It is required in
           pre-BCR signaling and in the maturation of B cells. PLCs
           catalyze the hydrolysis of phosphatidylinositol
           (4,5)-bisphosphate [PtdIns(4,5)P2] to produce
           Ins(1,4,5)P3 and diacylglycerol (DAG). Ins(1,4,5)P3
           initiates the calcium signaling cascade while DAG
           functions as an activator of PKC. PLCgamma contains a
           Pleckstrin homology (PH) domain followed by an
           elongation factor (EF) domain, two catalytic regions of
           PLC domains that flank two tandem SH2 domains, followed
           by a SH3 domain and C2 domain. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 33.3 bits (76), Expect = 0.012
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFF 245
           A +D+    +++L   +G  +  +SKE    GWWKG    +V ++F
Sbjct: 4   ALYDYRAKRSDELSFCKGALIHNVSKETG--GWWKGDYGGKVQHYF 47


>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B
           adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B2 (APS),
           like other members of the SH2B adapter protein family,
           contains a pleckstrin homology domain, at least one
           dimerization domain, and a C-terminal SH2 domain which
           binds to phosphorylated tyrosines in a variety of
           tyrosine kinases. SH2B1 and SH2B2  function in signaling
           pathways found downstream of growth hormone receptor and
           receptor tyrosine kinases, including the insulin,
           insulin-like growth factor-I (IGF-I), platelet-derived
           growth factor (PDGF), nerve growth factor, hepatocyte
           growth factor, and fibroblast growth factor receptors.
           SH2B2beta, a new isoform of SH2B2, is an endogenous
           inhibitor of SH2B1 and/or SH2B2 (SH2B2alpha), negatively
           regulating insulin signaling and/or JAK2-mediated
           cellular responses. In general SH2 domains are involved
           in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 97

 Score = 34.2 bits (78), Expect = 0.013
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 84  NLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMK 143
            LS+Y WF G + R KA  L+      ++ L +  Q  T P E  Y L+     K KH++
Sbjct: 4   ELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGE--YVLTFNFQGKAKHLR 61

Query: 144 V 144
           +
Sbjct: 62  L 62


>gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2
           domain-containing adapter proteins D (SHD).  The
           expression of SHD is restricted to the brain. SHD may be
           a physiological substrate of c-Abl and may function as
           an adapter protein in the central nervous system. It is
           also thought to be involved in apoptotic regulation. SHD
           contains five YXXP motifs, a substrate sequence
           preferred by Abl tyrosine kinases, in addition to a
           poly-proline rich region and a C-terminal SH2 domain. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 98

 Score = 33.9 bits (77), Expect = 0.015
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKEM 149
           WF G + R  A +LL    +G+YL+R+     T P +    LSL++ +   H+K      
Sbjct: 3   WFHGPLSRADAENLLSLCKEGSYLVRL---SETRPQDCS--LSLRSSQGFLHLKFARTRE 57

Query: 150 DGVPQYFLSQ-SRYFRSIVELICCYERNSL 178
           +   Q  L Q S  F S+ EL+  Y    L
Sbjct: 58  N---QVVLGQHSGPFPSVPELVLHYSSRPL 84


>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes.
           Yes is a member of the Src non-receptor type tyrosine
           kinase family of proteins. Yes is the cellular homolog
           of the Yamaguchi sarcoma virus oncogene. In humans it is
           encoded by the YES1 gene which maps to chromosome 18 and
           is in close proximity to thymidylate synthase. A
           corresponding Yes pseudogene has been found on
           chromosome 22. YES1 has been shown to interact with
           Janus kinase 2, CTNND1,RPL10, and Occludin. Yes1 has a
           unique N-terminal domain, an SH3 domain, an SH2 domain,
           a kinase domain and a regulatory tail, as do the other
           members of the family. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 101

 Score = 34.2 bits (78), Expect = 0.016
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 15/95 (15%)

Query: 90  WFVGEMGREKATSLLEREAD--GTYLLRIRPQGPTHPNETIYALSLKT-DE----KVKHM 142
           W+ G+MGR+ A  LL    +  G +L+R      +   +  Y+LS++  DE     VKH 
Sbjct: 5   WYFGKMGRKDAERLLLNPGNQRGIFLVR-----ESETTKGAYSLSIRDWDEVRGDNVKHY 59

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELICCYERNS 177
           K+ + +  G   Y+++    F ++ +L+  Y  ++
Sbjct: 60  KIRKLDNGG---YYITTRAQFDTLQKLVKHYTEHA 91


>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10
           Regulator of Kinase adaptor proteins.  CRK adaptor
           proteins consists of SH2 and SH3 domains, which bind
           tyrosine-phosphorylated peptides and proline-rich
           motifs, respectively. They function downstream of
           protein tyrosine kinases in many signaling pathways
           started by various extracellular signals, including
           growth and differentiation factors. Cellular CRK (c-CRK)
           contains a single SH2 domain, followed by N-terminal and
           C-terminal SH3 domains. It is involved in the regulation
           of many cellular processes including cell growth,
           motility, adhesion, and apoptosis. CRK has been
           implicated in the malignancy of various human cancers.
           The N-terminal SH3 domain of CRK binds a number of
           target proteins including DOCK180, C3G, SOS, and cABL.
           The CRK family includes two alternatively spliced
           protein forms, CRKI and CRKII, that are expressed by the
           CRK gene, and the CRK-like (CRKL) protein, which is
           expressed by a distinct gene (CRKL). SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 55

 Score = 32.7 bits (75), Expect = 0.018
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           A FDF   +   LP K+G  + V+ K  EQ  WW  +
Sbjct: 5   ALFDFPGNDDEDLPFKKGEILTVIRKPEEQ--WWNAR 39


>gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor
           protein.  Nck2 (also called Nckbeta or Growth factor
           receptor-bound protein 4, Grb4) plays a crucial role in
           connecting signaling pathways of tyrosine kinase
           receptors and important effectors in actin dynamics and
           cytoskeletal remodeling. It binds neuronal signaling
           proteins such as ephrinB and Disabled-1 (Dab-1)
           exclusively. Nck adaptor proteins regulate actin
           cytoskeleton dynamics by linking proline-rich effector
           molecules to protein tyrosine kinases and phosphorylated
           signaling intermediates. They contain three SH3 domains
           and a C-terminal SH2 domain. They function downstream of
           the PDGFbeta receptor and are involved in Rho GTPase
           signaling and actin dynamics. Vertebrates contain two
           Nck adaptor proteins: Nck1 (also called Nckalpha) and
           Nck2, which show partly overlapping functions but also
           bind distinct targets. The second SH3 domain of Nck
           appears to prefer ligands containing the APxxPxR motif.
           SH3 domains are protein interaction domains that usually
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially a PxxP motif. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 55

 Score = 32.7 bits (74), Expect = 0.019
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           I A  +F +     ++L L +G +V V+ K  +  GWW+G  + ++ +F
Sbjct: 1   IPAFVKFAYVAEREDELSLVKGSRVTVMEKCSD--GWWRGSYNGQIGWF 47


>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine
           N-methyltransferase 2.  PRMT2, also called HRMT1L1,
           belongs to the arginine methyltransferase protein
           family. It functions as a coactivator to both estrogen
           receptor alpha (ER-alpha) and androgen receptor (AR),
           presumably through arginine methylation. The ER-alpha
           transcription factor is involved in cell proliferation,
           differentiation, morphogenesis, and apoptosis, and is
           also implicated in the development and progression of
           breast cancer. PRMT2 and its variants are upregulated in
           breast cancer cells and may be involved in modulating
           the ER-alpha signaling pathway during formation of
           breast cancer. PRMT2 also plays a role in regulating the
           function of E2F transcription factors, which are
           critical cell cycle regulators, by binding to the
           retinoblastoma gene product (RB). It contains an
           N-terminal SH3 domain and an AdoMet binding domain. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 32.4 bits (74), Expect = 0.020
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWW 233
             VA  DF  T+ +QL  + G +++VL K      WW
Sbjct: 1   EYVAIADFVATDDSQLSFESGDKLLVLRKPSVD--WW 35


>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in
           Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene
           homolog, Fgr.  Fgr is a member of the Src non-receptor
           type tyrosine kinase family of proteins. The protein
           contains N-terminal sites for myristoylation and
           palmitoylation, a PTK domain, and SH2 and SH3 domains
           which are involved in mediating protein-protein
           interactions with phosphotyrosine-containing and
           proline-rich motifs, respectively. Fgr is expressed in
           B-cells and myeloid cells, localizes to plasma membrane
           ruffles, and functions as a negative regulator of cell
           migration and adhesion triggered by the beta-2 integrin
           signal transduction pathway. Multiple alternatively
           spliced variants, encoding the same protein, have been
           identified  Fgr has been shown to interact with
           Wiskott-Aldrich syndrome protein. Fgr has a unique
           N-terminal domain, an SH3 domain, an SH2 domain, a
           kinase domain and a regulatory tail, as do the other
           members of the family. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 101

 Score = 33.7 bits (77), Expect = 0.021
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 15/91 (16%)

Query: 90  WFVGEMGREKATSLLEREAD--GTYLLRIRPQGPTHPNETIYALSLK-----TDEKVKHM 142
           W+ G++GR+ A   L    +  G +L+R      +   +  Y+LS++       + VKH 
Sbjct: 5   WYFGKIGRKDAERQLLSPGNPRGAFLIR-----ESETTKGAYSLSIRDWDQNRGDHVKHY 59

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELICCY 173
           K+ + +  G   Y+++    F ++ EL+  Y
Sbjct: 60  KIRKLDTGG---YYITTRAQFDTVQELVQHY 87


>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2)
           domain found in SH2 domains, ANK, and kinase domain
           (shark) proteins.  These non-receptor protein-tyrosine
           kinases contain two SH2 domains, five ankyrin (ANK)-like
           repeats, and a potential tyrosine phosphorylation site
           in the carboxyl-terminal tail which resembles the
           phosphorylation site in members of the src family. Like,
           mammalian non-receptor protein-tyrosine kinases, ZAP-70
           and syk proteins, they do not have SH3 domains. However,
           the presence of ANK makes these unique among
           protein-tyrosine kinases. Both tyrosine kinases and ANK
           repeats have been shown to transduce developmental
           signals, and SH2 domains are known to participate
           intimately in tyrosine kinase signaling. These tyrosine
           kinases are believed to be involved in epithelial cell
           polarity. The members of this family include the shark
           (SH2 domains, ANK, and kinase domain) gene in Drosophila
           and yellow fever mosquitos, as well as the hydra protein
           HTK16. Drosophila Shark is proposed to transduce
           intracellularly the Crumbs, a protein necessary for
           proper organization of ectodermal epithelia,
           intercellular signal. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 81

 Score = 33.1 bits (76), Expect = 0.021
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 7/58 (12%)

Query: 89  LWFVGEMGREKATSLLEREA--DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV 144
            W+ G++ RE A +LL RE   DG +L+R   +  + P +  Y LSL    +V H ++
Sbjct: 2   RWYHGKISREVAEALLLREGGRDGLFLVR---ESTSAPGD--YVLSLLAQGEVLHYQI 54


>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase
           Activating Proteins.  Slit-Robo GTPase Activating
           Proteins (srGAPs) are Rho GAPs that interact with Robo1,
           the transmembrane receptor of Slit proteins. Slit
           proteins are secreted proteins that control axon
           guidance and the migration of neurons and leukocytes.
           Vertebrates contain three isoforms of srGAPs (srGAP1-3),
           all of which are expressed during embryonic and early
           development in the nervous system but with different
           localization and timing. A fourth member has also been
           reported (srGAP4, also called ARHGAP4). srGAPs contain
           an N-terminal F-BAR domain, a Rho GAP domain, and a
           C-terminal SH3 domain. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 32.4 bits (74), Expect = 0.021
 Identities = 10/43 (23%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDER 240
           A A+FD+      +L  K+G  + +  +  +   WW+G+++ +
Sbjct: 2   ATAQFDYTGRSERELSFKKGDSLTLYRQVSDD--WWRGQLNGQ 42


>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide
           Synthase TRaffic INducer.  Nostrin is expressed in
           endothelial and epithelial cells and is involved in the
           regulation, trafficking and targeting of endothelial NOS
           (eNOS). It facilitates the endocytosis of eNOS by
           coordinating the functions of dynamin and the
           Wiskott-Aldrich syndrome protein (WASP). Increased
           expression of Nostrin may be correlated to preeclampsia.
           Nostrin contains an N-terminal F-BAR domain and a
           C-terminal SH3 domain. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 32.3 bits (74), Expect = 0.021
 Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
            A + +     ++L L+ G  + V  K+ +  GWW G+++ +   F
Sbjct: 3   KALYSYTANREDELSLQPGDIIEVHEKQDD--GWWLGELNGKKGIF 46


>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2)
           domain found in SH2 domain Phosphatases (SHP) proteins. 
           The SH2 domain phosphatases (SHP-1, SHP-2/Syp,
           Drosophila corkscrew (csw), and Caenorhabditis elegans
           Protein Tyrosine Phosphatase (Ptp-2)) are cytoplasmic
           signaling enzymes. They are both targeted and regulated
           by interactions of their SH2 domains with
           phosphotyrosine docking sites. These proteins contain
           two SH2 domains (N-SH2, C-SH2) followed by a tyrosine
           phosphatase (PTP) domain, and a C-terminal extension.
           Shp1 and Shp2 have two tyrosyl phosphorylation sites in
           their C-tails, which are phosphorylated differentially
           by receptor and nonreceptor PTKs. Csw retains the
           proximal tyrosine and Ptp-2 lacks both sites.
           Shp-binding proteins include receptors, scaffolding
           adapters, and inhibitory receptors. Some of these bind
           both Shp1 and Shp2 while others bind only one. Most
           proteins that bind a Shp SH2 domain contain one or more
           immuno-receptor tyrosine-based inhibitory motifs
           (ITIMs): [IVL]xpYxx[IVL].  Shp1 N-SH2 domain blocks the
           catalytic domain and keeps the enzyme in the inactive
           conformation, and is thus believed to regulate the
           phosphatase activity of SHP-1. Its C-SH2 domain is
           thought to be involved in searching for phosphotyrosine
           activators. The SHP2 N-SH2 domain is a conformational
           switch; it either binds and inhibits the phosphatase, or
           it binds phosphoproteins and activates the enzyme. The
           C-SH2 domain contributes binding energy and specificity,
           but it does not have a direct role in activation. Csw
           SH2 domain function is essential, but either SH2 domain
           can fulfill this requirement. The role of the csw SH2
           domains during Sevenless receptor tyrosine kinase (SEV)
           signaling is to bind Daughter of Sevenless rather than
           activated SEV.  Ptp-2 acts in oocytes downstream of
           sheath/oocyte gap junctions to promote major sperm
           protein (MSP)-induced MAP Kinase (MPK-1)
           phosphorylation. Ptp-2 functions in the oocyte
           cytoplasm, not at the cell surface to inhibit multiple
           RasGAPs, resulting in sustained Ras activation. It is
           thought that MSP triggers PTP-2/Ras activation and ROS
           production to stimulate MPK-1 activity essential for
           oocyte maturation and that secreted MSP domains and
           Cu/Zn superoxide dismutases function antagonistically to
           control ROS and MAPK signaling. In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 99

 Score = 33.5 bits (77), Expect = 0.022
 Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 18/99 (18%)

Query: 90  WFVGEMGREKATSLL-EREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           WF   +   +A +LL  R  DG++L R     P+  N   + LS++  ++V H+K+    
Sbjct: 2   WFHPVISGIEAENLLKTRGVDGSFLAR-----PSKSNPGDFTLSVRRGDEVTHIKIQNTG 56

Query: 149 MDGVPQYFLSQSRYFRSIVELICCY--------ERNSLI 179
                 Y L     F ++ EL+  Y        E+N  +
Sbjct: 57  DY----YDLYGGEKFATLSELVQYYMEQHGQLREKNGDV 91


>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and
           related proteins.  This subfamily includes cortactin,
           Abp1 (actin-binding protein 1), hematopoietic lineage
           cell-specific protein 1 (HS1), and similar proteins.
           These proteins are involved in regulating actin dynamics
           through direct or indirect interaction with the Arp2/3
           complex, which is required to initiate actin
           polymerization. They all contain at least one C-terminal
           SH3 domain. Cortactin and HS1 bind Arp2/3 and actin
           through an N-terminal region that contains an acidic
           domain and several copies of a repeat domain found in
           cortactin and HS1. Abp1 binds actin via an N-terminal
           actin-depolymerizing factor (ADF) homology domain. Yeast
           Abp1 binds Arp2/3 directly through two acidic domains.
           Mammalian Abp1 does not directly interact with Arp2/3;
           instead, it regulates actin dynamics indirectly by
           interacting with dynamin and WASP family proteins. The
           C-terminal region of these proteins acts as an adaptor
           or scaffold that can connect membrane trafficking and
           signaling proteins that bind the SH3 domain within the
           actin network. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 54

 Score = 32.3 bits (74), Expect = 0.026
 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKG 235
           A A +D+   E N++   +G  +  + +  E  GWW G
Sbjct: 2   AKALYDYQAAEDNEISFVEGDIITQIEQIDE--GWWLG 37


>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in
           SH2-containing inositol-5'-phosphatase (SHIP) and
           SLAM-associated protein (SAP).  The SH2-containing
           inositol-5'-phosphatase, SHIP (also called
           SHIP1/SHIP1a), is a hematopoietic-restricted
           phosphatidylinositide phosphatase that translocates to
           the plasma membrane after extracellular stimulation and
           hydrolyzes the phosphatidylinositol-3-kinase
           (PI3K)-generated second messenger PI-3,4,5-P3 (PIP3) to
           PI-3,4-P2. As a result, SHIP dampens down PIP3 mediated
           signaling and represses the proliferation,
           differentiation, survival, activation, and migration of
           hematopoietic cells.  PIP3 recruits lipid-binding
           pleckstrin homology(PH) domain-containing proteins to
           the inner wall of the plasma membrane and activates
           them. PH domain-containing downstream effectors include
           the survival/proliferation enhancing serine/threonine
           kinase, Akt (protein kinase B), the tyrosine kinase,
           Btk, the regulator of protein translation, S6K, and the
           Rac and cdc42 guanine nucleotide exchange factor, Vav.
           SHIP is believed to act  as a tumor suppressor during
           leukemogenesis and lymphomagenesis, and may play a role
           in activating the immune system to combat cancer. SHIP
           contains an N-terminal SH2 domain, a centrally located
           phosphatase domain that specifically hydrolyzes the
           5'-phosphate from PIP3, PI-4,5-P2  and inositol-1,3,4,5-
           tetrakisphosphate (IP4), a C2 domain, that is an
           allosteric activating site when bound by SHIP's
           enzymatic product, PI-3,4-P2; 2 NPXY motifs that bind
           proteins with a phosphotyrosine binding (Shc, Dok 1, Dok
           2) or an SH2 (p85a, SHIP2) domain; and a proline-rich
           domain consisting of four PxxP motifs that bind a subset
           of SH3-containing proteins including Grb2, Src, Lyn,
           Hck, Abl, PLCg1, and PIAS1. The SH2 domain of SHIP binds
           to the tyrosine phosphorylated forms of Shc, SHP-2,
           Doks, Gabs, CD150, platelet-endothelial cell adhesion
           molecule, Cas, c-Cbl, immunoreceptor tyrosine-based
           inhibitory motifs (ITIMs), and immunoreceptor
           tyrosine-based activation motifs (ITAMs). The X-linked
           lymphoproliferative syndrome (XLP) gene encodes SAP
           (also called SH2D1A/DSHP) a protein that consists of a 5
           residue N-terminus, a single SH2 domain, and a short 25
           residue C-terminal tail.  XLP is characterized by an
           extreme sensitivity to Epstein-Barr virus.  Both T and
           natural killer (NK) cell dysfunctions have been seen in
           XLP patients. SAP binds the cytoplasmic tail of
           Signaling lymphocytic activation molecule (SLAM), 2B4,
           Ly-9, and CD84. SAP is believed to function as a
           signaling inhibitor, by blocking or regulating binding
           of other signaling proteins. SAP and the SAP-like
           protein EAT-2 recognize the sequence motif TIpYXX(V/I),
           which is found in the cytoplasmic domains of a
           restricted number of T, B, and NK cell surface receptors
           and are proposed to be natural inhibitors or regulators
           of the physiological role of a small family of receptors
           on the surface of these cells. In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 103

 Score = 33.6 bits (77), Expect = 0.026
 Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 29/116 (25%)

Query: 88  YLWFVGEMGREKATSLLEREA-DGTYLLRIRPQGPTHPNETI---YALSLKTDEKVKHMK 143
             W+ G + R KA  LL +   DG++L+R         +E++   YAL +     V   +
Sbjct: 3   PPWYHGNITRSKAEELLSKAGKDGSFLVR--------DSESVSGAYALCVLYQNCVHTYR 54

Query: 144 VYEKEMDGVPQYFLS-------QSRYFRSIVELICCYERNSLIENFIGLNVRLQLP 192
           +     D      LS         R+F ++ ELI  Y++    EN +GL   L  P
Sbjct: 55  ILPNAED-----KLSVQASEGVPVRFFTTLPELIEFYQK----EN-MGLVTHLLYP 100


>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of
           Cbl-interacting protein of 85 kDa.  CIN85, also called
           SH3 domain-containing kinase-binding protein 1 (SH3KBP1)
           or CD2-binding protein 3 (CD2BP3) or Ruk, is an adaptor
           protein that is involved in the downregulation of
           receptor tyrosine kinases by facilitating endocytosis
           through interaction with endophilin-associated ubiquitin
           ligase Cbl proteins. It is also important in many other
           cellular processes including vesicle-mediated transport,
           cytoskeletal remodelling, apoptosis, cell adhesion and
           migration, and viral infection, among others. CIN85
           exists as multiple variants from alternative splicing;
           the main variant contains three SH3 domains, a
           proline-rich region, and a C-terminal coiled-coil
           domain. All of these domains enable CIN85 to bind
           various protein partners and assemble complexes that
           have been implicated in many different functions. This
           alignment model represents the third SH3 domain (SH3C)
           of CIN85. SH3C has been shown to bind ubiquitin. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 56

 Score = 32.2 bits (73), Expect = 0.027
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 206 PTEA---NQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           P EA   ++L +K+G  V ++SK+    GWW+G+++ R   F
Sbjct: 7   PYEAQNEDELTIKEGDIVTLISKDCIDAGWWEGELNGRRGVF 48


>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine
           kinase.  BTK is a cytoplasmic (or nonreceptor) tyr
           kinase containing Src homology protein interaction
           domains (SH3, SH2) N-terminal to the catalytic tyr
           kinase domain. It also contains an N-terminal pleckstrin
           homology (PH) domain, which binds the products of PI3K
           and allows membrane recruitment and activation, and the
           Tec homology (TH) domain with proline-rich and
           zinc-binding regions. Btk is expressed in B-cells, and a
           variety of myeloid cells including mast cells,
           platelets, neutrophils, and dendrictic cells. It
           interacts with a variety of partners, from cytosolic
           proteins to nuclear transcription factors, suggesting a
           diversity of functions. Stimulation of a diverse array
           of cell surface receptors, including antigen engagement
           of the B-cell receptor (BCR), leads to PH-mediated
           membrane translocation of Btk and subsequent
           phosphorylation by Src kinase and activation. Btk plays
           an important role in the life cycle of B-cells including
           their development, differentiation, proliferation,
           survival, and apoptosis. Mutations in Btk cause the
           primary immunodeficiency disease, X-linked
           agammaglobulinaemia (XLA) in humans. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 55

 Score = 32.1 bits (73), Expect = 0.030
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           VA +D+ P  A  L L++G + ++L  E     WW+ +
Sbjct: 4   VALYDYTPMNAQDLQLRKGEEYVIL--EESNLPWWRAR 39


>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B
           adapter protein family.  The SH2B adapter protein family
            has 3 members:  SH2B1 (SH2-B, PSM), SH2B2 (APS), and
           SH2B3 (Lnk). SH2B family members contain a pleckstrin
           homology domain, at least one dimerization domain, and a
           C-terminal SH2 domain which binds to phosphorylated
           tyrosines in a variety of tyrosine kinases.  SH2B1 and
           SH2B2  function in signaling pathways found downstream
           of growth hormone receptor and receptor tyrosine
           kinases, including the insulin, insulin-like growth
           factor-I (IGF-I), platelet-derived growth factor (PDGF),
           nerve growth factor, hepatocyte growth factor, and
           fibroblast growth factor receptors. SH2B2beta, a new
           isoform of SH2B2, is an endogenous inhibitor of SH2B1
           and/or SH2B2 (SH2B2alpha), negatively regulating insulin
           signaling and/or JAK2-mediated cellular responses. SH2B3
           negatively regulates lymphopoiesis and early
           hematopoiesis. The lnk-deficiency results in enhanced
           production of B cells, and expansion as well as enhanced
           function of hematopoietic stem cells (HSCs),
           demonstrating negative regulatory functions of Sh2b3/Lnk
           in cytokine signaling. Sh2b3/Lnk also functions in
           responses controlled by cell adhesion and in crosstalk
           between integrin- and cytokine-mediated signaling. In
           general SH2 domains are involved in signal transduction.
           They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 97

 Score = 33.2 bits (76), Expect = 0.030
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 85  LSEYLWFVGEMGREKATSL-LEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMK 143
           LSEY WF G + R  A  L L   ADG  +  +R Q  T   E  + L+     + KH++
Sbjct: 5   LSEYPWFHGTLSRSDAAQLVLHSGADGHGVFLVR-QSETRRGE--FVLTFNFQGRAKHLR 61

Query: 144 V 144
           +
Sbjct: 62  L 62


>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange
           factors.  PIX proteins are Rho guanine nucleotide
           exchange factors (GEFs), which activate small GTPases by
           exchanging bound GDP for free GTP. They act as GEFs for
           both Cdc42 and Rac 1, and have been implicated in cell
           motility, adhesion, neurite outgrowth, and cell
           polarity. Vertebrates contain two proteins from the PIX
           subfamily, alpha-PIX and beta-PIX. Alpha-PIX, also
           called ARHGEF6, is localized in dendritic spines where
           it regulates spine morphogenesis. Mutations in the
           ARHGEF6 gene cause X-linked intellectual disability in
           humans. Beta-PIX play roles in regulating neuroendocrine
           exocytosis, focal adhesion maturation, cell migration,
           synaptic vesicle localization, and insulin secretion.
           PIX proteins contain an N-terminal SH3 domain followed
           by RhoGEF (also called Dbl-homologous or DH) and
           Pleckstrin Homology (PH) domains, and a C-terminal
           leucine-zipper domain for dimerization. The SH3 domain
           of PIX binds to an atypical PxxxPR motif in
           p21-activated kinases (PAKs) with high affinity. The
           binding of PAKs to PIX facilitate the localization of
           PAKs to focal complexes and also localizes PAKs to PIX
           targets Cdc43 and Rac, leading to the activation of
           PAKs. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 31.9 bits (73), Expect = 0.033
 Identities = 12/45 (26%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A+F+F  T  ++L   +G  +I +++   + GWW+G ++ +  +F
Sbjct: 4   AKFNFEGTNEDELSFDKG-DIITVTQV-VEGGWWEGTLNGKTGWF 46


>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and
           SH3 domain containing (Sorbs) proteins and similar
           domains.  This family, also called the vinexin family,
           is composed predominantly of adaptor proteins containing
           one sorbin homology (SoHo) and three SH3 domains.
           Members include the second SH3 domains of Sorbs1 (or
           ponsin), Sorbs2 (or ArgBP2), Vinexin (or Sorbs3), and
           similar domains. They are involved in the regulation of
           cytoskeletal organization, cell adhesion, and growth
           factor signaling. Members of this family bind multiple
           partners including signaling molecules like c-Abl,
           c-Arg, Sos, and c-Cbl, as well as cytoskeletal molecules
           such as vinculin and afadin. They may have overlapping
           functions. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 31.6 bits (72), Expect = 0.048
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDER-----VSY 243
           A A+++F      +L  ++G  VI L++  ++  W++G+I  R     VSY
Sbjct: 2   ARAKYNFNADTGVELSFRKG-DVITLTRRVDEN-WYEGRIGGRQGIFPVSY 50


>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of
           Proline-Serine-Threonine Phosphatase-Interacting Protein
           1.  PSTPIP1, also called CD2 Binding Protein 1 (CD2BP1),
           is mainly expressed in hematopoietic cells. It is a
           binding partner of the cell surface receptor CD2 and
           PTP-PEST, a tyrosine phosphatase which functions in cell
           motility and Rac1 regulation. It also plays a role in
           the activation of the Wiskott-Aldrich syndrome protein
           (WASP), which couples actin rearrangement and T cell
           activation. Mutations in the gene encoding PSTPIP1 cause
           the autoinflammatory disorder known as PAPA (pyogenic
           sterile arthritis, pyoderma gangrenosum, and acne)
           syndrome. PSTPIP1 contains an N-terminal F-BAR domain,
           PEST motifs, and a C-terminal SH3 domain. SH3 domains
           are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 31.2 bits (71), Expect = 0.050
 Identities = 10/37 (27%), Positives = 18/37 (48%), Gaps = 2/37 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWK 234
               +D+   E ++L + +G  V V+ K   + GWW 
Sbjct: 2   YSVLYDYTAQEDDELSISKGDVVAVIEK--GEDGWWT 36


>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and
           double SH3 domains proteins.  This group is composed of
           FCH and double SH3 domains protein 1 (FCHSD1) and
           FCHSD2. These proteins have a common domain structure
           consisting of an N-terminal F-BAR (FES-CIP4 Homology and
           Bin/Amphiphysin/Rvs), two SH3, and C-terminal
           proline-rich domains. They have only been characterized
           in silico and their functions remain unknown. This group
           also includes the insect protein, nervous wreck, which
           acts as a regulator of synaptic growth signaling. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 57

 Score = 31.2 bits (71), Expect = 0.053
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKE--GEQKGWWKGKIDERVSYF 244
           A +D+      +L   +G  + +L K+  G   GWW+G+ + RV  F
Sbjct: 4   ALYDYEAQSDEELSFPEGAIIRILRKDDNGVDDGWWEGEFNGRVGVF 50


>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak
           Interactive eXchange factor.  Alpha-PIX, also called Rho
           guanine nucleotide exchange factor 6 (ARHGEF6) or Cool
           (Cloned out of Library)-2, activates small GTPases by
           exchanging bound GDP for free GTP. It acts as a GEF for
           both Cdc42 and Rac 1, and is localized in dendritic
           spines where it regulates spine morphogenesis. It
           controls dendritic length and spine density in the
           hippocampus. Mutations in the ARHGEF6 gene cause
           X-linked intellectual disability in humans. PIX proteins
           contain an N-terminal SH3 domain followed by RhoGEF
           (also called Dbl-homologous or DH) and Pleckstrin
           Homology (PH) domains, and a C-terminal leucine-zipper
           domain for dimerization. The SH3 domain of PIX binds to
           an atypical PxxxPR motif in p21-activated kinases (PAKs)
           with high affinity. The binding of PAKs to PIX
           facilitate the localization of PAKs to focal complexes
           and also localizes PAKs to PIX targets Cdc43 and Rac,
           leading to the activation of PAKs. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 58

 Score = 31.5 bits (71), Expect = 0.054
 Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLYWGNFR 253
           Q++  A F+F  T  ++L + +G  +I +++  E+ GWW+G ++ +  +F   Y    +
Sbjct: 1   QLVVKARFNFKQTNEDELSVCKG-DIIYVTRV-EEGGWWEGTLNGKTGWFPSNYVREIK 57


>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3
           domain of the p67phox subunit of NADPH oxidase.
           p67phox, also called Neutrophil cytosol factor 2
           (NCF-2), is a cytosolic subunit of the phagocytic NADPH
           oxidase complex (also called Nox2 or gp91phox) which
           plays a crucial role in the cellular response to
           bacterial infection. NADPH oxidase catalyzes the
           transfer of electrons from NADPH to oxygen during
           phagocytosis forming superoxide and reactive oxygen
           species. p67phox plays a regulatory role and contains
           N-terminal TPR, first SH3 (or N-terminal or central
           SH3), PB1, and C-terminal SH3 domains. It binds, via its
           C-terminal SH3 domain, to a proline-rich region of
           p47phox and upon activation, this complex assembles with
           flavocytochrome b558, the Nox2-p22phox heterodimer.
           Concurrently, RacGTP translocates to the membrane and
           interacts with the TPR domain of p67phox, which leads to
           the activation of NADPH oxidase. The PB1 domain of
           p67phox binds to its partner PB1 domain in p40phox, and
           this facilitates the assembly of p47phox-p67phox at the
           membrane. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 30.9 bits (70), Expect = 0.062
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           VA F +  ++   L  ++G  ++VLSK  E   W +G+   ++  F
Sbjct: 3   VALFSYEASQPEDLEFQKGDVILVLSKVNED--WLEGQCKGKIGIF 46


>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E)
           of Intersectin-1.  Intersectin-1 (ITSN1) is an adaptor
           protein that functions in exo- and endocytosis, actin
           cytoskeletal reorganization, and signal transduction. It
           plays a role in clathrin-coated pit (CCP) formation. It
           binds to many proteins through its multidomain structure
           and facilitate the assembly of multimeric complexes.
           ITSN1 localizes in membranous organelles, CCPs, the
           Golgi complex, and may be involved in the cell membrane
           trafficking system. It exists in alternatively spliced
           short and long isoforms. The short isoform contains two
           Eps15 homology domains (EH1 and EH2), a coiled-coil
           region and five SH3 domains (SH3A-E), while the long
           isoform, in addition, contains RhoGEF (also called
           Dbl-homologous or DH), Pleckstrin homology (PH) and C2
           domains. The fifth SH3 domain (or SH3E) of ITSN1 has
           been shown to bind many protein partners including
           SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2, N-WASP,
           and synaptojanin-1, among others. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 54

 Score = 31.1 bits (70), Expect = 0.065
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           Q+I +  +D+     ++L   +G  + VL+KE     WWKG+++ +V  F
Sbjct: 2   QVIGM--YDYTAQNDDELAFSKGQIINVLNKE--DPDWWKGELNGQVGLF 47


>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in
           B-cell linker (BLNK) protein and SH2 domain-containing
           leukocyte protein of 76 kDa (SLP-76).  BLNK (also known
           as SLP-65 or BASH) is an important adaptor protein
           expressed in B-lineage cells. BLNK consists of a
           N-terminal sterile alpha motif (SAM) domain and a
           C-terminal SH2 domain.  BLNK is a cytoplasmic protein,
           but a part of it is bound to the plasma membrane through
           an N-terminal leucine zipper motif and transiently bound
           to a cytoplasmic domain of Iga through its C-terminal
           SH2 domain upon B cell antigen receptor
           (BCR)-stimulation. A non-ITAM phosphotyrosine in Iga is
           necessary for the binding with the BLNK SH2 domain
           and/or for normal BLNK function in signaling and B cell
           activation. Upon phosphorylation BLNK binds Btk and
           PLCgamma2 through their SH2 domains and mediates
           PLCgamma2 activation by Btk. BLNK also binds other
           signaling molecules such as Vav, Grb2, Syk, and HPK1.
           BLNK has been shown to be necessary for BCR-mediated
           Ca2+ mobilization, for the activation of
           mitogen-activated protein kinases such as ERK, JNK, and
           p38 in a chicken B cell line DT40, and for activation of
           transcription factors such as NF-AT and NF-kappaB in
           human or mouse B cells. BLNK is involved in B cell
           development, B cell survival, activation, proliferation,
           and T-independent immune responses. BLNK is structurally
           homologous to SLP-76. SLP-76 and (linker for activation
           of T cells) LAT are adaptor/linker proteins in T cell
           antigen receptor activation and T cell development. BLNK
           interacts with many downstream signaling proteins that
           interact directly with both SLP-76 and  LAT.  New data
           suggest functional complementation of SLP-76 and LAT in
           T cell antigen receptor function with BLNK in BCR
           function. In general SH2 domains are involved in signal
           transduction.  They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 121

 Score = 32.7 bits (75), Expect = 0.065
 Identities = 25/106 (23%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 80  ADHENLSEYLWFVGEMGREKATSLLEREA-DGTYLLR-IRPQGPTHPNETIYALSLKTDE 137
            +  +L    W+ G + R++A   L R   DGT+L+R    +  + P    Y L +  ++
Sbjct: 3   EEEADLLPKEWYAGNIDRKEAEEALRRSNKDGTFLVRDSSGKDSSQP----YTLMVLYND 58

Query: 138 KVKHMKVYEKEMDGVPQYFL----SQSRYFRSIVELICCYERNSLI 179
           KV ++++  + ++   QY L         F S+ E+I  +++  L+
Sbjct: 59  KVYNIQI--RFLENTRQYALGTGLRGEETFSSVAEIIEHHQKTPLL 102


>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C)
           of Intersectin.  Intersectins (ITSNs) are adaptor
           proteins that function in exo- and endocytosis, actin
           cytoskeletal reorganization, and signal transduction.
           They are essential for initiating clathrin-coated pit
           formation. They bind to many proteins through their
           multidomain structure and facilitate the assembly of
           multimeric complexes. Vertebrates contain two ITSN
           proteins, ITSN1 and ITSN2, which exist in alternatively
           spliced short and long isoforms. The short isoforms
           contain two Eps15 homology domains (EH1 and EH2), a
           coiled-coil region and five SH3 domains (SH3A-E), while
           the long isoforms, in addition, contain RhoGEF (also
           called Dbl-homologous or DH), Pleckstrin homology (PH)
           and C2 domains. ITSN1 and ITSN2 are both widely
           expressed, with variations depending on tissue type and
           stage of development. The third SH3 domain (or SH3C) of
           ITSN1 has been shown to bind many proteins including
           dynamin1/2, CIN85, c-Cbl, SHIP2, Reps1, synaptojanin-1,
           and WNK, among others. The SH3C of ITSN2 has been shown
           to bind the K15 protein of Kaposi's sarcoma-associated
           herpesvirus. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 52

 Score = 30.8 bits (70), Expect = 0.074
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           +A + +   E   L    G  ++V  K+GE   WW G I +R   F
Sbjct: 3   IALYPYESNEPGDLTFNAGDVILVTKKDGE---WWTGTIGDRTGIF 45


>gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B
           adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B3 (Lnk),
           like other members of the SH2B adapter protein family,
           contains a pleckstrin homology domain, at least one
           dimerization domain, and a C-terminal SH2 domain which
           binds to phosphorylated tyrosines in a variety of
           tyrosine kinases.  SH2B3 negatively regulates
           lymphopoiesis and early hematopoiesis. The
           lnk-deficiency results in enhanced production of B
           cells, and expansion as well as enhanced function of
           hematopoietic stem cells (HSCs), demonstrating negative
           regulatory functions of Sh2b3/Lnk in cytokine signaling.
           Sh2b3/Lnk also functions in responses controlled by cell
           adhesion and in crosstalk between integrin- and
           cytokine-mediated signaling. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 97

 Score = 31.8 bits (72), Expect = 0.078
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 82  HENLSEYLWFVGEMGREKATSLLER---EADGTYLLRIRPQGPTHPNETIYALSLKTDEK 138
              LS Y WF G + R KA  L++    +A G +L+R   Q  T   E  Y L+     +
Sbjct: 2   DHFLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVR---QSETRRGE--YVLTFNFQGR 56

Query: 139 VKHMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYER 175
            KH+++   E          Q  +F S+V+++  ++R
Sbjct: 57  AKHLRLSLTERGQCR----VQHLHFPSVVDMLHHFQR 89


>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
           of Intersectin.  Intersectins (ITSNs) are adaptor
           proteins that function in exo- and endocytosis, actin
           cytoskeletal reorganization, and signal transduction.
           They are essential for initiating clathrin-coated pit
           formation. They bind to many proteins through their
           multidomain structure and facilitate the assembly of
           multimeric complexes. Vertebrates contain two ITSN
           proteins, ITSN1 and ITSN2, which exist in alternatively
           spliced short and long isoforms. The short isoforms
           contain two Eps15 homology domains (EH1 and EH2), a
           coiled-coil region and five SH3 domains (SH3A-E), while
           the long isoforms, in addition, contain RhoGEF (also
           called Dbl-homologous or DH), Pleckstrin homology (PH)
           and C2 domains. ITSN1 and ITSN2 are both widely
           expressed, with variations depending on tissue type and
           stage of development. The fifth SH3 domain (or SH3E) of
           ITSN1 has been shown to bind many protein partners
           including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
           N-WASP, and synaptojanin-1, among others. SH3 domains
           are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 30.8 bits (70), Expect = 0.082
 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 195 QIIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           Q+IA+  F +     ++L  ++G  + VLSK+     WW+G+++ +   F
Sbjct: 1   QVIAL--FPYTAQNEDELSFQKGDIINVLSKD--DPDWWRGELNGQTGLF 46


>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C)
           of Intersectin-1.  Intersectin-1 (ITSN1) is an adaptor
           protein that functions in exo- and endocytosis, actin
           cytoskeletal reorganization, and signal transduction. It
           plays a role in clathrin-coated pit (CCP) formation. It
           binds to many proteins through its multidomain structure
           and facilitate the assembly of multimeric complexes.
           ITSN1 localizes in membranous organelles, CCPs, the
           Golgi complex, and may be involved in the cell membrane
           trafficking system. It exists in alternatively spliced
           short and long isoforms. The short isoform contains two
           Eps15 homology domains (EH1 and EH2), a coiled-coil
           region and five SH3 domains (SH3A-E), while the long
           isoform, in addition, contains RhoGEF (also called
           Dbl-homologous or DH), Pleckstrin homology (PH) and C2
           domains. The third SH3 domain (or SH3C) of ITSN1 has
           been shown to bind many proteins including dynamin1/2,
           CIN85, c-Cbl, SHIP2, Reps1, synaptojanin-1, and WNK,
           among others. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 52

 Score = 30.7 bits (69), Expect = 0.088
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           VA + +   E   L  +QG  ++V  K+G+   WW G + ++   F
Sbjct: 3   VAMYTYESNEQGDLTFQQGDVILVTKKDGD---WWTGTVGDKTGVF 45


>gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D)
           of Intersectin.  Intersectins (ITSNs) are adaptor
           proteins that function in exo- and endocytosis, actin
           cytoskeletal reorganization, and signal transduction.
           They are essential for initiating clathrin-coated pit
           formation. They bind to many proteins through their
           multidomain structure and facilitate the assembly of
           multimeric complexes. Vertebrates contain two ITSN
           proteins, ITSN1 and ITSN2, which exist in alternatively
           spliced short and long isoforms. The short isoforms
           contain two Eps15 homology domains (EH1 and EH2), a
           coiled-coil region and five SH3 domains (SH3A-E), while
           the long isoforms, in addition, contain RhoGEF (also
           called Dbl-homologous or DH), Pleckstrin homology (PH)
           and C2 domains. ITSN1 and ITSN2 are both widely
           expressed, with variations depending on tissue type and
           stage of development. The fourth SH3 domain (or SH3D) of
           ITSN1 has been shown to bind SHIP2, Numb, CdGAP, and
           N-WASP. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 58

 Score = 30.8 bits (70), Expect = 0.090
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 203 DFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDER 240
            F  T  NQL L  G  V+V  K     GWW+G++  R
Sbjct: 7   PFTATAENQLSLAVGQLVLVRKKSP--SGWWEGELQAR 42


>gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in
           hematopoietic SH2 (HSH2) protein.  HSH2 is thought to
           function as an adapter protein involved in tyrosine
           kinase signaling. It may also be involved in regulating
           cytokine signaling and cytoskeletal reorganization in
           hematopoietic cells. HSH2 contains several putative
           protein-binding motifs, SH3-binding proline-rich
           regions, and phosphotyrosine sites, but lacks enzymatic
           motifs. HSH2 was found to interact with
           cytokine-regulated tyrosine kinase c-FES and an
           activated Cdc42-associated tyrosine kinase ACK1. HSH2
           binds c-FES through both its C-terminal region and its
           N-terminal region including the SH2 domain and binds
           ACK1 via its N-terminal proline-rich region. Both
           kinases bound and tyrosine-phosphorylated HSH2 in
           mammalian cells.  In general SH2 domains are involved in
           signal transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 102

 Score = 31.8 bits (72), Expect = 0.091
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV 144
           WF G + RE A ++LE +  G++L+R+     +H +   Y LS K     +H  V
Sbjct: 9   WFHGAISREAAENMLESQPLGSFLIRV-----SH-SHVGYTLSYKAQSSCRHFMV 57


>gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B
           adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B1 (SH2-B,
           PSM), like other members of the SH2B adapter protein
           family, contains a pleckstrin homology domain, at least
           one dimerization domain, and a C-terminal SH2 domain
           which binds to phosphorylated tyrosines in a variety of
           tyrosine kinases.  SH2B1 and SH2B2  function in
           signaling pathways found downstream of growth hormone
           receptor and receptor tyrosine kinases, including the
           insulin, insulin-like growth factor-I (IGF-I),
           platelet-derived growth factor (PDGF), nerve growth
           factor, hepatocyte growth factor, and fibroblast growth
           factor receptors. SH2B2beta, a new isoform of SH2B2, is
           an endogenous inhibitor of SH2B1 and/or SH2B2
           (SH2B2alpha), negatively regulating insulin signaling
           and/or JAK2-mediated cellular responses. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 97

 Score = 31.5 bits (71), Expect = 0.10
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 12/89 (13%)

Query: 85  LSEYLWFVGEMGREKATSLL---EREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKH 141
           LS Y WF G + R KA  L+      + G +L+R   Q  T   E  Y L+     K KH
Sbjct: 5   LSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVR---QSETRRGE--YVLTFNFQGKAKH 59

Query: 142 MKVYEKEMDGVPQYFLSQSRYFRSIVELI 170
           +++   E +G  +    Q  +F+SI +++
Sbjct: 60  LRLSLNE-EGQCRV---QHLWFQSIFDML 84


>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing
           Adaptor Molecule 2.  STAM2, also called EAST (Epidermal
           growth factor receptor-associated protein with SH3 and
           TAM domain) or Hbp (Hrs binding protein), is part of the
           endosomal sorting complex required for transport
           (ESCRT-0). It plays a role in sorting mono-ubiquinated
           endosomal cargo for trafficking to the lysosome for
           degradation. It is also involved in the regulation of
           exocytosis. STAMs were discovered as proteins that are
           highly phosphorylated following cytokine and growth
           factor stimulation. They function in cytokine signaling
           and surface receptor degradation, as well as regulate
           Golgi morphology. They associate with many proteins
           including Jak2 and Jak3 tyrosine kinases, Hrs, AMSH, and
           UBPY. STAM adaptor proteins contain VHS (Vps27, Hrs,
           STAM homology), ubiquitin interacting (UIM), and SH3
           domains. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 57

 Score = 30.4 bits (68), Expect = 0.11
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A +DF   E N+L  K G  +IVL  +     WWKG+    V  F
Sbjct: 6   ALYDFEAVEDNELTFKHGEIIIVL--DDSDANWWKGENHRGVGLF 48


>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive
           eXchange factor.  Beta-PIX, also called Rho guanine
           nucleotide exchange factor 7 (ARHGEF7) or Cool (Cloned
           out of Library)-1, activates small GTPases by exchanging
           bound GDP for free GTP. It acts as a GEF for both Cdc42
           and Rac 1, and plays important roles in regulating
           neuroendocrine exocytosis, focal adhesion maturation,
           cell migration, synaptic vesicle localization, and
           insulin secretion. PIX proteins contain an N-terminal
           SH3 domain followed by RhoGEF (also called
           Dbl-homologous or DH) and Pleckstrin Homology (PH)
           domains, and a C-terminal leucine-zipper domain for
           dimerization. The SH3 domain of PIX binds to an atypical
           PxxxPR motif in p21-activated kinases (PAKs) with high
           affinity. The binding of PAKs to PIX facilitate the
           localization of PAKs to focal complexes and also
           localizes PAKs to PIX targets Cdc43 and Rac, leading to
           the activation of PAKs. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 54

 Score = 30.4 bits (68), Expect = 0.11
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A+F+F  T  ++L   +G  VI +++  E+ GWW+G  + R  +F
Sbjct: 4   AKFNFQQTNEDELSFSKG-DVIHVTRV-EEGGWWEGTHNGRTGWF 46


>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating
           of p53 proteins (ASPP).  The ASPP family of proteins
           bind to important regulators of apoptosis (p53, Bcl-2,
           and RelA) and cell growth (APCL, PP1). They share
           similarity at their C-termini, where they harbor a
           proline-rich region, four ankyrin (ANK) repeats, and an
           SH3 domain. Vertebrates contain three members of the
           family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2
           activate the apoptotic function of the p53 family of
           tumor suppressors (p53, p63, and p73), while iASPP is an
           oncoprotein that specifically inhibits p53-induced
           apoptosis. The expression of ASPP proteins is altered in
           tumors; ASPP1 and ASPP2 are downregulated whereas iASPP
           is upregulated is some cancer types. ASPP proteins also
           bind and regulate protein phosphatase 1 (PP1), and this
           binding is competitive with p53 binding. The SH3 domain
           and the ANK repeats of ASPP contribute to the p53
           binding site; they bind to the DNA binding domain of
           p53. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 57

 Score = 30.4 bits (69), Expect = 0.11
 Identities = 11/45 (24%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGE-QKGWWKGKIDERVSY 243
           A FD+     ++L  ++G ++ VL K  + +  WW  +++++  Y
Sbjct: 5   ALFDYEAENGDELSFREGDELTVLRKGDDDETEWWWARLNDKEGY 49


>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and
           Casein kinase Substrate in Neurons 3 (PACSIN3).  PACSIN
           3 or Syndapin III (Synaptic dynamin-associated protein
           III) is expressed ubiquitously and regulates glucose
           uptake in adipocytes through its role in GLUT1
           trafficking. It also modulates the subcellular
           localization and stimulus-specific function of the
           cation channel TRPV4. PACSINs act as regulators of
           cytoskeletal and membrane dynamics. Vetebrates harbor
           three isoforms with distinct expression patterns and
           specific functions. PACSINs contain an N-terminal F-BAR
           domain and a C-terminal SH3 domain. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 56

 Score = 30.3 bits (68), Expect = 0.12
 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKI 237
           A +D+   EA++L  K G +++ + +E EQ GW KG++
Sbjct: 6   ALYDYTGQEADELSFKAGEELLKIGEEDEQ-GWCKGRL 42


>gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine
           Kinase, Abelson kinase.  Abl (or c-Abl) is a
           ubiquitously-expressed cytoplasmic (or nonreceptor) PTK
           that contains SH3, SH2, and tyr kinase domains in its
           N-terminal region, as well as nuclear localization
           motifs, a putative DNA-binding domain, and F- and
           G-actin binding domains in its C-terminal tail. It also
           contains a short autoinhibitory cap region in its
           N-terminus. Abl function depends on its subcellular
           localization. In the cytoplasm, Abl plays a role in cell
           proliferation and survival. In response to DNA damage or
           oxidative stress, Abl is transported to the nucleus
           where it induces apoptosis. In chronic myelogenous
           leukemia (CML) patients, an aberrant translocation
           results in the replacement of the first exon of Abl with
           the BCR (breakpoint cluster region) gene. The resulting
           BCR-Abl fusion protein is constitutively active and
           associates into tetramers, resulting in a hyperactive
           kinase sending a continuous signal. This leads to
           uncontrolled proliferation, morphological transformation
           and anti-apoptotic effects. BCR-Abl is the target of
           selective inhibitors, such as imatinib (Gleevec), used
           in the treatment of CML. Abl2, also known as ARG
           (Abelson-related gene), is thought to play a cooperative
           role with Abl in the proper development of the nervous
           system. The Tel-ARG fusion protein, resulting from
           reciprocal translocation between chromosomes 1 and 12,
           is associated with acute myeloid leukemia (AML). SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 56

 Score = 30.5 bits (69), Expect = 0.12
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVL--SKEGE 228
           VA +DF  +  NQL +K+G Q+ VL  +K GE
Sbjct: 3   VALYDFVASGENQLSIKKGEQLRVLGYNKNGE 34


>gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in
           suppressor of cytokine signaling (SOCS) proteins.  SH2
           domain found in SOCS proteins. SOCS was first recognized
           as a group of cytokine-inducible SH2 (CIS) domain
           proteins comprising eight family members in human (CIS
           and SOCS1-SOCS7). In addition to the SH2 domain, SOCS
           proteins have a variable N-terminal domain and a
           conserved SOCS box in the C-terminal domain. SOCS
           proteins bind to a substrate via their SH2 domain. The
           prototypical members, CIS and SOCS1-SOCS3, have been
           shown to regulate growth hormone signaling in vitro and
           in a classic negative feedback response compete for
           binding at phosphotyrosine sites in JAK kinase and
           receptor pathways to displace effector proteins and
           target bound receptors for proteasomal degradation. Loss
           of SOCS activity results in excessive cytokine signaling
           associated with a variety of hematopoietic, autoimmune,
           and inflammatory diseases and certain cancers. Members
           (SOCS4-SOCS7) were identified by their conserved SOCS
           box, an adapter motif of 3 helices that associates
           substrate binding domains, such as the SOCS SH2 domain,
           ankryin, and WD40 with ubiquitin ligase components.
           These show limited cytokine induction. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 100

 Score = 31.3 bits (71), Expect = 0.13
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 6/94 (6%)

Query: 84  NLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMK 143
            L++  W+ G + R +A   L    DG++L+R      +  +  + +LS ++  K  H +
Sbjct: 6   KLAKQGWYWGPITRWEAEGKLANVPDGSFLVR-----DSSDDRYLLSLSFRSHGKTLHTR 60

Query: 144 VYEKEMDGVPQYFLSQSRYFRSIVELICCYERNS 177
           + E        Y         SIV+LI    R+S
Sbjct: 61  I-EHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDS 93


>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase
           Activating Proteins 1, 2, and 3.  srGAP1, also called
           Rho GTPase-Activating Protein 13 (ARHGAP13), is a Cdc42-
           and RhoA-specific GAP and is expressed later in the
           development of central nervous system tissues. srGAP2 is
           expressed in zones of neuronal differentiation. It plays
           a role in the regeneration of neurons and axons. srGAP3,
           also called MEGAP (MEntal disorder associated
           GTPase-Activating Protein), is a Rho GAP with activity
           towards Rac1 and Cdc42. It impacts cell migration by
           regulating actin and microtubule cytoskeletal dynamics.
           The association between srGAP3 haploinsufficiency and
           mental retardation is under debate. srGAPs are Rho GAPs
           that interact with Robo1, the transmembrane receptor of
           Slit proteins. Slit proteins are secreted proteins that
           control axon guidance and the migration of neurons and
           leukocytes. srGAPs contain an N-terminal F-BAR domain, a
           Rho GAP domain, and a C-terminal SH3 domain. SH3 domains
           are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 29.9 bits (67), Expect = 0.14
 Identities = 11/39 (28%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           A+A+FD+    A +L  K+G  +++  +  +   WW+G+
Sbjct: 2   AIAKFDYVGRSARELSFKKGASLLLYHRASDD--WWEGR 38


>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase
           Activating Protein 4.  srGAP4, also called ARHGAP4, is
           highly expressed in hematopoietic cells and may play a
           role in lymphocyte differentiation. It is able to
           stimulate the GTPase activity of Rac1, Cdc42, and RhoA.
           In the nervous system, srGAP4 has been detected in
           differentiating neurites and may be involved in axon and
           dendritic growth. srGAPs are Rho GAPs that interact with
           Robo1, the transmembrane receptor of Slit proteins. Slit
           proteins are secreted proteins that control axon
           guidance and the migration of neurons and leukocytes.
           srGAPs contain an N-terminal F-BAR domain, a Rho GAP
           domain, and a C-terminal SH3 domain. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 55

 Score = 29.8 bits (67), Expect = 0.17
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKI 237
           AVA FD+    A +L  K+G  +++ SK      WW+G+ 
Sbjct: 4   AVACFDYTGRTAQELSFKRGDVLLLHSKASSD--WWRGEH 41


>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine
           Kinase.  Lck is a member of the Src subfamily of
           proteins, which are cytoplasmic (or non-receptor) PTKs.
           Lck is expressed in T-cells and natural killer cells. It
           plays a critical role in T-cell maturation, activation,
           and T-cell receptor (TCR) signaling. Lck phosphorylates
           ITAM (immunoreceptor tyr activation motif) sequences on
           several subunits of TCRs, leading to the activation of
           different second messenger cascades. Phosphorylated
           ITAMs serve as binding sites for other signaling factor
           such as Syk and ZAP-70, leading to their activation and
           propagation of downstream events. In addition, Lck
           regulates drug-induced apoptosis by interfering with the
           mitochondrial death pathway. The apototic role of Lck is
           independent of its primary function in T-cell signaling.
           Src kinases contain an N-terminal SH4 domain with a
           myristoylation site, followed by SH3 and SH2 domains, a
           tyr kinase domain, and a regulatory C-terminal region
           containing a conserved tyr. They are activated by
           autophosphorylation at the tyr kinase domain, but are
           negatively regulated by phosphorylation at the
           C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
           domain of Src kinases contributes to substrate
           recruitment by binding adaptor proteins/substrates, and
           regulation of kinase activity through an intramolecular
           interaction. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 54

 Score = 29.8 bits (67), Expect = 0.17
 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           VA + + P+    L  ++G ++ +L + GE   WWK +
Sbjct: 3   VALYSYEPSHDGDLGFEKGEKLRILEQSGE---WWKAQ 37


>gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis
           Stimulating of p53 protein 2.  ASPP2 is the full length
           form of the previously-identified tumor supressor,
           p53-binding protein 2 (p53BP2). ASPP2 activates the
           apoptotic function of the p53 family of tumor
           suppressors (p53, p63, and p73). It plays a central role
           in regulating apoptosis and cell growth; ASPP2-deficient
           mice show postnatal death. Downregulated expression of
           ASPP2 is frequently found in breast tumors, lung cancer,
           and diffuse large B-cell lymphoma where it is correlated
           with a poor clinical outcome. ASPP2 contains a
           proline-rich region, four ankyrin (ANK) repeats, and an
           SH3 domain at its C-terminal half. The SH3 domain and
           the ANK repeats of ASPP2 contribute to the p53 binding
           site; they bind to the DNA binding domain of p53. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 57

 Score = 29.9 bits (67), Expect = 0.18
 Identities = 10/45 (22%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 200 AEFDFCPTEANQLPLKQG-CQVIVLSKEGEQKGWWKGKIDERVSY 243
           A +D+     ++L  K+G C  I+  ++ ++  WW  +++++  Y
Sbjct: 5   ALWDYEGESDDELSFKEGDCMTILRREDEDETEWWWARLNDKEGY 49


>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9
           and similar proteins.  Sorting nexins (SNXs) are Phox
           homology (PX) domain containing proteins that are
           involved in regulating membrane traffic and protein
           sorting in the endosomal system. SNXs differ from each
           other in their lipid-binding specificity, subcellular
           localization and specific function in the endocytic
           pathway. This subfamily consists of SH3 domain
           containing SNXs including SNX9, SNX18, SNX33, and
           similar proteins. SNX9 is localized to plasma membrane
           endocytic sites and acts primarily in clathrin-mediated
           endocytosis, while SNX18 is localized to peripheral
           endosomal structures, and acts in a trafficking pathway
           that is clathrin-independent but relies on AP-1 and
           PACS1. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 55

 Score = 30.0 bits (68), Expect = 0.18
 Identities = 10/37 (27%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           A +DF    + +L L+ G +V+ ++++    GW +G+
Sbjct: 4   ALYDFDSQPSGELSLRAG-EVLTITRQDVGDGWLEGR 39


>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain.  SH3 (Src homology 3) domains
           are often indicative of a protein involved in signal
           transduction related to cytoskeletal organisation. First
           described in the Src cytoplasmic tyrosine kinase. The
           structure is a partly opened beta barrel.
          Length = 53

 Score = 29.7 bits (68), Expect = 0.21
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
               FD+  T+ N+L LK+G  V VL K+    GWW+G+   R    
Sbjct: 2   GRVIFDYVATDPNELSLKKGDVVKVLDKDDN--GWWEGERGGRRGLV 46


>gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated
           Phosphoprotein 1.  SKAP1, also called SKAP55 (Src
           kinase-associated protein of 55kDa), is an immune
           cell-specific adaptor protein that plays an important
           role in T-cell adhesion, migration, and integrin
           clustering. It is expressed exclusively in
           T-lymphocytes, mast cells, and macrophages. Binding
           partners include ADAP (adhesion and
           degranulation-promoting adaptor protein), Fyn, Riam,
           RapL, and RasGRP. It contains a pleckstrin homology (PH)
           domain, a C-terminal SH3 domain, and several tyrosine
           phosphorylation sites. The SH3 domain of SKAP1 is
           necessary for its ability to regulate T-cell conjugation
           with antigen-presenting cells and the formation of LFA-1
           clusters. SKAP1 binds primarily to a proline-rich region
           of ADAP through its SH3 domain; its degradation is
           regulated by ADAP. A secondary interaction occurs via
           the ADAP SH3 domain and the RKxxYxxY motif in SKAP1. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 29.4 bits (66), Expect = 0.23
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 208 EANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERV 241
             ++L  ++G  + +LSKE    GWW G+++  V
Sbjct: 12  NPDELSFQRGDLIYILSKEYNMYGWWVGELNGIV 45


>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of
           CD2-associated protein.  CD2AP, also called CMS (Cas
           ligand with Multiple SH3 domains) or METS1
           (Mesenchyme-to-Epithelium Transition protein with SH3
           domains), is a cytosolic adaptor protein that plays a
           role in regulating the cytoskeleton. It is critical in
           cell-to-cell union necessary for kidney function. It
           also stabilizes the contact between a T cell and
           antigen-presenting cells. It is primarily expressed in
           podocytes at the cytoplasmic face of the slit diaphragm
           and serves as a linker anchoring podocin and nephrin to
           the actin cytoskeleton. CD2AP contains three SH3
           domains, a proline-rich region, and a C-terminal
           coiled-coil domain. All of these domains enable CD2AP to
           bind various protein partners and assemble complexes
           that have been implicated in many different functions.
           This alignment model represents the second SH3 domain
           (SH3B) of CD2AP. SH3B binds to c-Cbl in a site (TPSSRPLR
           is the core binding motif) distinct from the c-Cbl/SH3A
           binding site. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 29.6 bits (66), Expect = 0.25
 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 202 FDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           F++ P   ++L LK G  +I +++E E+ GWW G ++ +   F
Sbjct: 7   FEYVPQNEDELELKVG-DIIDINEEVEE-GWWSGTLNGKSGLF 47


>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth
           factor receptor-bound protein 2.  GRB2 is a critical
           signaling molecule that regulates the Ras pathway by
           linking tyrosine kinases to the Ras guanine nucleotide
           releasing protein Sos (son of sevenless), which converts
           Ras to the active GTP-bound state. It is ubiquitously
           expressed in all tissues throughout development and is
           important in cell cycle progression, motility,
           morphogenesis, and angiogenesis. In lymphocytes, GRB2 is
           associated with antigen receptor signaling components.
           GRB2 contains an N-terminal SH3 domain, a central SH2
           domain, and a C-terminal SH3 domain. Its N-terminal SH3
           domain binds to Sos and Sos-derived proline-rich
           peptides. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 56

 Score = 29.6 bits (66), Expect = 0.25
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID 238
           A+A++DF  T  ++L  K+G  + VL++E +Q  W+K +++
Sbjct: 3   AIAKYDFKATADDELSFKRGDILKVLNEECDQN-WYKAELN 42


>gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2 domain
           containing protein 4A (SH2D4A).  SH2D4A contains a
           single SH2 domain. In general SH2 domains are involved
           in signal transduction.  They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 103

 Score = 30.7 bits (69), Expect = 0.27
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 10/54 (18%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRI--RPQGPTHPNETIYALSLKTDEKVKH 141
           WF G +  +KA  LL     G++L+R+  + +G        YALS  ++E  KH
Sbjct: 9   WFHGILTLKKANELLLSTMPGSFLIRVSEKIKG--------YALSYLSEEGCKH 54


>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in
           suppressor of cytokine signaling (SOCS) family.  SH2
           domain found in SOCS proteins. SOCS was first recognized
           as a group of cytokine-inducible SH2 (CIS) domain
           proteins comprising eight family members in human (CIS
           and SOCS1-SOCS7). In addition to the SH2 domain, SOCS
           proteins have a variable N-terminal domain and a
           conserved SOCS box in the C-terminal domain. SOCS
           proteins bind to a substrate via their SH2 domain. The
           prototypical members, CIS and SOCS1-SOCS3, have been
           shown to regulate growth hormone signaling in vitro and
           in a classic negative feedback response compete for
           binding at phosphotyrosine sites in JAK kinase and
           receptor pathways to displace effector proteins and
           target bound receptors for proteasomal degradation. Loss
           of SOCS activity results in excessive cytokine signaling
           associated with a variety of hematopoietic, autoimmune,
           and inflammatory diseases and certain cancers. Members
           (SOCS4-SOCS7) were identified by their conserved SOCS
           box, an adapter motif of 3 helices that associates
           substrate binding domains, such as the SOCS SH2 domain,
           ankryin, and WD40 with ubiquitin ligase components.
           These show limited cytokine induction. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 81

 Score = 29.9 bits (68), Expect = 0.29
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 19/88 (21%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKV-YEKE 148
           W+ G + R +A  LL  + +GT+L+R         +  ++++S +T  +  H ++ Y   
Sbjct: 2   WYWGGITRYEAEELLAGKPEGTFLVRDSSD-----SRYLFSVSFRTYGRTLHARIEY--- 53

Query: 149 MDGVPQYFLSQS------RYFRSIVELI 170
                    S          F  +VELI
Sbjct: 54  ----SNGRFSFDSSDPSVPRFPCVVELI 77


>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C
           and Casein kinase Substrate in Neurons 1 (PACSIN1) and
           PACSIN 2.  PACSIN 1 or Syndapin I (Synaptic
           dynamin-associated protein I) is expressed specifically
           in the brain and is localized in neurites and synaptic
           boutons. It binds the brain-specific proteins dynamin I,
           synaptojanin, synapsin I, and neural Wiskott-Aldrich
           syndrome protein (nWASP), and functions as a link
           between the cytoskeletal machinery and synaptic vesicle
           endocytosis. PACSIN 1 interacts with huntingtin and may
           be implicated in the neuropathology of Huntington's
           disease. PACSIN 2 or Syndapin II is expressed
           ubiquitously and is involved in the regulation of
           tubulin polymerization. It associates with Golgi
           membranes and forms a complex with dynamin II which is
           crucial in promoting vesicle formation from the
           trans-Golgi network. PACSINs act as regulators of
           cytoskeletal and membrane dynamics. Vetebrates harbor
           three isoforms with distinct expression patterns and
           specific functions. PACSINs contain an N-terminal F-BAR
           domain and a C-terminal SH3 domain. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 56

 Score = 29.1 bits (65), Expect = 0.34
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKID 238
           A +D+   E ++L  K G ++  L  E EQ GW KG++D
Sbjct: 5   ALYDYDGQEQDELSFKAGDELTKLEDEDEQ-GWCKGRLD 42


>gnl|CDD|198175 cd09919, SH2_STAT_family, Src homology 2 (SH2) domain found in
           signal transducer and activator of transcription (STAT)
           family.  STAT proteins mediate the signaling of
           cytokines and a number of growth factors from the
           receptors of these extracellular signaling molecules to
           the cell nucleus.  STATs are specifically phosphorylated
           by receptor-associated Janus kinases, receptor tyrosine
           kinases, or cytoplasmic tyrosine kinases. The
           phosphorylated STAT molecules dimerize by reciprocal
           binding of their SH2 domains to the phosphotyrosine
           residues. These dimeric STATs translocate into the
           nucleus, bind to specific DNA sequences, and regulate
           the transcription of their target genes.  However there
           are a number of unphosphorylated STATs that travel
           between the cytoplasm and nucleus and some STATs that
           exist as dimers in unstimulated cells that can exert
           biological functions independent of being activated by a
           receptor. There are seven mammalian STAT family members
           which have been identified: STAT1, STAT2, STAT3, STAT4,
           STAT5 (STAT5A and STAT5B), and STAT6. There are 6
           conserved domains in STAT: N-terminal domain (NTD),
           coiled-coil domain (CCD), DNA-binding domain (DBD),
           alpha-helical linker domain (LD), SH2 domain, and
           transactivation domain (TAD).  NTD is involved in
           dimerization of unphosphorylated STATs monomers and for
           the tetramerization between STAT1, STAT3, STAT4 and
           STAT5 on promoters with two or more tandem STAT binding
           sites.  It also plays a role in promoting interactions
           with transcriptional co-activators such as CREB binding
           protein (CBP)/p300, as well as being important for
           nuclear import and deactivation of STATs involving
           tyrosine de-phosphorylation. The CCD interacts with
           other proteins, such as IFN regulatory protein 9
           (IRF-9/p48) with STAT1 and c-JUN with STAT3 and is also
           thought to participate in the negative regulation of
           these proteins. Distinct genes are bound to STATs via
           their DBD domain. This domain is also involved in
           nuclear translocation of activated STAT1 and STAT3
           phosphorylated dimers upon cytokine stimulation.  LD
           links the DNA-binding and SH2 domains and is important
           for the transcriptional activation of STAT1 in response
           to IFN-gamma. It also plays a role in protein-protein
           interactions and has also been implicated in the
           constitutive nucleocytoplasmic shuttling of
           unphosphorylated STATs in resting cells.  The SH2 domain
           is necessary for receptor association and tyrosine
           phosphodimer formation. Residues within this domain may
           be particularly important for some cellular functions
           mediated by the STATs as well as residues adjacent to
           this domain.  The TAD interacts with several proteins,
           namely minichromosome maintenance complex component 5
           (MCM5), breast cancer 1 (BRCA1) and CBP/p300. TAD also
           contains a modulatory phosphorylation site that
           regulates STAT activity and is necessary for maximal
           transcription of a number of target genes. The conserved
           tyrosine residue present in the C-terminus is crucial
           for dimerization via interaction with the SH2 domain
           upon the interaction of the ligand with the receptor.
           STAT activation by tyrosine phosphorylation also
           determines nuclear import and retention, DNA binding to
           specific DNA elements in the promoters of responsive
           genes, and transcriptional activation of STAT dimers. In
           addition to the SH2 domain there is a coiled-coil
           domain, a DNA binding domain, and a transactivation
           domain in the STAT proteins. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 115

 Score = 30.2 bits (69), Expect = 0.40
 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 89  LWF----VGEMGREKATSLLEREADGTYLLR 115
           LW     +G + +E+A  LL+++  GT+LLR
Sbjct: 16  LWQDGLIMGFISKEEAEDLLKKKPPGTFLLR 46


>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding
           protein Eve-1.  Eve-1, also called SH3 domain-containing
           protein 19 (SH3D19) or EEN-binding protein (EBP), exists
           in multiple alternatively spliced isoforms. The longest
           isoform contains five SH3 domain in the C-terminal
           region and seven proline-rich motifs in the N-terminal
           region. It is abundantly expressed in skeletal muscle
           and heart, and may be involved in regulating the
           activity of ADAMs (A disintegrin and metalloproteases).
           Eve-1 interacts with EEN, an endophilin involved in
           endocytosis and may be the target of the MLL-EEN fusion
           protein that is implicated in leukemogenesis. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 51

 Score = 28.5 bits (64), Expect = 0.42
 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
            VA FDF   + ++L   +G  + +    GE+  W KG+++ ++  F
Sbjct: 2   CVARFDFEGEQEDELSFSEGDVITLKEYVGEE--WAKGELNGKIGIF 46


>gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated
           Phosphoprotein 2.  SKAP2, also called SKAP55-Related
           (SKAP55R) or SKAP55 homolog (SKAP-HOM or SKAP55-HOM), is
           an immune cell-specific adaptor protein that plays an
           important role in adhesion and migration of B-cells and
           macrophages. Binding partners include ADAP (adhesion and
           degranulation-promoting adaptor protein), YopH, SHPS1,
           and HPK1. SKAP2 has also been identified as a substrate
           for lymphoid-specific tyrosine phosphatase (Lyp), which
           has been implicated in a wide variety of autoimmune
           diseases. It contains a pleckstrin homology (PH) domain,
           a C-terminal SH3 domain, and several tyrosine
           phosphorylation sites. Like SKAP1, SKAP2 is expected to
           bind primarily to a proline-rich region of ADAP through
           its SH3 domain; its degradation may be regulated by
           ADAP. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 28.7 bits (64), Expect = 0.52
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 210 NQLPLKQGCQVIVLSKEGEQKGWWKGKI 237
           ++L  K+G  + +LSKE  + GWW G++
Sbjct: 14  DELSFKRGDTIYILSKEYNRFGWWVGEM 41


>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth
           factor receptor-bound protein 2.  GRB2 is a critical
           signaling molecule that regulates the Ras pathway by
           linking tyrosine kinases to the Ras guanine nucleotide
           releasing protein Sos (son of sevenless), which converts
           Ras to the active GTP-bound state. It is ubiquitously
           expressed in all tissues throughout development and is
           important in cell cycle progression, motility,
           morphogenesis, and angiogenesis. In lymphocytes, GRB2 is
           associated with antigen receptor signaling components.
           GRB2 contains an N-terminal SH3 domain, a central SH2
           domain, and a C-terminal SH3 domain. The C-terminal SH3
           domain of GRB2 binds to Gab2 (Grb2-associated binder 2)
           through epitopes containing RxxK motifs, as well as to
           the proline-rich C-terminus of FGRF2. SH3 domains are
           protein interaction domains that typically bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 28.7 bits (64), Expect = 0.55
 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           A FDF P E  +L  ++G  + V+  +     WWKG    +   F
Sbjct: 4   ALFDFDPQEDGELGFRRGDFIEVM--DNSDPNWWKGACHGQTGMF 46


>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing
           Adaptor Molecules.  STAMs were discovered as proteins
           that are highly phosphorylated following cytokine and
           growth factor stimulation. They function in cytokine
           signaling and surface receptor degradation, as well as
           regulate Golgi morphology. They associate with many
           proteins including Jak2 and Jak3 tyrosine kinases, Hrs,
           AMSH, and UBPY. STAM adaptor proteins contain VHS
           (Vps27, Hrs, STAM homology), ubiquitin interacting
           (UIM), and SH3 domains. There are two vertebrate STAMs,
           STAM1 and STAM2, which may be functionally redundant;
           vertebrate STAMs contain ITAM motifs. They are part of
           the endosomal sorting complex required for transport
           (ESCRT-0). STAM2 deficiency in mice did not cause any
           obvious abnormality, while STAM1 deficiency resulted in
           growth retardation. Loss of both STAM1 and STAM2 in mice
           proved lethal, indicating that STAMs are important for
           embryonic development. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 54

 Score = 28.2 bits (63), Expect = 0.80
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           A +DF   E N+L  K G  + VL  +     WWKG 
Sbjct: 5   ALYDFEAAEDNELTFKAGEIITVL--DDSDPNWWKGS 39


>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and
           SH3 domain containing 2 (Sorbs2), also called
           Arg-binding protein 2 (ArgBP2).  Sorbs2 or ArgBP2 is an
           adaptor protein containing one sorbin homology (SoHo)
           and three SH3 domains. It regulates actin-dependent
           processes including cell adhesion, morphology, and
           migration. It is expressed in many tissues and is
           abundant in the heart. Like vinexin, it is found in
           focal adhesion where it interacts with vinculin and
           afadin. It also localizes in epithelial cell stress
           fibers and in cardiac muscle cell Z-discs. Sorbs2 has
           been implicated to play roles in the signaling of c-Arg,
           Akt, and Pyk2. Other interaction partners of Sorbs2
           include c-Abl, flotillin, spectrin, dynamin 1/2,
           synaptojanin, PTP-PEST, among others. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 57

 Score = 28.0 bits (62), Expect = 0.81
 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKI 237
           AVA+++F      +L L++G +V++L +    + W++GKI
Sbjct: 3   AVAKYNFNADTNVELSLRKGDRVVLLKQ--VDQNWYEGKI 40


>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding
           protein Eve-1.  Eve-1, also called SH3 domain-containing
           protein 19 (SH3D19) or EEN-binding protein (EBP), exists
           in multiple alternatively spliced isoforms. The longest
           isoform contains five SH3 domain in the C-terminal
           region and seven proline-rich motifs in the N-terminal
           region. It is abundantly expressed in skeletal muscle
           and heart, and may be involved in regulating the
           activity of ADAMs (A disintegrin and metalloproteases).
           Eve-1 interacts with EEN, an endophilin involved in
           endocytosis and may be the target of the MLL-EEN fusion
           protein that is implicated in leukemogenesis. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 50

 Score = 27.8 bits (62), Expect = 0.85
 Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           AVA +DF       L  ++G +++V      +  W +G+++ R   F
Sbjct: 2   AVALYDFTGETEEDLSFQRGDRILVTEHLDAE--WSRGRLNGREGIF 46


>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine
           nucleotide Exchange Factor 2.  ASEF2, also called
           Spermatogenesis-associated protein 13 (SPATA13), is a
           GEF that localizes with actin at the leading edge of
           cells and is important in cell migration and adhesion
           dynamics. GEFs activate small GTPases by exchanging
           bound GDP for free GTP. ASEF2 can activate both Rac 1
           and Cdc42, but only Rac1 activation is necessary for
           increased cell migration and adhesion turnover. Together
           with APC (adenomatous polyposis coli) and Neurabin2, a
           scaffold protein that binds F-actin, it is involved in
           regulating HGF-induced cell migration. ASEF2 contains a
           SH3 domain followed by RhoGEF (also called
           Dbl-homologous or DH) and Pleckstrin Homology (PH)
           domains. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 54

 Score = 27.7 bits (61), Expect = 0.93
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           + A A +D    +  +L  K G  + VL  E   K WW G+ ++R ++F
Sbjct: 1   VYAEALWDHVTMDDQELAFKAGDVIRVL--EASNKDWWWGRNEDREAWF 47


>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of
           the p67phox subunit of NADPH oxidase and similar
           proteins.  This subfamily is composed of p67phox, NADPH
           oxidase activator 1 (Noxa1), and similar proteins.
           p67phox, also called Neutrophil cytosol factor 2
           (NCF-2), and Noxa1 are homologs and are the cytosolic
           subunits of the phagocytic (Nox2) and nonphagocytic
           (Nox1) NADPH oxidase complexes, respectively. NADPH
           oxidase catalyzes the transfer of electrons from NADPH
           to oxygen during phagocytosis forming superoxide and
           reactive oxygen species. p67phox and Noxa1 play
           regulatory roles. p67phox contains N-terminal TPR, first
           SH3 (or N-terminal or central SH3), PB1, and C-terminal
           SH3 domains. Noxa1 has a similar domain architecture
           except it is lacking the N-terminal SH3 domain. The TPR
           domain of both binds activated GTP-bound Rac, while the
           C-terminal SH3 domain of p67phox and Noxa1 binds the
           polyproline motif found at the C-terminus of p47phox and
           Noxo1, respectively. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 27.9 bits (62), Expect = 1.0
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
           VA   +       L  ++G  + VLS+  E   W +G  D RV  F + +
Sbjct: 3   VALHRYEAQGPEDLGFREGDTIDVLSEVNEA--WLEGHSDGRVGIFPKCF 50


>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of
           Cbl-interacting protein of 85 kDa.  CIN85, also called
           SH3 domain-containing kinase-binding protein 1 (SH3KBP1)
           or CD2-binding protein 3 (CD2BP3) or Ruk, is an adaptor
           protein that is involved in the downregulation of
           receptor tyrosine kinases by facilitating endocytosis
           through interaction with endophilin-associated ubiquitin
           ligase Cbl proteins. It is also important in many other
           cellular processes including vesicle-mediated transport,
           cytoskeletal remodelling, apoptosis, cell adhesion and
           migration, and viral infection, among others. CIN85
           exists as multiple variants from alternative splicing;
           the main variant contains three SH3 domains, a
           proline-rich region, and a C-terminal coiled-coil
           domain. All of these domains enable CIN85 to bind
           various protein partners and assemble complexes that
           have been implicated in many different functions. This
           alignment model represents the second SH3 domain (SH3B)
           of CIN85. SH3B has been shown to bind Cbl proline-rich
           peptides and ubiquitin. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 27.7 bits (61), Expect = 1.1
 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 200 AEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
             F + P   ++L LK G  +I +  E E+ GWW+G ++ +   F
Sbjct: 4   VAFSYLPQNEDELELKVG-DIIEVVGEVEE-GWWEGVLNGKTGMF 46


>gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan
           Peroxisomal biogenesis factor 13.  PEX13 is a peroxin
           and is required for protein import into the peroxisomal
           matrix and membrane. It is an integral membrane protein
           that is essential for the localization of PEX14 and the
           import of proteins containing the peroxisome matrix
           targeting signals, PTS1 and PTS2. Mutations of the PEX13
           gene in humans lead to a wide range of peroxisome
           biogenesis disorders (PBDs), the most severe of which is
           known as Zellweger syndrome (ZS), a severe multisystem
           disorder characterized by hypotonia, psychomotor
           retardation, and neuronal migration defects. PEX13
           contains two transmembrane regions and a C-terminal SH3
           domain. SH3 domains are protein interaction domains that
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 58

 Score = 27.6 bits (62), Expect = 1.1
 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQ---KGWWKGKIDERVS 242
           +A AE+DF     ++L  + G   + L+ +  Q   +GW    +D +  
Sbjct: 1   VARAEYDFVAESEDELSFRAG-DKLRLAPKELQPRVRGWLLATVDGQKI 48


>gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2
           domain containing protein 2A and 7 (SH2D2A and SH2D7).
           SH2D2A and SH7 both contain a single SH2 domain. In
           general SH2 domains are involved in signal transduction.
            They typically bind pTyr-containing ligands via two
           surface pockets, a pTyr and hydrophobic binding pocket,
           allowing proteins with SH2 domains to localize to
           tyrosine phosphorylated sites.
          Length = 77

 Score = 28.3 bits (63), Expect = 1.2
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 6/53 (11%)

Query: 89  LWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKH 141
            WF G + R +A  LLE +  G YL+R      T      + LS ++    +H
Sbjct: 1   AWFHGFITRREAERLLEPKPQGCYLVRFSESAVT------FVLSYRSRTCCRH 47


>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and
           SH3 domain containing 1 (Sorbs1), also called ponsin.
           Sorbs1 is also called ponsin, SH3P12, or CAP (c-Cbl
           associated protein). It is an adaptor protein containing
           one sorbin homology (SoHo) and three SH3 domains. It
           binds Cbl and plays a major role in regulating the
           insulin signaling pathway by enhancing insulin-induced
           phosphorylation of Cbl. Sorbs1, like vinexin, localizes
           at cell-ECM and cell-cell adhesion sites where it binds
           vinculin, paxillin, and afadin. It may function in the
           control of cell motility. Other interaction partners of
           Sorbs1 include c-Abl, Sos, flotillin, Grb4, ataxin-7,
           filamin C, among others. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 55

 Score = 27.6 bits (61), Expect = 1.3
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYFFQLY 248
           A A+FDF      +LPL++G  ++ + K+ +Q  W++G+   RV  F + Y
Sbjct: 3   ARAKFDFKAQTLKELPLQKG-DIVYIYKQIDQN-WYEGEHHGRVGIFPRSY 51


>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast
           Cancer Anti-estrogen Resistance protein 3.  BCAR3 is
           part of a growing family of guanine nucleotide exchange
           factors is responsible for activation of Ras-family
           GTPases, including Sos1 and 2, GRF1 and 2,
           CalDAG-GEF/GRP1-4, C3G, cAMP-GEF/Epac 1 and 2, PDZ-GEFs,
           MR-GEF, RalGDS family members, RalGPS, RasGEF, Smg GDS,
           and phospholipase C(epsilon). 12102558  21262352  BCAR3
           binds to the carboxy-terminus of BCAR1/p130Cas, a focal
           adhesion adapter protein.  Over expression of BCAR1
           (p130Cas) and BCAR3 induces estrogen independent growth
           in normally estrogen-dependent cell lines. They have
           been linked to resistance to anti-estrogens in breast
           cancer, Rac activation, and cell motility, though the
           BCAR3/p130Cas complex is not required for this activity
           in BCAR3.  Many BCAR3-mediated signaling events in
           epithelial and mesenchymal cells are independent of
           p130Cas association. Structurally these proteins contain
           a single SH2 domain upstream of their RasGEF domain,
           which is responsible for the ability of BCAR3 to enhance
           p130Cas over-expression-induced migration. In general
           SH2 domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 136

 Score = 28.8 bits (65), Expect = 1.6
 Identities = 28/105 (26%), Positives = 40/105 (38%), Gaps = 25/105 (23%)

Query: 83  ENLSEYLWFVGEMGREKATSLLEREAD----------GTYLLRIRPQG-PTHPNETIYAL 131
           E+L  + W+ G + R+ A SL++RE D          G Y+L  R +G P H       L
Sbjct: 1   EDLRSHAWYHGRIPRQVAESLVQREGDFLVRDSLSSPGDYVLTCRWKGQPLHFKINRVVL 60

Query: 132 SLKTDEKVKHMKVYEKEMDGVPQYFLSQSRYFRSIVELICCYERN 176
                        Y +      QY     + F SI  L+  Y  N
Sbjct: 61  RPSE--------AYTRV-----QYQFEDEQ-FDSIPALVHFYVGN 91


>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain
           of Fungal Actin-binding protein 1.  Abp1 is an adaptor
           protein that functions in receptor-mediated endocytosis
           and vesicle trafficking. It contains an N-terminal
           actin-binding module, the actin-depolymerizing factor
           (ADF) homology domain, a central proline-rich region,
           and a C-terminal SH3 domain (many yeast Abp1 proteins
           contain two C-terminal SH3 domains). Yeast Abp1 also
           contains two acidic domains that bind directly to the
           Arp2/3 complex, which is required to initiate actin
           polymerization. The SH3 domain of yeast Abp1 binds and
           localizes the kinases, Ark1p and Prk1p, which facilitate
           actin patch disassembly following vesicle
           internalization. It also mediates the localization to
           the actin patch of the synaptojanin-like protein, Sjl2p,
           which plays a key role in endocytosis. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 54

 Score = 27.1 bits (60), Expect = 1.7
 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKG 235
           AV  +D+   E N++ L +G  V  +    E   WW G
Sbjct: 2   AVVLYDYEKDEDNEIELVEGEIVTNIEMVDE--DWWMG 37


>gnl|CDD|213743 TIGR02829, spore_III_AE, stage III sporulation protein AE.  A
           comparative genome analysis of all sequenced genomes of
           shows a number of proteins conserved strictly among the
           endospore-forming subset of the Firmicutes. This
           protein, a member of this panel, is found in a spore
           formation operon and is designated stage III sporulation
           protein AE [Cellular processes, Sporulation and
           germination].
          Length = 381

 Score = 29.6 bits (67), Expect = 1.8
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 8/41 (19%)

Query: 225 KEGEQ----KGWWKGKIDERVSYFFQLYWGNFRLLSSLFIV 261
             GE+    K   +      +SY F     N +LL +L I+
Sbjct: 70  LRGEKPFSVKKIGEA----LLSYLFHELLSNGKLLGTLIIL 106


>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2
           domain-bearing protein kinases A and C (ShkA and ShkC). 
           SH2-bearing genes cloned from Dictyostelium include two
           transcription factors, STATa and STATc, and a signaling
           factor, SHK1 (shkA). A database search of the
           Dictyostelium discoideum genome revealed two additional
           putative STAT sequences, dd-STATb and dd-STATd, and four
           additional putative SHK genes, dd-SHK2 (shkB), dd-SHK3
           (shkC), dd-SHK4 (shkD), and dd-SHK5 (shkE). This model
           contains members of shkA and shkC.  All of the SHK
           members are most closely related to the protein kinases
           found in plants.  However these kinases in plants are
           not conjugated to any SH2 or SH2-like sequences.
           Alignment data indicates that the SHK SH2 domains carry
           some features of the STAT SH2 domains in Dictyostelium.
           When STATc's linker domain was used for a BLAST search,
           the sequence between the protein kinase domain and the
           SH2 domain (the linker) of SHK was recovered, suggesting
           a close relationship among these molecules within this
           region. SHK's linker domain is predicted to contain an
           alpha-helix which is indeed homologous to that of STAT.
           Based on the phylogenetic alignment, SH2 domains can be
           grouped into two categories, STAT-type and Src-type. SHK
           family members are in between, but are closer to the
           STAT-type which indicates a close relationship between
           SHK and STAT families in their SH2 domains and further
           supports the notion that SHKs linker-SH2 domain evolved
           from STAT or STATL (STAT-like Linker-SH2) domain found
           in plants. In SHK, STAT, and SPT6, the linker-SH2
           domains all reside exclusively in the C-terminal
           regions. In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 113

 Score = 28.3 bits (63), Expect = 1.9
 Identities = 19/88 (21%), Positives = 37/88 (42%), Gaps = 11/88 (12%)

Query: 84  NLSEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDE-KVKHM 142
            L E  WF G++   ++ + L  + +GT+L+R     P       Y +S  +    + H 
Sbjct: 6   ELMECAWFHGDISTSESENRLNGKPEGTFLVRFSTSEPGA-----YTISKVSKNGGISHQ 60

Query: 143 KVYEKEMDGVPQYFLSQSRYFRSIVELI 170
           +++          F   +  + S+ ELI
Sbjct: 61  RIHRPGGK-----FQVNNSKYLSVKELI 83


>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV.  This
           subfamily is composed of proteins with similarity to
           Myosin XVa. Myosin XVa is an unconventional myosin that
           is critical for the normal growth of mechanosensory
           stereocilia of inner ear hair cells. Mutations in the
           myosin XVa gene are associated with nonsyndromic hearing
           loss. Myosin XVa contains a unique N-terminal extension
           followed by a motor domain, light chain-binding IQ
           motifs, and a tail consisting of a pair of MyTH4-FERM
           tandems separated by a SH3 domain, and a PDZ domain. SH3
           domains bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs;
           they play a role in the regulation of enzymes by
           intramolecular interactions, changing the subcellular
           localization of signal pathway components and mediate
           multiprotein complex assemblies.
          Length = 56

 Score = 26.9 bits (60), Expect = 1.9
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGE-QKGWWKGKIDERVSYFFQLY 248
            VA   +   +   L   +G  + +L KEG    GW  G +D R   F + Y
Sbjct: 2   VVAVRAYITRDQTLLSFHKGDVIKLLPKEGPLDPGWLFGTLDGRSGAFPKEY 53


>gnl|CDD|212805 cd11872, SH3_DOCK_AB, Src Homology 3 domain of Class A and B
           Dedicator of Cytokinesis proteins.  DOCK proteins are
           atypical guanine nucleotide exchange factors (GEFs) that
           lack the conventional Dbl homology (DH) domain. They are
           divided into four classes (A-D) based on sequence
           similarity and domain architecture: class A includes
           Dock1, 2 and 5; class B includes Dock3 and 4; class C
           includes Dock6, 7, and 8; and class D includes Dock9, 10
           and 11. All DOCKs contain two homology domains: the
           DHR-1 (Dock homology region-1), also called CZH1 (CED-5,
           Dock180, and MBC-zizimin homology 1), and DHR-2 (also
           called CZH2 or Docker). The DHR-1 domain binds
           phosphatidylinositol-3,4,5-triphosphate while DHR-2
           contains the catalytic activity for Rac and/or Cdc42.
           This subfamily includes only Class A and B DOCKs, which
           also contain an SH3 domain at the N-terminal region and
           a PxxP motif at the C-terminus. Class A/B DOCKs are
           mostly specific GEFs for Rac, except Dock4 which
           activates the Ras family GTPase Rap1, probably
           indirectly through interaction with Rap regulatory
           proteins. The SH3 domain of class A/B DOCKs have been
           shown to bind Elmo, a scaffold protein that promotes GEF
           activity of DOCKs by releasing DHR-2 autoinhibition by
           the intramolecular SH3 domain. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 56

 Score = 26.8 bits (60), Expect = 2.0
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 3/39 (7%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKG 235
             VA ++F     +QL L+ G  V +L +     GW++G
Sbjct: 1   YGVAIYNFQGDGEHQLSLQVGDTVQILEECE---GWYRG 36


>gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting
           lymphocyte kinase (Rlk).  TXK is a cytoplasmic (or
           nonreceptor) tyr kinase containing Src homology protein
           interaction domains (SH3, SH2) N-terminal to the
           catalytic tyr kinase domain. It also contains an
           N-terminal cysteine-rich region. Rlk is expressed in
           T-cells and mast cell lines, and is a key component of
           T-cell receptor (TCR) signaling. It is important in
           TCR-stimulated proliferation, IL-2 production and
           phospholipase C-gamma1 activation. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 55

 Score = 26.8 bits (59), Expect = 2.0
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGK 236
           I   A +DF P E + L LK+  + ++L +      WWK +
Sbjct: 1   IQVKALYDFLPREPSNLALKRAEEYLILEQYDPH--WWKAR 39


>gnl|CDD|198208 cd10345, SH2_C-SH2_Zap70_Syk_like, C-terminal Src homology 2 (SH2)
           domain found in Zeta-chain-associated protein kinase 70
           (ZAP-70) and Spleen tyrosine kinase (Syk) proteins.
           ZAP-70 and Syk comprise a family of hematopoietic cell
           specific protein tyrosine kinases (PTKs) that are
           required for antigen and antibody receptor function.
           ZAP-70 is expressed in T and natural killer (NK) cells
           and Syk is expressed in B cells, mast cells,
           polymorphonuclear leukocytes, platelets, macrophages,
           and immature T cells. They are required for the proper
           development of T and B cells, immune receptors, and
           activating NK cells. They consist of two N-terminal Src
           homology 2 (SH2) domains and a C-terminal kinase domain
           separated from the SH2 domains by a linker or hinge
           region. Phosphorylation of both tyrosine residues within
           the Immunoreceptor Tyrosine-based Activation Motifs
           (ITAM; consensus sequence Yxx[LI]x(7,8)Yxx[LI]) by the
           Src-family PTKs is required for efficient interaction of
           ZAP-70 and Syk with the receptor subunits and for
           receptor function. ZAP-70 forms two phosphotyrosine
           binding pockets, one of which is shared by both SH2
           domains. In Syk the two SH2 domains do not form such a
           phosphotyrosine-binding site. The SH2 domains here are
           believed to function independently. In addition, the two
           SH2 domains of Syk display flexibility in their relative
           orientation, allowing Syk to accommodate a greater
           variety of spacing sequences between the ITAM
           phosphotyrosines and singly phosphorylated non-classical
           ITAM ligands. This model contains the C-terminus SH2
           domains of both Syk and Zap70. In general SH2 domains
           are involved in signal transduction.  They typically
           bind pTyr-containing ligands via two surface pockets, a
           pTyr and hydrophobic binding pocket, allowing proteins
           with SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 95

 Score = 27.7 bits (61), Expect = 2.1
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 90  WFVGEMGREKATSLLEREA--DGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEK 147
           WF G++ RE++  ++   +  +G +L+R R    +      YAL L  + KV H   Y  
Sbjct: 2   WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGS------YALCLLHEGKVLH---YRI 52

Query: 148 EMDGVPQYFLSQSRYFRSIVELI 170
           + D   +  + + + F ++ +L+
Sbjct: 53  DKDKTGKLSIPEGKKFDTLWQLV 75


>gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and
           double SH3 domains protein 1.  FCHSD1 has a domain
           structure consisting of an N-terminal F-BAR (FES-CIP4
           Homology and Bin/Amphiphysin/Rvs), two SH3, and
           C-terminal proline-rich domains. It has only been
           characterized in silico and its function is unknown. SH3
           domains are protein interaction domains that bind to
           proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 58

 Score = 26.9 bits (59), Expect = 2.2
 Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVL--SKEGEQKGWWKGKIDERVSYFFQL 247
           +A A + +      +L   +G  + +L  +++G   G+W+G+   RV  F  L
Sbjct: 1   LARALYSYTGQSPEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGRVGVFPSL 53


>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of
           GRB2-related adaptor protein 2.  GRAP2 is also called
           GADS (GRB2-related adapter downstream of Shc), GrpL,
           GRB2L, Mona, or GRID (Grb2-related protein with insert
           domain). It is expressed specifically in the
           hematopoietic system. It plays an important role in T
           cell receptor (TCR) signaling by promoting the formation
           of the SLP-76:LAT complex, which couples the TCR to the
           Ras pathway. It also has roles in antigen-receptor and
           tyrosine kinase mediated signaling. GRAP2 is unique from
           other GRB2-like adaptor proteins in that it can be
           regulated by caspase cleavage. It contains an N-terminal
           SH3 domain, a central SH2 domain, and a C-terminal SH3
           domain. The C-terminal SH3 domain of GRAP2 binds to
           different motifs found in substrate peptides including
           the typical PxxP motif in hematopoietic progenitor
           kinase 1 (HPK1), the RxxK motif in SLP-76 and HPK1, and
           the RxxxxK motif in phosphatase-like protein HD-PTP. SH3
           domains are protein interaction domains that typically
           bind to proline-rich ligands with moderate affinity and
           selectivity, preferentially to PxxP motifs. They play
           versatile and diverse roles in the cell including the
           regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 26.7 bits (59), Expect = 2.2
 Identities = 13/47 (27%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 198 AVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
             A +DF   E ++L    G  + VL  +     WWKG++  ++  F
Sbjct: 2   VRALYDFEALEDDELGFNSGDVIEVL--DSSNPSWWKGRLHGKLGLF 46


>gnl|CDD|198245 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain found in
           suppressor of cytokine signaling (SOCS) proteins.  SH2
           domain found in SOCS proteins. SOCS was first recognized
           as a group of cytokine-inducible SH2 (CIS) domain
           proteins comprising eight family members in human (CIS
           and SOCS1-SOCS7).  In addition to the SH2 domain, SOCS
           proteins have a variable N-terminal domain and a
           conserved SOCS box in the C-terminal domain. SOCS
           proteins bind to a substrate via their SH2 domain. The
           prototypical members, CIS and SOCS1-SOCS3, have been
           shown to regulate growth hormone signaling in vitro and
           in a classic negative feedback response compete for
           binding at phosphotyrosine sites in JAK kinase and
           receptor pathways to displace effector proteins and
           target bound receptors for proteasomal degradation. Loss
           of SOCS activity results in excessive cytokine signaling
           associated with a variety of hematopoietic, autoimmune,
           and inflammatory diseases and certain cancers. Members
           (SOCS4-SOCS7) were identified by their conserved SOCS
           box, an adapter motif of 3 helices that associates
           substrate binding domains, such as the SOCS SH2 domain,
           ankryin, and WD40 with ubiquitin ligase components.
           These show limited cytokine induction. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 98

 Score = 27.7 bits (62), Expect = 2.3
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 86  SEYLWFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKT 135
           S + W  G +  E+A + L+RE  GT+L+R   Q         +ALS+K 
Sbjct: 10  SGFYW--GPLSVEEAHAKLKREPVGTFLIRDSRQK-----NCFFALSVKM 52


>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain
           containing protein 7 (SH2D7).  SH2D7 contains a single
           SH2 domain. In general SH2 domains are involved in
           signal transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 102

 Score = 27.6 bits (61), Expect = 2.9
 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE 148
           WF G + R++   LL  +A G++L+R+  +       T Y LS +  ++ +H  + +  
Sbjct: 9   WFHGFITRKQTEQLLRDKALGSFLIRLSDR------ATGYILSYRGSDRCRHFVINQLR 61


>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine
           nucleotide exchange factor ARHGEF9.  ARHGEF9, also
           called PEM2 or collybistin, selectively activates Cdc42
           by exchanging bound GDP for free GTP. It is highly
           expressed in the brain and it interacts with gephyrin, a
           postsynaptic protein associated with GABA and glycine
           receptors. Mutations in the ARHGEF9 gene cause X-linked
           mental retardation with associated features like
           seizures, hyper-anxiety, aggressive behavior, and
           sensory hyperarousal. ARHGEF9 contains a SH3 domain
           followed by RhoGEF (also called Dbl-homologous or DH)
           and Pleckstrin Homology (PH) domains. SH3 domains are
           protein interaction domains that bind to proline-rich
           ligands with moderate affinity and selectivity,
           preferentially to PxxP motifs. They play versatile and
           diverse roles in the cell including the regulation of
           enzymes, changing the subcellular localization of
           signaling pathway components, and mediating the
           formation of multiprotein complex assemblies.
          Length = 62

 Score = 26.6 bits (58), Expect = 3.2
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 5/59 (8%)

Query: 196 IIAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF---FQLYWGN 251
           + A A +D       +L  K G  + VL  +   K WW G+ID+   +F   F   W N
Sbjct: 5   VSAEAVWDHVTMANRELAFKAGDVIKVL--DASNKDWWWGQIDDEEGWFPASFVRLWVN 61


>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox
           subunit of NADPH oxidase and similar domains.  This
           family is composed of the tandem SH3 domains of p47phox
           subunit of NADPH oxidase and Nox Organizing protein 1
           (NoxO1), the four SH3 domains of Tks4 (Tyr kinase
           substrate with four SH3 domains), the five SH3 domains
           of Tks5, the SH3 domain of obscurin, Myosin-I,  and
           similar domains. Most members of this group also contain
           Phox homology (PX) domains, except for obscurin and
           Myosin-I. p47phox and NoxO1 are regulators of the
           phagocytic NADPH oxidase complex (also called Nox2 or
           gp91phox) and nonphagocytic NADPH oxidase Nox1,
           respectively. They play roles in the activation of their
           respective NADPH oxidase, which catalyzes the transfer
           of electrons from NADPH to molecular oxygen to form
           superoxide. Tks proteins are Src substrates and
           scaffolding proteins that play important roles in the
           formation of podosomes and invadopodia, the dynamic
           actin-rich structures that are related to cell migration
           and cancer cell invasion. Obscurin is a giant muscle
           protein that plays important roles in the organization
           and assembly of the myofibril and the sarcoplasmic
           reticulum. Type I myosins (Myosin-I) are actin-dependent
           motors in endocytic actin structures and actin patches.
           They play roles in membrane traffic in endocytic and
           secretory pathways, cell motility, and mechanosensing.
           Myosin-I contains an N-terminal actin-activated ATPase,
           a phospholipid-binding TH1 (tail homology 1) domain, and
           a C-terminal extension which includes an F-actin-binding
           TH2 domain, an SH3 domain, and an acidic peptide that
           participates in activating the Arp2/3complex. The SH3
           domain of myosin-I is required for myosin-I-induced
           actin polymerization. SH3 domains are protein
           interaction domains that bind to proline-rich ligands
           with moderate affinity and selectivity, preferentially
           to PxxP motifs. They play versatile and diverse roles in
           the cell including the regulation of enzymes, changing
           the subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 53

 Score = 26.1 bits (58), Expect = 3.3
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSYF 244
           +A+A  D+     +++ L++G  V VL K     GWW  +  ++  + 
Sbjct: 3   VAIA--DYEAQGDDEISLQEGEVVEVLEKNDS--GWWYVRKGDKEGWV 46


>gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain
           of Dynamin Binding Protein, also called Tuba, and
           similar domains.  DNMBP or Tuba is a cdc42-specific
           guanine nucleotide exchange factor (GEF) that contains
           four N-terminal SH3 domains, a central RhoGEF [or Dbl
           homology (DH)] domain followed by a Bin/Amphiphysin/Rvs
           (BAR) domain, and two C-terminal SH3 domains. It
           provides a functional link between dynamin, Rho GTPase
           signaling, and actin dynamics. It plays an important
           role in regulating cell junction configuration. The
           C-terminal SH3 domains of DNMBP bind to N-WASP and
           Ena/VASP proteins, which are key regulatory proteins of
           the actin cytoskeleton. Also included in this subfamily
           is the second C-terminal SH3 domain of Rho guanine
           nucleotide exchange factor 37 (ARHGEF37), whose function
           is still unknown. SH3 domains are protein interaction
           domains that bind to proline-rich ligands with moderate
           affinity and selectivity, preferentially to PxxP motifs.
           They play versatile and diverse roles in the cell
           including the regulation of enzymes, changing the
           subcellular localization of signaling pathway
           components, and mediating the formation of multiprotein
           complex assemblies.
          Length = 57

 Score = 26.2 bits (58), Expect = 3.3
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 4/38 (10%)

Query: 199 VAEFDFCPTEANQLPLKQGCQVIVLSKEGEQKG---WW 233
            A + F      +L + +G  V VL K  + KG   WW
Sbjct: 3   YALYTFEARSPGELSVTEGQVVTVLEKH-DLKGNPEWW 39


>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase.
          Length = 1378

 Score = 29.0 bits (65), Expect = 3.7
 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 17/54 (31%)

Query: 2   GLKSQNLR-----------------SISIVTLKSRGLRPLCSQACYLACHKQCI 38
           G KS NLR                 SISI  L+  G   +C   C L     CI
Sbjct: 806 GYKSSNLREWVEEKTKGRISANSVQSISIQLLRKGGPDAVCEHLCSLKKGSTCI 859


>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase
           substrate (Tks) proteins.  Tks proteins are Src
           substrates and scaffolding proteins that play important
           roles in the formation of podosomes and invadopodia, the
           dynamic actin-rich structures that are related to cell
           migration and cancer cell invasion. Vertebrates contain
           two Tks proteins, Tks4 (Tyr kinase substrate with four
           SH3 domains) and Tks5 (Tyr kinase substrate with five
           SH3 domains), which display partially overlapping but
           non-redundant functions. Both associate with the ADAMs
           family of transmembrane metalloproteases, which function
           as sheddases and mediators of cell and matrix
           interactions. Tks5 interacts with N-WASP and Nck, while
           Tks4 is essential for the localization of MT1-MMP
           (membrane-type 1 matrix metalloproteinase) to
           invadopodia. Tks proteins contain an N-terminal Phox
           homology (PX) domain and four or five SH3 domains. This
           model characterizes the third SH3 domain of Tks
           proteins. SH3 domains are protein interaction domains
           that bind to proline-rich ligands with moderate affinity
           and selectivity, preferentially to PxxP motifs. They
           play versatile and diverse roles in the cell including
           the regulation of enzymes, changing the subcellular
           localization of signaling pathway components, and
           mediating the formation of multiprotein complex
           assemblies.
          Length = 53

 Score = 25.9 bits (57), Expect = 4.1
 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 203 DFCPTEANQLPLKQGCQVIVLSKEGEQKGWWKGKIDER 240
           +F  T  + +  ++G +V V+ K     GWW  KID +
Sbjct: 7   EFQATIQDGISFQKGQKVEVIDKN--PSGWWYVKIDGK 42


>gnl|CDD|212823 cd11890, MIA, Melanoma Inhibitory Activity protein.  MIA is a
           single domain protein that adopts a Src Homology 3 (SH3)
           domain-like fold; it contains an additional antiparallel
           beta sheet and two disulfide bonds compared to classical
           SH3 domains. MIA is secreted from malignant melanoma
           cells and it plays an important role in melanoma
           development and invasion. MIA is expressed by
           chondrocytes in normal tissues and may be important in
           the cartilage cell phenotype. Unlike classical SH3
           domains, MIA does not bind proline-rich ligands. It
           binds peptide ligands with sequence similarity to type
           III human fibronectin repeats.
          Length = 98

 Score = 27.2 bits (60), Expect = 4.4
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 197 IAVAEFDFCPTEANQLPLKQGCQVIVLSK---------EGEQKGWWKGKIDERVSYF 244
           IAVA  D+   +   +P+++G  V V SK          G  +G + G+   R+ YF
Sbjct: 15  IAVALQDYMAPDCRFIPIQRGQVVYVFSKLKGRGRLFWGGSVQGDYYGEQAARLGYF 71


>gnl|CDD|238729 cd01452, VWA_26S_proteasome_subunit, 26S proteasome plays a major
           role in eukaryotic protein breakdown, especially for
           ubiquitin-tagged proteins. It is an ATP-dependent
           protease responsible for the bulk of non-lysosomal
           proteolysis in eukaryotes, often using covalent
           modification of proteins by ubiquitylation. It consists
           of a 20S proteolytic core particle (CP) and a 19S
           regulatory particle (RP). The CP is an ATP independent
           peptidase consisting of hydrolyzing activities. One or
           both ends of CP carry the RP that confers both ubiquitin
           and ATP dependence to the 26S proteosome. The RP's
           proposed functions include recognition of substrates and
           translocation of these to CP for proteolysis. The RP can
           dissociate into a stable lid and base subcomplexes. The
           base is composed of three non-ATPase subunits (Rpn 1, 2
           and 10). A single residue in the vWA domain of Rpn10 has
           been implicated to be responsible for stabilizing the
           lid-base association.
          Length = 187

 Score = 27.3 bits (61), Expect = 6.4
 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 4/41 (9%)

Query: 145 YEKEMDGVPQYFLSQSRYFRSIVELICCYERNSLIENFIGL 185
           Y +  D  P  F +Q       V LIC  +  S  EN +GL
Sbjct: 15  YMRNGDYPPTRFQAQ----ADAVNLICQAKTRSNPENNVGL 51


>gnl|CDD|211667 TIGR01530, nadN, NAD pyrophosphatase/5'-nucleotidase NadN.  This
           model describes NadN of Haemophilus influenzae and a
           small number of close homologs in pathogenic,
           Gram-negative bacteria. NadN is a periplasmic enzyme
           that cleaves NAD (nicotinamide adenine dinucleotide) to
           NMN (nicotinamide mononucleotide) and AMP. The NMN must
           be converted by a 5'-nucleotidase to nicotinamide
           riboside for import. NadN belongs a large family of
           5'-nucleotidases and has NMN 5'-nucleotidase activity
           for NMN, AMP, etc [Transport and binding proteins,
           Other, Biosynthesis of cofactors, prosthetic groups, and
           carriers, Pyridine nucleotides].
          Length = 545

 Score = 28.0 bits (62), Expect = 6.6
 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 208 EANQLPLKQGCQVIVLSKEGEQKGWWKGKIDERVSY 243
           EAN+ P  +G +++ +    +Q   W+  ID+   Y
Sbjct: 463 EANETPNAEGKRLVSVEVLNKQTQQWE-PIDDNKRY 497


>gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in
           suppressor of cytokine signaling (SOCS) proteins.  SH2
           domain found in SOCS proteins. SOCS was first recognized
           as a group of cytokine-inducible SH2 (CIS) domain
           proteins comprising eight family members in human (CIS
           and SOCS1-SOCS7).  In addition to the SH2 domain, SOCS
           proteins have a variable N-terminal domain and a
           conserved SOCS box in the C-terminal domain. SOCS
           proteins bind to a substrate via their SH2 domain. The
           prototypical members, CIS and SOCS1-SOCS3, have been
           shown to regulate growth hormone signaling in vitro and
           in a classic negative feedback response compete for
           binding at phosphotyrosine sites in JAK kinase and
           receptor pathways to displace effector proteins and
           target bound receptors for proteasomal degradation. Loss
           of SOCS activity results in excessive cytokine signaling
           associated with a variety of hematopoietic, autoimmune,
           and inflammatory diseases and certain cancers. Members
           (SOCS4-SOCS7) were identified by their conserved SOCS
           box, an adapter motif of 3 helices that associates
           substrate binding domains, such as the SOCS SH2 domain,
           ankryin, and WD40 with ubiquitin ligase components.
           These show limited cytokine induction. In general SH2
           domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 103

 Score = 26.4 bits (58), Expect = 8.1
 Identities = 20/88 (22%), Positives = 42/88 (47%), Gaps = 10/88 (11%)

Query: 90  WFVGEMGREKATSLLEREADGTYLLRIRPQGPTHPNETIYALSLKTDEKVKHMKVYEKE- 148
           W+ G M   +A   L+   +GT+L+R         ++ +  +S+KT     ++++  ++ 
Sbjct: 9   WYWGSMTVNEAKEKLQDAPEGTFLVRDSSH-----SDYLLTISVKTSAGPTNLRIEYQDG 63

Query: 149 ---MDGVPQYFLSQSRYFRSIVELICCY 173
              +D +     S+ + F S+V LI  Y
Sbjct: 64  KFRLDSI-ICVKSKLKQFDSVVHLIEYY 90


>gnl|CDD|198279 cd10416, SH2_SH2D2A, Src homology 2 domain found in the SH2 domain
           containing protein 2A (SH2D2A).  SH2D2A contains a
           single SH2 domain. In general SH2 domains are involved
           in signal transduction.  They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 102

 Score = 26.2 bits (57), Expect = 8.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 89  LWFVGEMGREKATSLLEREADGTYLLR 115
            WF G + R +A  LLE +  G YL+R
Sbjct: 8   AWFHGFITRREAERLLEPKPQGCYLVR 34


>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein
           YejF; Provisional.
          Length = 529

 Score = 27.4 bits (61), Expect = 8.6
 Identities = 27/86 (31%), Positives = 36/86 (41%), Gaps = 18/86 (20%)

Query: 46  TGVPLPAMSPRPPLMDIAGAAQPLGGNEWTAKSWADH----ENLS------EYLWFVGEM 95
           +G P+P   P  PL+D+          +   K   DH    +N+S      E L  VGE 
Sbjct: 262 SGDPVPLPEPASPLLDVEQLQVAFPIRKGILKRTVDHNVVVKNISFTLRPGETLGLVGES 321

Query: 96  GREKATSLLEREADGTYLLR-IRPQG 120
           G  K+T+       G  LLR I  QG
Sbjct: 322 GSGKSTT-------GLALLRLINSQG 340


>gnl|CDD|239546 cd03463, 3,4-PCD_alpha, Protocatechuate 3,4-dioxygenase (3,4-PCD) ,
           alpha subunit. 3,4-PCD catalyzes the oxidative ring
           cleavage of 3,4-dihydroxybenzoate to produce
           beta-carboxy-cis,cis-muconate. 3,4-PCDs are large
           aggregates of 12 protomers, each composed of an alpha-
           and beta-subunit and an Fe3+ ion bound in the
           beta-subunit at the alpha-subunit-beta-subunit
           interface. 3,4-PCD is a member of the aromatic
           dioxygenases which are non-heme iron intradiol-cleaving
           enzymes that break the C1-C2 bond and utilize Fe3+.
          Length = 185

 Score = 26.8 bits (60), Expect = 8.8
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 100 ATSLLEREADGTYLLRIRPQGPTHPNETIY 129
           AT + +RE DG Y   IR QG     ET++
Sbjct: 157 ATLIAKREGDGAYRFDIRLQG---EGETVF 183


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0813    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 13,801,599
Number of extensions: 1295729
Number of successful extensions: 1197
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1145
Number of HSP's successfully gapped: 168
Length of query: 272
Length of database: 10,937,602
Length adjustment: 95
Effective length of query: 177
Effective length of database: 6,723,972
Effective search space: 1190143044
Effective search space used: 1190143044
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.0 bits)