Psyllid ID: psy3254


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSPGGNIPPGPPGAPSGGGFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
ccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccEEEEcEEEcccccccccccccccccccccHHHHHHHcccccccccccc
cccccccccccccHHEEEEEcccccccccccccccHHHHHHHHHHHcccHcccHcHHHHHcccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccccHHEEEcccccEEEccccccEEEccccccccccccccccccHHHEEHHHccccEEEEcc
maegkppygdihpmraifmiptkpppsfrepdvwtpeFIDFVSRClvknpeerATASEMLNhefiqvspggnippgppgapsgggfcdfeflkflsyDDLQHRMANLDCEMEREIEQLRRNILLNteghakladfgvagqltDTMAKrntvigtpfwmaPEVIQEIGYDCVADMWSL
maegkppygdihpmraIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSPGGNIPPGPPGAPSGGGFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSpggnippgppgapsgggFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
*************MRAIFMIP********EPDVWTPEFIDFVSRCLVK***********************************GGFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMW**
**EGKPPYGDIHPMRAIFMIPTKPPP*FRE*DVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSPGGNIPPGPPGAPSGGGFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSPGGNIPPGPPGAPSGGGFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
****KPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSPGGNIPPGPPGAPSGGGFCDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEMLNHEFIQVSPGGNIPPGPPGAPSGGGFCDFEFLKFLSxxxxxxxxxxxxxxxxxxxxxLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q8T0S6 669 Serine/threonine-protein yes N/A 0.372 0.098 0.803 6e-28
Q9JI11 487 Serine/threonine-protein yes N/A 0.322 0.117 0.964 1e-27
A4K2T0 487 Serine/threonine-protein yes N/A 0.305 0.110 0.964 1e-27
Q5E9L6 487 Serine/threonine-protein yes N/A 0.305 0.110 0.964 1e-27
A4K2Y1 487 Serine/threonine-protein N/A N/A 0.305 0.110 0.964 1e-27
A4K2W5 487 Serine/threonine-protein N/A N/A 0.305 0.110 0.964 1e-27
Q9JI10 497 Serine/threonine-protein no N/A 0.271 0.096 0.964 1e-27
Q13043 487 Serine/threonine-protein yes N/A 0.305 0.110 0.964 1e-27
A4K2P5 487 Serine/threonine-protein N/A N/A 0.305 0.110 0.964 1e-27
Q13188 491 Serine/threonine-protein no N/A 0.282 0.101 0.964 1e-27
>sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%)

Query: 1   MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEML 60
           MAEGKPPYG+IHPMRAIFMIP KPPPSFREPD W+ EFIDFVS+CLVK P++RATA+E+L
Sbjct: 229 MAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELL 288

Query: 61  NHEFIQ 66
            HEFI+
Sbjct: 289 EHEFIR 294




Plays a key role in the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki) oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Phosphorylates Sav, Wts and Th/DIAP1. Regulates the level of Th/DIAP1 apoptosis inhibitor.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 Back     alignment and function description
>sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=1 SV=1 Back     alignment and function description
>sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 Back     alignment and function description
>sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=1 SV=1 Back     alignment and function description
>sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 Back     alignment and function description
>sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 Back     alignment and function description
>sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=1 SV=1 Back     alignment and function description
>sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
345480521 528 PREDICTED: serine/threonine-protein kina 0.367 0.123 0.938 3e-30
156551419 521 PREDICTED: serine/threonine-protein kina 0.367 0.124 0.938 3e-30
350421067 521 PREDICTED: serine/threonine-protein kina 0.367 0.124 0.923 8e-30
328786401 521 PREDICTED: serine/threonine-protein kina 0.367 0.124 0.923 8e-30
340719762 521 PREDICTED: serine/threonine-protein kina 0.367 0.124 0.923 8e-30
328706800 541 PREDICTED: serine/threonine-protein kina 0.401 0.131 0.807 1e-29
322795456 400 hypothetical protein SINV_14160 [Solenop 0.372 0.165 0.909 2e-29
383847106 521 PREDICTED: serine/threonine-protein kina 0.367 0.124 0.907 3e-29
332017045 529 Serine/threonine-protein kinase 3 [Acrom 0.367 0.122 0.907 4e-29
170027953 615 serine/threonine-protein kinase 3 [Culex 0.372 0.107 0.863 4e-29
>gi|345480521|ref|XP_003424164.1| PREDICTED: serine/threonine-protein kinase hippo-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/65 (93%), Positives = 63/65 (96%)

Query: 1   MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEML 60
           MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPD W+PEFIDFVS CLVKNPEERATASE+L
Sbjct: 217 MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDQWSPEFIDFVSVCLVKNPEERATASELL 276

Query: 61  NHEFI 65
           NHEFI
Sbjct: 277 NHEFI 281




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156551419|ref|XP_001604121.1| PREDICTED: serine/threonine-protein kinase hippo-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350421067|ref|XP_003492721.1| PREDICTED: serine/threonine-protein kinase 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328786401|ref|XP_393691.4| PREDICTED: serine/threonine-protein kinase 3-like isoform 1 [Apis mellifera] gi|380027210|ref|XP_003697322.1| PREDICTED: serine/threonine-protein kinase 3-like [Apis florea] Back     alignment and taxonomy information
>gi|340719762|ref|XP_003398316.1| PREDICTED: serine/threonine-protein kinase 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328706800|ref|XP_001950941.2| PREDICTED: serine/threonine-protein kinase hippo-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322795456|gb|EFZ18201.1| hypothetical protein SINV_14160 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383847106|ref|XP_003699196.1| PREDICTED: serine/threonine-protein kinase 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332017045|gb|EGI57844.1| Serine/threonine-protein kinase 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|170027953|ref|XP_001841861.1| serine/threonine-protein kinase 3 [Culex quinquefasciatus] gi|167868331|gb|EDS31714.1| serine/threonine-protein kinase 3 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
FB|FBgn0261456 669 hpo "hippo" [Drosophila melano 0.372 0.098 0.803 1.4e-35
UNIPROTKB|Q6IP06 493 stk3 "Serine/threonine-protein 0.322 0.115 0.964 1.1e-25
UNIPROTKB|Q802A6 491 STK4 "Serine/threonine-protein 0.322 0.116 0.947 4e-25
ZFIN|ZDB-GENE-030131-2845 492 stk3 "serine/threonine kinase 0.322 0.115 0.964 1.1e-25
RGD|68412 491 Stk3 "serine/threonine kinase 0.322 0.116 0.964 1.1e-25
UNIPROTKB|O54748 491 Stk3 "Serine/threonine-protein 0.322 0.116 0.964 1.1e-25
MGI|MGI:1928487 497 Stk3 "serine/threonine kinase 0.322 0.114 0.964 1.2e-25
UNIPROTKB|F5H5B4432 STK4 "Serine/threonine-protein 0.372 0.152 0.681 9.4e-31
UNIPROTKB|F1P4Y3 486 STK4 "Serine/threonine-protein 0.322 0.117 0.964 1e-25
RGD|1312035 487 Stk4 "serine/threonine kinase 0.322 0.117 0.964 1.1e-25
FB|FBgn0261456 hpo "hippo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 1.4e-35, Sum P(2) = 1.4e-35
 Identities = 53/66 (80%), Positives = 61/66 (92%)

Query:     1 MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEML 60
             MAEGKPPYG+IHPMRAIFMIP KPPPSFREPD W+ EFIDFVS+CLVK P++RATA+E+L
Sbjct:   229 MAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELL 288

Query:    61 NHEFIQ 66
              HEFI+
Sbjct:   289 EHEFIR 294


GO:0004702 "receptor signaling protein serine/threonine kinase activity" evidence=ISS;NAS
GO:0006468 "protein phosphorylation" evidence=IDA;NAS
GO:0005575 "cellular_component" evidence=ND
GO:0006915 "apoptotic process" evidence=IMP
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0008283 "cell proliferation" evidence=IMP
GO:0008285 "negative regulation of cell proliferation" evidence=IMP
GO:0006917 "induction of apoptosis" evidence=IMP
GO:0046621 "negative regulation of organ growth" evidence=TAS
GO:0043066 "negative regulation of apoptotic process" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0045464 "R8 cell fate specification" evidence=IMP
GO:0043524 "negative regulation of neuron apoptotic process" evidence=IMP
GO:0016301 "kinase activity" evidence=IDA
GO:0010212 "response to ionizing radiation" evidence=IMP
GO:0042771 "intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0002011 "morphogenesis of an epithelial sheet" evidence=IMP
GO:0001654 "eye development" evidence=IMP
GO:0042127 "regulation of cell proliferation" evidence=IMP
GO:0072089 "stem cell proliferation" evidence=IDA
GO:0060253 "negative regulation of glial cell proliferation" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0035265 "organ growth" evidence=IDA
UNIPROTKB|Q6IP06 stk3 "Serine/threonine-protein kinase 3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q802A6 STK4 "Serine/threonine-protein kinase 3/4" [Squalus acanthias (taxid:7797)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2845 stk3 "serine/threonine kinase 3 (STE20 homolog, yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|68412 Stk3 "serine/threonine kinase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O54748 Stk3 "Serine/threonine-protein kinase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1928487 Stk3 "serine/threonine kinase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5B4 STK4 "Serine/threonine-protein kinase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4Y3 STK4 "Serine/threonine-protein kinase 4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1312035 Stk4 "serine/threonine kinase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 6e-39
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 4e-37
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-32
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-30
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-27
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 3e-27
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 4e-27
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-26
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 3e-26
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 8e-26
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-23
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-23
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-23
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 4e-23
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-22
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-22
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 3e-22
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 1e-21
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-21
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 2e-20
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-19
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 4e-19
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 1e-18
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-18
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 5e-18
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 7e-18
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 9e-18
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-17
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 3e-17
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 3e-17
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 5e-17
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-16
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 3e-16
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 3e-16
pfam00069260 pfam00069, Pkinase, Protein kinase domain 8e-16
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-15
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-15
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 3e-15
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-15
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 4e-15
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 4e-15
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-15
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 8e-15
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 9e-15
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-14
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 1e-14
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-14
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-14
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-14
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-14
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 3e-14
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 4e-14
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 6e-14
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 6e-14
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 7e-14
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 7e-14
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 8e-14
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 8e-14
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-13
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-13
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-13
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-13
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-13
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 3e-13
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 4e-13
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 5e-13
cd06615 308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 8e-13
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 9e-13
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 9e-13
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 9e-13
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 1e-12
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 1e-12
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-12
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-12
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-12
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 2e-12
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-12
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 4e-12
pfam1162949 pfam11629, Mst1_SARAH, C terminal SARAH domain of 4e-12
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 6e-12
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 9e-12
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 9e-12
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-11
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-11
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-11
cd06650 333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 2e-11
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-11
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 3e-11
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-11
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 4e-11
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 5e-11
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-11
cd06649 331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 5e-11
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 6e-11
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 7e-11
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 9e-11
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-10
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 2e-10
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-10
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-10
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-10
cd06633 313 cd06633, STKc_TAO3, Catalytic domain of the Protei 2e-10
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-10
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 3e-10
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 5e-10
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 5e-10
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-10
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 5e-10
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 6e-10
cd06634 308 cd06634, STKc_TAO2, Catalytic domain of the Protei 6e-10
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 7e-10
cd06635 317 cd06635, STKc_TAO1, Catalytic domain of the Protei 9e-10
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-09
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-09
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-09
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-09
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 3e-09
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-09
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 5e-09
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 6e-09
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 8e-09
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 1e-08
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 1e-08
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-08
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 2e-08
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 2e-08
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-08
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 2e-08
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 2e-08
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 3e-08
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 3e-08
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 3e-08
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-08
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 3e-08
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 4e-08
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 4e-08
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 5e-08
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 6e-08
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 7e-08
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 9e-08
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 1e-07
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-07
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-07
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-07
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 1e-07
smart00750176 smart00750, KIND, kinase non-catalytic C-lobe doma 1e-07
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 2e-07
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-07
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-07
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-07
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-07
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 3e-07
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 3e-07
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-07
smart00750176 smart00750, KIND, kinase non-catalytic C-lobe doma 5e-07
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 5e-07
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 6e-07
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-07
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 7e-07
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 8e-07
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 8e-07
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 8e-07
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 8e-07
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 9e-07
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 9e-07
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 9e-07
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 9e-07
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 9e-07
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-06
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-06
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-06
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-06
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 1e-06
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 2e-06
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-06
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 2e-06
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 2e-06
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 3e-06
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 3e-06
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-06
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 3e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-06
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 3e-06
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 3e-06
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-06
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 4e-06
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 6e-06
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 7e-06
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 8e-06
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 9e-06
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 2e-05
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-05
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-05
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-05
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-05
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-05
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 2e-05
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 2e-05
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-05
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 3e-05
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 4e-05
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-05
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 4e-05
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 5e-05
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 5e-05
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 6e-05
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 7e-05
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 8e-05
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 9e-05
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 9e-05
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-04
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 1e-04
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 1e-04
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-04
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-04
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-04
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-04
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 2e-04
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 2e-04
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 2e-04
cd08227327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 3e-04
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 4e-04
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 4e-04
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 6e-04
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 6e-04
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 6e-04
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 7e-04
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 7e-04
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 8e-04
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 0.001
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 0.001
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.001
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 0.001
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 0.002
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 0.002
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 0.002
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 0.002
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.002
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 0.002
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 0.002
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 0.002
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 0.002
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 0.002
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 0.002
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 0.002
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 0.003
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 0.003
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 0.003
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 0.003
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 0.003
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 0.003
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 0.003
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 0.004
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 0.004
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
 Score =  132 bits (335), Expect = 6e-39
 Identities = 45/65 (69%), Positives = 54/65 (83%)

Query: 1   MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEML 60
           MAEGKPPY DIHPMRAIFMIP KPPP+  +P+ W+PEF DFV +CLVK+PEER +A ++L
Sbjct: 192 MAEGKPPYSDIHPMRAIFMIPNKPPPTLSDPEKWSPEFNDFVKKCLVKDPEERPSAIQLL 251

Query: 61  NHEFI 65
            H FI
Sbjct: 252 QHPFI 256


Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase kinase kinase (MAPKKKK). Activation of JNK by MST1 leads to caspase activation and apoptosis. MST1 has also been implicated in cell proliferation and differentiation. Krs1 may regulate cell growth arrest and apoptosis in response to cellular stress. Length = 256

>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|152065 pfam11629, Mst1_SARAH, C terminal SARAH domain of Mst1 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
KOG0581|consensus 364 99.82
KOG0598|consensus 357 99.8
KOG0578|consensus550 99.78
KOG0575|consensus 592 99.76
KOG0591|consensus 375 99.74
KOG0615|consensus 475 99.74
KOG0694|consensus 694 99.73
KOG0192|consensus 362 99.73
KOG0593|consensus 396 99.73
KOG0616|consensus 355 99.71
KOG0201|consensus 467 99.7
KOG0579|consensus 1187 99.7
KOG0595|consensus 429 99.69
KOG0594|consensus 323 99.69
KOG0582|consensus 516 99.68
KOG0583|consensus 370 99.68
KOG0661|consensus 538 99.68
KOG0663|consensus 419 99.67
KOG0658|consensus 364 99.66
KOG0600|consensus 560 99.66
KOG0574|consensus 502 99.65
KOG0603|consensus 612 99.64
KOG0599|consensus 411 99.64
KOG0659|consensus 318 99.64
KOG0577|consensus 948 99.63
KOG0197|consensus468 99.63
KOG0660|consensus 359 99.63
KOG0589|consensus 426 99.63
KOG0033|consensus 355 99.63
KOG0592|consensus 604 99.62
KOG0198|consensus 313 99.61
KOG4721|consensus 904 99.61
KOG0588|consensus 786 99.6
KOG0614|consensus 732 99.58
KOG0690|consensus 516 99.57
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.57
KOG0984|consensus282 99.57
KOG0605|consensus 550 99.56
KOG0597|consensus 808 99.56
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.56
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.55
KOG0667|consensus 586 99.55
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.55
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.54
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.54
KOG0695|consensus 593 99.54
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.54
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.54
KOG0986|consensus 591 99.54
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.54
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.54
KOG4279|consensus 1226 99.53
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.53
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.53
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.53
KOG0983|consensus 391 99.53
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.53
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.52
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.52
KOG0696|consensus 683 99.52
KOG1187|consensus361 99.52
KOG0664|consensus 449 99.52
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.52
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.52
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.52
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.51
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.51
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.51
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.5
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.5
KOG1006|consensus 361 99.5
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.49
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.49
KOG4236|consensus 888 99.49
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.49
KOG0193|consensus678 99.49
KOG0032|consensus 382 99.49
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.49
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.49
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.49
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.48
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.48
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.48
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.48
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.48
PHA02882294 putative serine/threonine kinase; Provisional 99.48
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.47
PHA03212 391 serine/threonine kinase US3; Provisional 99.47
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.47
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.47
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.47
KOG4645|consensus1509 99.47
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.47
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.47
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.46
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.46
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.46
KOG0585|consensus 576 99.46
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.46
PTZ00283 496 serine/threonine protein kinase; Provisional 99.46
PHA03210 501 serine/threonine kinase US3; Provisional 99.45
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.45
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.45
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.45
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.45
KOG0671|consensus 415 99.44
KOG0611|consensus 668 99.44
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.44
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.44
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.43
KOG1026|consensus774 99.43
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.43
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.43
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.43
PTZ00267 478 NIMA-related protein kinase; Provisional 99.43
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.42
PTZ00036 440 glycogen synthase kinase; Provisional 99.42
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.41
PHA03211 461 serine/threonine kinase US3; Provisional 99.41
KOG0666|consensus 438 99.41
PHA03209 357 serine/threonine kinase US3; Provisional 99.41
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.41
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.41
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.4
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.4
PTZ00284 467 protein kinase; Provisional 99.39
PHA03207 392 serine/threonine kinase US3; Provisional 99.39
KOG0194|consensus 474 99.39
KOG0587|consensus 953 99.39
KOG0612|consensus 1317 99.39
KOG0662|consensus 292 99.38
KOG0604|consensus 400 99.37
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.37
KOG0665|consensus 369 99.37
KOG0580|consensus281 99.36
KOG0669|consensus 376 99.36
KOG1035|consensus 1351 99.36
KOG0596|consensus 677 99.36
KOG1095|consensus 1025 99.36
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.35
PLN00181 793 protein SPA1-RELATED; Provisional 99.35
KOG0196|consensus 996 99.35
KOG0581|consensus364 99.34
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.34
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.34
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.34
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.33
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.33
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.33
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.33
KOG0578|consensus550 99.32
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.32
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.32
KOG0584|consensus 632 99.32
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.31
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.31
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.31
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.31
KOG4717|consensus 864 99.31
KOG0033|consensus355 99.31
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.3
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.3
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.3
KOG0586|consensus 596 99.29
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.29
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.29
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.29
KOG0200|consensus 609 99.29
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.29
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.29
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.29
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.29
KOG0574|consensus 502 99.29
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.28
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.28
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.28
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.28
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.27
KOG1094|consensus807 99.27
KOG0608|consensus 1034 99.27
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.27
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.27
KOG1989|consensus 738 99.27
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.26
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.26
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.26
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.26
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.26
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.26
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.25
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.25
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.25
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.25
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.25
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.25
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.24
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.24
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.24
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.24
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.24
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.24
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.24
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.24
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.24
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.24
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.23
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.23
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.23
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.23
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.23
PHA02988283 hypothetical protein; Provisional 99.23
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.23
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.23
KOG0588|consensus 786 99.23
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.23
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.23
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.23
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.22
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.22
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.22
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.22
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.22
KOG0615|consensus475 99.22
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.22
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.22
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.22
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.22
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.21
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.21
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.21
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.21
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.21
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.21
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.21
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.21
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.21
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.21
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.21
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.2
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.2
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.2
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.2
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.2
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.2
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.19
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.19
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.19
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.19
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.19
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.18
KOG4717|consensus 864 99.18
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.18
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.18
KOG1152|consensus772 99.18
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.18
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.18
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.18
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.18
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.18
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.18
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.17
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.17
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.17
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.17
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.17
KOG4250|consensus 732 99.17
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.17
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.17
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.17
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.16
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.16
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.16
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.16
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.16
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.16
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.16
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.16
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.16
KOG0201|consensus467 99.16
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.16
KOG0575|consensus 592 99.16
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.15
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.15
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.15
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.15
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.15
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.15
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.15
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.15
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.15
KOG1151|consensus 775 99.15
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.15
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.14
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.14
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.14
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.14
KOG4257|consensus 974 99.14
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.14
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.14
KOG0610|consensus 459 99.14
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.14
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.14
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.14
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.14
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.14
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.13
KOG0670|consensus 752 99.13
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.13
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.13
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.13
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.13
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.13
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.13
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.13
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.12
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.12
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.12
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.12
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.12
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.12
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.12
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.12
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.12
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.11
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.11
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.11
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.11
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.11
KOG0198|consensus313 99.11
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.11
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.11
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.1
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.1
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.1
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.1
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.1
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.1
KOG0199|consensus 1039 99.1
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.1
PLN00009 294 cyclin-dependent kinase A; Provisional 99.1
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.1
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.1
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.1
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.1
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.1
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.09
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.09
KOG0576|consensus 829 99.09
KOG0592|consensus 604 99.09
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.09
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.09
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.09
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.08
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.08
KOG1025|consensus 1177 99.08
KOG0579|consensus 1187 99.08
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.08
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.07
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.07
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.07
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.07
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.07
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.07
KOG1027|consensus 903 99.07
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.06
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.06
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.06
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.06
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.06
KOG4278|consensus 1157 99.05
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.05
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.05
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.05
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.05
KOG3653|consensus 534 99.05
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.05
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.05
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.05
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.04
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.04
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.04
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.03
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.03
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.03
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.03
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.02
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.02
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.02
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.01
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.01
KOG0607|consensus 463 99.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.0
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.0
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.0
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.99
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.99
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.99
KOG2345|consensus302 98.98
KOG0032|consensus382 98.98
KOG0604|consensus400 98.98
KOG0583|consensus370 98.97
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 98.97
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.97
KOG0610|consensus459 98.96
KOG0582|consensus 516 98.96
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.96
KOG0983|consensus391 98.95
KOG0599|consensus411 98.95
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.94
KOG0576|consensus 829 98.93
KOG2052|consensus 513 98.93
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 98.91
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.89
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.88
KOG0580|consensus281 98.88
KOG0587|consensus 953 98.87
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.87
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 98.86
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.86
KOG0590|consensus601 98.86
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.84
KOG4279|consensus 1226 98.82
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.82
KOG0606|consensus 1205 98.81
KOG1033|consensus516 98.81
KOG0616|consensus355 98.8
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.8
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.8
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.78
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 98.76
KOG0598|consensus357 98.75
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.74
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.74
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 98.73
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 98.73
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.72
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 98.72
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.72
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 98.72
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 98.71
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 98.71
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.71
PTZ00263329 protein kinase A catalytic subunit; Provisional 98.71
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.71
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.7
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.7
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.7
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.7
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 98.7
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.69
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.68
PRK09188 365 serine/threonine protein kinase; Provisional 98.68
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 98.67
KOG0605|consensus550 98.67
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 98.67
PTZ00036440 glycogen synthase kinase; Provisional 98.66
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 98.66
KOG0577|consensus 948 98.66
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.65
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 98.65
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.65
KOG0668|consensus 338 98.64
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 98.64
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 98.63
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 98.63
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.63
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 98.63
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 98.62
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.62
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.62
KOG0603|consensus612 98.61
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 98.61
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.61
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.61
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.61
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 98.61
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.61
KOG0585|consensus576 98.61
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.6
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.6
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.6
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 98.6
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 98.59
KOG4645|consensus1509 98.59
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.59
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 98.59
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.58
KOG1167|consensus 418 98.58
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 98.58
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 98.58
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.57
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 98.57
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 98.57
KOG1024|consensus563 98.57
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.56
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 98.56
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 98.56
>KOG0581|consensus Back     alignment and domain information
Probab=99.82  E-value=2.6e-21  Score=140.64  Aligned_cols=77  Identities=36%  Similarity=0.648  Sum_probs=69.6

Q ss_pred             chHHHHhhhch-hhHHHHHhhhchHHHHHHHHhhcceEeCCCCCeEEeeeecccccccccCCCccccccccccccccccC
Q psy3254          87 CDFEFLKFLSY-DDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQE  165 (177)
Q Consensus        87 ~~~~~l~~l~~-~~~~~~~~~~~~~~~~~i~~l~~nil~~~~~~~~l~dfg~~~~~~~~~~~~~~~~g~~~y~aPe~~~~  165 (177)
                      .+..++.|+|. ..++|||+|            |+|+|++..|.+|+||||+++.+.+.  ...+++||..|||||.+.+
T Consensus       186 ~VL~GL~YLh~~~~IIHRDIK------------PsNlLvNskGeVKicDFGVS~~lvnS--~a~tfvGT~~YMsPERi~g  251 (364)
T KOG0581|consen  186 AVLRGLSYLHEERKIIHRDIK------------PSNLLVNSKGEVKICDFGVSGILVNS--IANTFVGTSAYMSPERISG  251 (364)
T ss_pred             HHHHHHHHHhhccCeeeccCC------------HHHeeeccCCCEEeccccccHHhhhh--hcccccccccccChhhhcC
Confidence            34677789995 899999999            77999999999999999999988765  5678999999999999999


Q ss_pred             CCCCccceEecC
Q psy3254         166 IGYDCVADMWSL  177 (177)
Q Consensus       166 ~~~~~~~Diws~  177 (177)
                      ..|+.++|||||
T Consensus       252 ~~Ys~~sDIWSL  263 (364)
T KOG0581|consen  252 ESYSVKSDIWSL  263 (364)
T ss_pred             CcCCcccceecc
Confidence            999999999997



>KOG0598|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3com_A 314 Crystal Structure Of Mst1 Kinase Length = 314 2e-27
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 6e-20
3ckw_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-19
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 2e-19
3a7f_A303 Human Mst3 Kinase Length = 303 9e-19
3ckx_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 9e-19
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-18
3q4z_A 306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 7e-13
2x7f_A 326 Crystal Structure Of The Kinase Domain Of Human Tra 8e-13
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-12
3q52_A 306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 4e-12
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 4e-12
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 5e-12
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 8e-12
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-12
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 2e-11
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 8e-12
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 7e-11
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 8e-12
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 1e-10
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 9e-12
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 9e-12
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 9e-12
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-10
1s9i_A 354 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-11
2y4i_C 395 Ksr2-Mek1 Heterodimer Length = 395 4e-11
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 4e-11
3orn_A 307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 4e-11
3eqc_A 360 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-11
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 5e-11
1s9j_A 341 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-11
2p55_A 333 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-11
3mbl_A 328 Crystal Structure Of The Human Mitogen-Activated Pr 5e-11
3dv3_A 322 Mek1 With Pf-04622664 Bound Length = 322 5e-11
4fie_A423 Full-Length Human Pak4 Length = 423 8e-11
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-10
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-10
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-10
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-10
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 2e-10
4an2_A 301 Crystal Structures Of Human Mek1 With Carboxamide-B 2e-10
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 3e-09
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 3e-09
3aln_A 327 Crystal Structure Of Human Non-Phosphorylated Mkk4 2e-08
2gcd_A 309 Tao2 Kinase Domain-Staurosporine Structure Length = 2e-08
1u5q_A 348 Crystal Structure Of The Tao2 Kinase Domain: Activa 2e-08
2z7q_A 321 Crystal Structure Of The N-Terminal Kinase Domain O 3e-08
3g51_A 325 Structural Diversity Of The Active Conformation Of 4e-08
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 5e-08
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 6e-08
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 8e-08
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 9e-08
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 1e-07
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 3e-07
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 3e-07
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 4e-07
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 4e-07
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 6e-07
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 1e-06
2yac_A 311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-06
3kb7_A 311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-06
2v5q_A 315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-06
2dyl_A 318 Crystal Structure Of Human Mitogen-Activated Protei 1e-06
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 1e-06
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 1e-06
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 2e-06
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 2e-06
3o96_A 446 Crystal Structure Of Human Akt1 With An Allosteric 2e-06
4ejn_A 446 Crystal Structure Of Autoinhibited Form Of Akt1 In 2e-06
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-06
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 3e-06
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 3e-06
3thb_A 333 Structure Of Plk1 Kinase Domain In Complex With A B 4e-06
2ou7_A 335 Structure Of The Catalytic Domain Of Human Polo-Lik 4e-06
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 4e-06
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 4e-06
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 4e-06
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 4e-06
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 4e-06
2f2u_A 402 Crystal Structure Of The Rho-Kinase Kinase Domain L 5e-06
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 5e-06
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 5e-06
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 6e-06
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-06
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 6e-06
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 6e-06
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 6e-06
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 6e-06
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 6e-06
3ama_A 351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 6e-06
2esm_A 415 Crystal Structure Of Rock 1 Bound To Fasudil Length 6e-06
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 6e-06
3v8s_A 410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 6e-06
2gnf_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-06
2v55_A 406 Mechanism Of Multi-site Phosphorylation From A Rock 6e-06
2gnj_A 350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 6e-06
2gng_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-06
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 7e-06
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 8e-06
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 8e-06
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 8e-06
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 8e-06
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 1e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-05
2uzt_A 336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 1e-05
2f7e_E 351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 1e-05
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 2e-05
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 2e-05
4dfy_A 371 Crystal Structure Of R194a Mutant Of Camp-Dependent 2e-05
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 2e-05
3g33_A 308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 2e-05
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 2e-05
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-05
1xh9_A 350 Crystal Structures Of Protein Kinase B Selective In 2e-05
3nup_A 307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 2e-05
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 3e-05
2w96_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-05
1bi8_A 326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-05
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 3e-05
1jow_B 308 Crystal Structure Of A Complex Of Human Cdk6 And A 3e-05
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 3e-05
2w99_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-05
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 3e-05
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 3e-05
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 3e-05
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-05
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-05
1szm_A 350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 4e-05
2jdt_A 351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 4e-05
2vo0_A 351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 4e-05
2uvy_A 351 Structure Of Pka-pkb Chimera Complexed With Methyl- 4e-05
3l9m_A 351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 4e-05
1q61_A 350 Pka Triple Mutant Model Of Pkb Length = 350 4e-05
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-05
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 4e-05
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 4e-05
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 4e-05
2w9f_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 4e-05
1j3h_A 350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 4e-05
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 4e-05
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 4e-05
3fhi_A 350 Crystal Structure Of A Complex Between The Catalyti 5e-05
4ae6_A 343 Structure And Function Of The Human Sperm-specific 5e-05
4ae9_A 343 Structure And Function Of The Human Sperm-specific 5e-05
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 5e-05
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 5e-05
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 5e-05
3mfr_A 351 Cask-4m Cam Kinase Domain, Native Length = 351 5e-05
1cdk_A 350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 5e-05
3pvb_A 345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 5e-05
3agl_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-05
2c1a_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-05
3agm_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-05
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 5e-05
1cmk_E 350 Crystal Structures Of The Myristylated Catalytic Su 5e-05
3dnd_A 350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 5e-05
1ctp_E 350 Structure Of The Mammalian Catalytic Subunit Of Cam 5e-05
1svh_A 350 Crystal Structure Of Protein Kinase A In Complex Wi 5e-05
1q8w_A 350 The Catalytic Subunit Of Camp-Dependent Protein Kin 5e-05
3nx8_A 351 Human Camp Dependent Protein Kinase In Complex With 5e-05
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 5e-05
2jds_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-05
1ydt_E 350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 5e-05
1stc_E 350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 5e-05
2erz_E 351 Crystal Structure Of C-amp Dependent Kinase (pka) B 5e-05
1xh7_A 350 Crystal Structures Of Protein Kinase B Selective In 5e-05
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 5e-05
1apm_E 350 2.0 Angstrom Refined Crystal Structure Of The Catal 5e-05
2qcs_A 350 A Complex Structure Between The Catalytic And Regul 5e-05
1bkx_A 350 A Binary Complex Of The Catalytic Subunit Of Camp-D 5e-05
1jbp_E 350 Crystal Structure Of The Catalytic Subunit Of Camp- 5e-05
4dfx_E 350 Crystal Structure Of Myristoylated K7c Catalytic Su 5e-05
3mvj_A 371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 5e-05
1l3r_E 350 Crystal Structure Of A Transition State Mimic Of Th 5e-05
1fmo_E 350 Crystal Structure Of A Polyhistidine-Tagged Recombi 5e-05
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 5e-05
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 5e-05
2gu8_A 337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 5e-05
1syk_A 350 Crystal Structure Of E230q Mutant Of Camp-Dependent 5e-05
2qur_A 350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 5e-05
3qal_E 350 Crystal Structure Of Arg280ala Mutant Of Catalytic 5e-05
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 5e-05
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 6e-05
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 6e-05
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 6e-05
4aw2_A 437 Crystal Structure Of Cdc42 Binding Protein Kinase A 6e-05
4dg3_E 371 Crystal Structure Of R336a Mutant Of Camp-dependent 6e-05
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 6e-05
1smh_A 350 Protein Kinase A Variant Complex With Completely Or 6e-05
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 6e-05
3c4w_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-05
3c4x_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-05
3t8o_A 543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 6e-05
3s95_A 310 Crystal Structure Of The Human Limk1 Kinase Domain 6e-05
3qc9_A 543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 7e-05
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 7e-05
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 8e-05
4hvd_A 314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 9e-05
3pjc_A 315 Crystal Structure Of Jak3 Complexed With A Potent A 1e-04
1q24_A 350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-04
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-04
3lxk_A 327 Structural And Thermodynamic Characterization Of Th 1e-04
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-04
1vzo_A 355 The Structure Of The N-Terminal Kinase Domain Of Ms 1e-04
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-04
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-04
3o7l_B 350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 1e-04
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 1e-04
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 1e-04
1z9x_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-04
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-04
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-04
2a27_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 1e-04
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-04
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 2e-04
2a2a_A 321 High-resolution Crystallographic Analysis Of The Au 2e-04
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 2e-04
2ya9_A 361 Crystal Structure Of The Autoinhibited Form Of Mous 2e-04
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-04
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-04
1wmk_A 321 Human Death-Associated Kinase Drp-1, Mutant S308d D 2e-04
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 2e-04
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 2e-04
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-04
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-04
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 2e-04
1oir_A 299 Imidazopyridines: A Potent And Selective Class Of C 2e-04
1h01_A 298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 2e-04
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 2e-04
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-04
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 2e-04
1rdq_E 350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 2e-04
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 2e-04
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-04
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 2e-04
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-04
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-04
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 2e-04
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 2e-04
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 2e-04
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 2e-04
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 2e-04
3qam_E 350 Crystal Structure Of Glu208ala Mutant Of Catalytic 2e-04
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-04
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-04
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 2e-04
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-04
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 3e-04
2vd5_A 412 Structure Of Human Myotonic Dystrophy Protein Kinas 3e-04
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 3e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-04
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 3e-04
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 3e-04
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 3e-04
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-04
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 4e-04
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 4e-04
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 4e-04
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 4e-04
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 4e-04
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 4e-04
4fr4_A 384 Crystal Structure Of Human SerineTHREONINE-Protein 4e-04
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 4e-04
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 4e-04
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 4e-04
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 5e-04
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 5e-04
2xk9_A 322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 5e-04
2ycf_A 322 Crystal Structure Of Checkpoint Kinase 2 In Complex 5e-04
2w0j_A 323 Crystal Structure Of Chk2 In Complex With Nsc 10955 5e-04
2ycr_A 323 Crystal Structure Of Checkpoint Kinase 2 In Complex 6e-04
3gni_B389 Structure Of Strad And Mo25 Length = 389 6e-04
2wtk_B373 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 6e-04
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 6e-04
2cn5_A 329 Crystal Structure Of Human Chk2 In Complex With Adp 6e-04
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 7e-04
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 7e-04
3tac_A 361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 7e-04
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 7e-04
3c0g_A 351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 8e-04
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 8e-04
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-04
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 9e-04
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure

Iteration: 1

Score = 117 bits (294), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 53/57 (92%), Positives = 55/57 (96%) Query: 121 NILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYDCVADMWSL 177 NILLNTEGHAKLADFGVAGQLTD MAKRN VIGTPFWMAPEVIQEIGY+CVAD+WSL Sbjct: 155 NILLNTEGHAKLADFGVAGQLTDXMAKRNXVIGTPFWMAPEVIQEIGYNCVADIWSL 211
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3GNI|B Chain B, Structure Of Strad And Mo25 Length = 389 Back     alignment and structure
>pdb|2WTK|B Chain B, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 373 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-36
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-35
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 4e-36
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 1e-33
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 7e-36
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 3e-32
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 8e-36
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 2e-34
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-35
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-34
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 6e-34
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 7e-29
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-33
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-33
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-30
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-30
3aln_A 327 Dual specificity mitogen-activated protein kinase; 4e-30
3aln_A327 Dual specificity mitogen-activated protein kinase; 4e-27
3fme_A290 Dual specificity mitogen-activated protein kinase; 4e-29
3fme_A290 Dual specificity mitogen-activated protein kinase; 9e-26
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-29
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-25
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 3e-28
3eqc_A360 Dual specificity mitogen-activated protein kinase; 4e-17
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 5e-28
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 7e-23
3an0_A340 Dual specificity mitogen-activated protein kinase; 8e-28
3an0_A340 Dual specificity mitogen-activated protein kinase; 3e-25
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-27
2dyl_A 318 Dual specificity mitogen-activated protein kinase 3e-27
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-25
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-23
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-24
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-08
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 2e-23
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-12
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 8e-23
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-13
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 3e-22
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 4e-20
2a19_B284 Interferon-induced, double-stranded RNA-activated 3e-22
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-08
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-20
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 6e-09
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-19
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-12
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 9e-18
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-16
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 3e-17
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-13
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 2e-16
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 5e-16
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-16
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-06
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 6e-16
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 7e-16
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-15
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-15
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-14
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-05
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-14
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-14
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 2e-14
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-04
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 2e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 7e-07
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 4e-14
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 4e-14
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 4e-14
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 4e-14
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 9e-14
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 8e-05
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 2e-13
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-13
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-04
2jo8_A51 Serine/threonine-protein kinase 4; C-terminal doma 2e-13
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 3e-13
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-13
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 5e-04
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-13
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-13
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 5e-13
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 5e-13
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 5e-13
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 5e-13
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-07
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 6e-13
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 6e-13
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 7e-13
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 7e-13
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 8e-13
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-06
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 9e-13
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 1e-12
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-12
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-12
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-12
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-05
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 2e-12
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 2e-12
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 2e-12
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-12
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-05
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-12
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-12
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-05
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 7e-12
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 9e-12
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-11
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-11
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 7e-06
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-11
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-11
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-05
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 3e-11
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 4e-11
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 4e-11
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-06
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 5e-11
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 4e-06
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 5e-11
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 9e-07
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-11
3soc_A322 Activin receptor type-2A; structural genomics cons 7e-11
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-10
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 8e-08
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-10
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-04
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 1e-10
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 2e-05
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-10
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-10
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-04
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-10
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-05
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 2e-10
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 4e-06
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 2e-10
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-06
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-10
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-10
3bhy_A283 Death-associated protein kinase 3; death associate 3e-10
3bhy_A283 Death-associated protein kinase 3; death associate 2e-06
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-10
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-06
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 4e-10
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 3e-06
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 5e-10
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 3e-06
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 5e-10
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 3e-09
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 6e-10
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-06
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 6e-10
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-06
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 6e-10
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-05
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 7e-10
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 4e-06
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 8e-10
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 7e-09
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 8e-10
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-05
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 9e-10
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 9e-06
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 9e-10
2y0a_A326 Death-associated protein kinase 1; transferase, ca 5e-06
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 1e-09
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 6e-06
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 1e-09
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 8e-08
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-09
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-09
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 5e-06
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-09
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-06
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-06
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-09
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-07
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 2e-09
3dls_A335 PAS domain-containing serine/threonine-protein KI; 5e-04
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 3e-09
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 3e-04
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 3e-09
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-07
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 3e-09
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-07
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 4e-09
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 4e-09
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-06
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 5e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-07
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 5e-09
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-06
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 6e-09
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-04
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 6e-09
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-09
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 8e-09
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 9e-04
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-08
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-07
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 1e-08
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-05
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-08
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 3e-06
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-08
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-08
2eue_A275 Carbon catabolite derepressing protein kinase; kin 4e-08
2eue_A275 Carbon catabolite derepressing protein kinase; kin 7e-04
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 4e-08
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-05
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 6e-08
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 6e-08
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 7e-05
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 6e-08
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 7e-08
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 9e-08
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 1e-07
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-07
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 2e-07
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 4e-05
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-07
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-06
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-07
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 2e-07
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 3e-06
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-07
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 3e-07
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 4e-07
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 3e-04
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 4e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 4e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 4e-07
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-07
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 6e-07
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 6e-07
3ork_A 311 Serine/threonine protein kinase; structural genomi 6e-07
3ork_A311 Serine/threonine protein kinase; structural genomi 7e-04
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 6e-07
3rp9_A458 Mitogen-activated protein kinase; structural genom 8e-07
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-06
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-04
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-06
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-06
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-06
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 2e-06
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 9e-06
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-06
2fst_X367 Mitogen-activated protein kinase 14; active mutant 2e-06
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 2e-04
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-06
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 3e-04
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-06
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-06
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-06
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 3e-06
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-06
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 4e-06
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 6e-05
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-06
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 6e-06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 7e-06
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 8e-06
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 9e-06
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 9e-06
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 3e-04
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 9e-06
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 1e-05
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-05
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-05
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-04
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-05
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-05
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 1e-05
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-05
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-05
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-05
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-05
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-05
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 2e-05
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 3e-05
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 5e-05
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 3e-05
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 5e-05
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-05
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 4e-05
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 5e-05
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-04
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 1e-04
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-04
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-04
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-04
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-04
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 3e-04
3uqc_A286 Probable conserved transmembrane protein; structur 3e-04
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 3e-04
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 3e-04
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 3e-04
3o0g_A 292 Cell division protein kinase 5; kinase activator c 3e-04
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-04
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 3e-04
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 6e-04
3niz_A 311 Rhodanese family protein; structural genomics, str 3e-04
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 4e-04
3pls_A298 Macrophage-stimulating protein receptor; protein k 4e-04
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 4e-04
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 5e-04
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 6e-04
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-04
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 8e-04
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
 Score =  126 bits (319), Expect = 4e-36
 Identities = 45/66 (68%), Positives = 58/66 (87%)

Query: 1   MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEML 60
           MAEGKPPY DIHPMRAIFMIPT PPP+FR+P++W+  F DFV +CLVK+PE+RATA+++L
Sbjct: 218 MAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLL 277

Query: 61  NHEFIQ 66
            H F++
Sbjct: 278 QHPFVR 283


>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2jo8_A Serine/threonine-protein kinase 4; C-terminal domain, human mammalian sterIle 20-like kinase 1, dimer, transferase; NMR {Homo sapiens} Length = 51 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.83
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.82
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.81
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.81
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.8
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.79
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.78
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.77
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.77
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.76
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.76
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.76
4aoj_A329 High affinity nerve growth factor receptor; transf 99.74
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.74
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.72
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.71
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.7
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.7
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.64
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.62
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.61
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.6
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.6
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.6
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.6
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.59
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.58
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.57
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.57
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.56
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.56
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.56
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.56
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.55
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.55
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.54
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.54
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.54
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.53
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.53
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.53
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.53
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.52
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.52
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.52
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.52
3niz_A 311 Rhodanese family protein; structural genomics, str 99.52
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.52
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.51
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.51
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.51
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.51
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.51
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.51
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.5
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.5
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.5
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.5
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.5
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.5
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.5
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.5
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.49
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.49
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.49
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.48
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.48
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.48
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.48
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.48
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.47
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.47
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.47
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.47
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.47
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.47
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.47
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.46
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.46
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.46
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.46
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.45
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.45
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.45
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.45
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.45
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.45
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.44
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.44
3q4u_A301 Activin receptor type-1; structural genomics conso 99.44
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.44
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.44
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.44
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.44
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.44
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.43
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.43
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.43
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.43
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.43
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.43
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.43
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.43
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.42
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.42
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.42
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.42
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.42
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.42
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.42
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.42
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.42
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.41
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.41
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.41
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.41
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.41
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.41
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.41
3soc_A322 Activin receptor type-2A; structural genomics cons 99.41
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.41
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.41
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.41
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.41
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.4
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.4
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.4
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.4
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.4
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.4
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.4
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.4
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.4
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.4
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.4
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.4
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.4
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.4
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.39
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.39
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.39
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.39
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.39
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.39
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.39
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.39
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.38
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.38
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.38
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.38
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.38
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.38
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.38
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.38
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.38
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.38
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.38
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.38
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.38
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.38
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.38
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.37
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.37
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.37
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.37
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.37
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.37
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.37
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.37
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.37
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.37
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.36
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.36
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.36
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.36
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.36
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.35
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.35
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.35
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.35
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.35
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.35
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.35
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.35
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.35
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.35
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.35
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.35
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.35
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.35
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.35
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.34
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.34
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.34
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.34
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.34
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.34
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.34
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.34
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.33
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.33
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.33
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.33
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.33
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.32
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.32
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.32
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.32
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.32
3bhy_A283 Death-associated protein kinase 3; death associate 99.32
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.32
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.32
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.32
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.32
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.31
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.31
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.31
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.31
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.31
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.31
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.3
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.3
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.3
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.3
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.3
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.3
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.3
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.3
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.29
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.29
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.29
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.29
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.28
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.28
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.28
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.28
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.28
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.27
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.27
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.27
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.27
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.27
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.26
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.26
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.26
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.26
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.25
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.25
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.25
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.25
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.24
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.23
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.22
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.2
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.17
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.16
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.12
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.12
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.1
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.09
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.07
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.06
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.02
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.01
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 98.98
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 98.95
2eue_A275 Carbon catabolite derepressing protein kinase; kin 98.94
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 98.94
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 98.94
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.93
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 98.92
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.92
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 98.9
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 98.89
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.89
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 98.88
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 98.88
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 98.87
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 98.87
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 98.87
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 98.86
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 98.86
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 98.86
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 98.86
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 98.85
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 98.85
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 98.84
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 98.83
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 98.83
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 98.83
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 98.83
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 98.83
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 98.83
3niz_A311 Rhodanese family protein; structural genomics, str 98.83
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 98.82
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 98.82
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.82
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.82
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 98.82
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.81
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 98.81
2dyl_A318 Dual specificity mitogen-activated protein kinase 98.81
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 98.8
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 98.78
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 98.78
3fme_A290 Dual specificity mitogen-activated protein kinase; 98.78
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 98.77
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 98.77
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 98.77
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 98.76
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 98.76
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 98.76
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 98.76
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 98.76
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 98.75
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 98.75
2y0a_A326 Death-associated protein kinase 1; transferase, ca 98.74
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 98.74
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 98.74
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 98.74
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 98.74
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.74
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 98.73
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 98.73
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 98.73
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 98.72
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 98.72
4aoj_A329 High affinity nerve growth factor receptor; transf 98.72
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 98.72
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 98.71
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 98.71
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 98.71
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 98.71
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 98.7
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 98.7
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 98.69
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 98.69
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 98.69
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 98.69
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 98.68
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.68
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 98.68
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 98.68
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 98.67
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 98.67
3eqc_A360 Dual specificity mitogen-activated protein kinase; 98.67
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 98.67
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 98.67
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 98.67
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 98.67
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 98.66
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 98.66
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 98.66
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.66
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 98.65
3an0_A340 Dual specificity mitogen-activated protein kinase; 98.65
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 98.65
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.64
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 98.64
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 98.64
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 98.64
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.63
2fst_X367 Mitogen-activated protein kinase 14; active mutant 98.63
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 98.63
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 98.63
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 98.62
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 98.62
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 98.62
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 98.61
3o0g_A292 Cell division protein kinase 5; kinase activator c 98.61
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 98.6
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.6
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 98.6
3bhy_A283 Death-associated protein kinase 3; death associate 98.59
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 98.57
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 98.55
3aln_A327 Dual specificity mitogen-activated protein kinase; 98.55
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 98.54
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 98.53
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 98.52
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 98.51
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 98.51
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 98.51
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 98.5
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 98.5
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 98.49
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 98.49
4ase_A353 Vascular endothelial growth factor receptor 2; tra 98.48
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.48
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 98.48
3dls_A335 PAS domain-containing serine/threonine-protein KI; 98.48
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 98.47
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 98.47
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 98.47
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 98.46
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.45
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 98.45
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 98.42
3rp9_A458 Mitogen-activated protein kinase; structural genom 98.41
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 98.4
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.39
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 98.39
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 98.38
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 98.38
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 98.36
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 98.35
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 98.34
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 98.33
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 98.32
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 98.31
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 98.3
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 98.3
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 98.28
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 98.27
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 98.27
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 98.27
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 98.26
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 98.26
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 98.25
3ork_A311 Serine/threonine protein kinase; structural genomi 98.23
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 98.23
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 98.21
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 98.19
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 98.19
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 98.18
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 98.17
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 98.17
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 98.17
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 98.16
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 98.16
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 98.16
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 98.14
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.14
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 98.13
3lzb_A327 Epidermal growth factor receptor; epidermal growth 98.13
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 98.12
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 98.1
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 98.1
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.09
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 98.08
3poz_A327 Epidermal growth factor receptor; kinase domain, a 98.08
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 98.08
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.07
3uqc_A286 Probable conserved transmembrane protein; structur 98.06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.05
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 98.05
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 98.02
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 98.01
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 98.01
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 98.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 97.99
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 97.99
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 97.99
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 97.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 97.95
2xir_A316 Vascular endothelial growth factor receptor 2; ang 97.95
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 97.95
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.94
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 97.93
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 97.92
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 97.92
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.92
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 97.9
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 97.88
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 97.86
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 97.85
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 97.82
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 97.82
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 97.77
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 97.72
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 97.72
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 97.7
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 97.64
3uqc_A286 Probable conserved transmembrane protein; structur 97.63
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 97.63
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 97.62
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 97.6
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 97.57
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 97.57
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 97.57
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 97.46
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 97.43
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 97.43
3soc_A322 Activin receptor type-2A; structural genomics cons 97.29
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 97.22
2a19_B284 Interferon-induced, double-stranded RNA-activated 97.22
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 97.21
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.21
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 97.2
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 97.19
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 97.13
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 97.11
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 97.05
3q4u_A301 Activin receptor type-1; structural genomics conso 97.04
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 97.04
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 97.01
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 96.98
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 96.84
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 96.78
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
Probab=99.83  E-value=4e-22  Score=148.02  Aligned_cols=78  Identities=37%  Similarity=0.761  Sum_probs=70.2

Q ss_pred             hHHHHhhhchhhHHHHHhhhchHHHHHHHHhhcceEeCCCCCeEEeeeecccccccccCCCccccccccccccccccCCC
Q psy3254          88 DFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIG  167 (177)
Q Consensus        88 ~~~~l~~l~~~~~~~~~~~~~~~~~~~i~~l~~nil~~~~~~~~l~dfg~~~~~~~~~~~~~~~~g~~~y~aPe~~~~~~  167 (177)
                      ...++.|+|..+++|||+|            |+||+++.++.+||+|||+|+.+........+.+||+.|||||++.+..
T Consensus       179 i~~aL~ylH~~~IiHRDlK------------p~NILl~~~g~vKl~DFGla~~~~~~~~~~~~~~GTp~YmAPEvl~~~~  246 (346)
T 4fih_A          179 VLQALSVLHAQGVIHRDIK------------SDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLP  246 (346)
T ss_dssp             HHHHHHHHHHTTEECCCCS------------GGGEEECTTCCEEECCCTTCEECCSSSCCBCCCCSCGGGCCHHHHTTCC
T ss_pred             HHHHHHHHHHCCcccccCC------------HHHEEECCCCCEEEecCcCceecCCCCCcccccccCcCcCCHHHHCCCC
Confidence            3678889999999999999            6699999999999999999998766555566789999999999999999


Q ss_pred             CCccceEecC
Q psy3254         168 YDCVADMWSL  177 (177)
Q Consensus       168 ~~~~~Diws~  177 (177)
                      |+.++||||+
T Consensus       247 y~~~~DiWSl  256 (346)
T 4fih_A          247 YGPEVDIWSL  256 (346)
T ss_dssp             BCTHHHHHHH
T ss_pred             CCcHHHHHHH
Confidence            9999999995



>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-19
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-14
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-19
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-14
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-16
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-11
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-16
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-12
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-16
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-14
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-15
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-14
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-15
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-14
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-14
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-10
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-14
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-10
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-14
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-08
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-14
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-10
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-13
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-09
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-13
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-12
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-12
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-08
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-12
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-09
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-12
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-10
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-12
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-11
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-11
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-11
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-11
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-09
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-11
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-11
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 9e-10
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 6e-11
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 8e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-11
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-09
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-10
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-08
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-10
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-08
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-10
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-04
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-10
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-07
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-10
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-08
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-10
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-10
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-10
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-06
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-10
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-08
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 4e-10
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-10
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 5e-05
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 5e-10
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-09
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 5e-10
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-10
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 7e-09
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-10
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-07
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-10
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-09
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-10
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-08
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 9e-10
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-09
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-08
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-09
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 0.003
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-09
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-05
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 3e-09
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-07
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-09
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 6e-04
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-09
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-09
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 9e-08
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-09
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 0.002
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-09
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-06
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-09
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-08
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-09
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-06
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-09
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-06
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 8e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-08
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-08
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 8e-08
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-08
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-06
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-08
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 8e-07
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 6e-08
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-07
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-07
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-07
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-04
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 81.2 bits (200), Expect = 2e-19
 Identities = 28/76 (36%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 1   MAEGKPPYGDIHPMRAIFMIPTKPPPSFREPDVWTPEFIDFVSRCLVKNPEERATASEML 60
           M EG+PPY + +P+RA+++I T   P  + P+  +  F DF++RCL  + E+R +A E+L
Sbjct: 209 MIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELL 268

Query: 61  NHEFIQVS-PGGNIPP 75
            H+F++++ P  ++ P
Sbjct: 269 QHQFLKIAKPLSSLTP 284


>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.76
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.75
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.74
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.73
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.72
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.72
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.71
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.71
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.71
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.71
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.69
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.69
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.68
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.68
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.68
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.68
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.68
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.68
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.67
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.67
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.67
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.66
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.66
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.65
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.65
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.64
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.63
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.63
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.63
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.62
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.62
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.6
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.6
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.6
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.6
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.6
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.58
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.57
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.57
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.56
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.56
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.55
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.54
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.54
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.53
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.53
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.53
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.53
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.52
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.52
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.51
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.5
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.5
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.47
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.46
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.46
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.44
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.35
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.34
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.31
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.3
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.28
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.24
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.24
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.23
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.22
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.21
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.17
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.17
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.17
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.16
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.15
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.15
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.14
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.13
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.12
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.1
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.09
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.09
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.06
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.04
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.02
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 98.95
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.95
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 98.9
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 98.89
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.88
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.88
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 98.87
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 98.81
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 98.79
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 98.79
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 98.78
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.76
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 98.69
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 98.67
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.65
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.65
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 98.64
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 98.64
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 98.63
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.62
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.56
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.54
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 98.5
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.5
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.43
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 98.42
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.36
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.33
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 98.31
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 98.3
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 98.27
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 98.21
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 97.92
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.62
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 96.71
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 96.04
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76  E-value=2.2e-20  Score=134.55  Aligned_cols=79  Identities=43%  Similarity=0.780  Sum_probs=69.8

Q ss_pred             chHHHHhhhchhhHHHHHhhhchHHHHHHHHhhcceEeCCCCCeEEeeeecccccccccCCCccccccccccccccccCC
Q psy3254          87 CDFEFLKFLSYDDLQHRMANLDCEMEREIEQLRRNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEI  166 (177)
Q Consensus        87 ~~~~~l~~l~~~~~~~~~~~~~~~~~~~i~~l~~nil~~~~~~~~l~dfg~~~~~~~~~~~~~~~~g~~~y~aPe~~~~~  166 (177)
                      +...++.|+|..+++|+|+|            |+||+++.++.+|++|||+++.+..........+||+.|||||++.+.
T Consensus       124 qi~~aL~yLH~~~iiHrDiK------------p~NILl~~~~~vkl~DFG~a~~~~~~~~~~~~~~gt~~Y~aPE~~~~~  191 (293)
T d1yhwa1         124 ECLQALEFLHSNQVIHRDIK------------SDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRK  191 (293)
T ss_dssp             HHHHHHHHHHHTTEECCCCS------------GGGEEECTTCCEEECCCTTCEECCSTTCCBCCCCSCGGGCCHHHHSSS
T ss_pred             HHHHHHHHHHHCCCcccCCc------------HHHeEECCCCcEeeccchhheeeccccccccccccCCCccChhhhcCC
Confidence            34788889999999999999            669999999999999999998876554455667899999999999999


Q ss_pred             CCCccceEecC
Q psy3254         167 GYDCVADMWSL  177 (177)
Q Consensus       167 ~~~~~~Diws~  177 (177)
                      .|+.++||||+
T Consensus       192 ~~~~~~DiwSl  202 (293)
T d1yhwa1         192 AYGPKVDIWSL  202 (293)
T ss_dssp             CBCTHHHHHHH
T ss_pred             CCCchhceehH
Confidence            99999999995



>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure