Diaphorina citri psyllid: psy322


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MLDEFWFLRMTHILFEIVITDLEYVRPENDETICREDIHSHPNIEIVITDLEYVRPENDETICREDIHRQYKAVELIYTKEFDMKIDIWSTACLTFELVTGDYMFNPFESKYYTIDEHHILKIIQLMAEIPPNLMDNERCIRNIKVLLERDQHNITSMNAKDNFYRILAKSYKIPKEDAKQL
ccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccHHHHHHHHccccHHHHccc
**DEFWFLRMTHILFEIVITDL*******DETICREDIHSHPNIEIVITDLEYVRPENDETICREDIHRQYKAVELIYTKEFDMKIDIWSTACLTFELVTGDYMFNPFESKYYTIDEHHILKIIQLMAEIPPNLMDNERCIRNIKVLLERDQHNITSMNAKDNFYRILAKSYKIP*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDEFWFLRMTHILFEIVITDLEYVRPENDETICREDIHSHPNIEIVITDLEYVRPENDETICREDIHRQYKAVELIYTKEFDMKIDIWSTACLTFELVTGDYMFNPFESKYYTIDEHHILKIIQLMAEIPPNLMDNERCIRNIKVLLERDQHNITSMNAKDNFYRILAKSYKIPKEDAKQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q8Y, chain A
Confidence level:very confident
Coverage over the Query: 8-181
View the alignment between query and template
View the model in PyMOL