Query         psy3259
Match_columns 69
No_of_seqs    25 out of 27
Neff          2.6 
Searched_HMMs 46136
Date          Fri Aug 16 20:29:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3259.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3259hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2080|consensus               97.8 2.9E-06 6.2E-11   74.1  -1.0   52   15-66   1161-1213(1295)
  2 PF02759 RUN:  RUN domain;  Int  97.5 7.2E-05 1.6E-09   46.5   2.4   33   29-61      2-38  (133)
  3 KOG2080|consensus               94.6  0.0066 1.4E-07   53.9  -1.0   43    9-64   1134-1176(1295)
  4 PF03474 DMA:  DMRTA motif;  In  69.1     1.6 3.4E-05   25.2   0.0   26   11-36     12-38  (39)
  5 PF08611 DUF1774:  Fungal prote  59.6     4.6 9.9E-05   27.1   0.9   14   45-59      1-14  (97)
  6 cd06213 oxygenase_e_transfer_s  59.2     6.2 0.00013   26.5   1.5   28   20-47    195-223 (227)
  7 cd06193 siderophore_interactin  54.2      10 0.00022   26.0   1.9   30   19-48    199-230 (235)
  8 PLN00019 photosystem I reactio  49.9       6 0.00013   30.1   0.2   18   16-33    119-136 (223)
  9 cd06191 FNR_iron_sulfur_bindin  49.8      11 0.00023   25.4   1.4   28   20-47    199-227 (231)
 10 COG3604 FhlA Transcriptional r  47.6      10 0.00022   32.0   1.3   17   15-31    243-259 (550)
 11 PF02507 PSI_PsaF:  Photosystem  46.4       7 0.00015   28.7   0.1   19   15-33     75-93  (175)
 12 TIGR02911 sulfite_red_B sulfit  44.7      19 0.00042   25.4   2.1   30   18-47    190-220 (261)
 13 cd06196 FNR_like_1 Ferredoxin   44.2      17 0.00036   24.2   1.6   29   19-47    187-216 (218)
 14 CHL00132 psaF photosystem I su  42.2     9.4  0.0002   28.3   0.3   18   16-33     79-96  (185)
 15 KOG4381|consensus               41.8      33 0.00071   27.4   3.2   41   15-61     52-97  (368)
 16 PF08513 LisH:  LisH;  InterPro  40.7      13 0.00029   18.9   0.6   10   50-59      4-13  (27)
 17 PRK08051 fre FMN reductase; Va  40.7      19 0.00041   24.6   1.6   31   20-50    196-228 (232)
 18 cd06183 cyt_b5_reduct_like Cyt  39.6      27 0.00059   23.1   2.1   30   18-47    201-232 (234)
 19 smart00541 FYRN "FY-rich" doma  39.4     8.2 0.00018   21.9  -0.3   12   37-48     16-27  (44)
 20 PF10307 DUF2410:  Hypothetical  38.3      31 0.00068   25.1   2.4   23   14-36     68-92  (197)
 21 cd06214 PA_degradation_oxidore  37.5      29 0.00062   23.3   2.0   30   18-47    206-236 (241)
 22 cd06189 flavin_oxioreductase N  34.4      28  0.0006   23.3   1.6   29   19-47    191-220 (224)
 23 cd00322 FNR_like Ferredoxin re  33.5      32 0.00069   22.3   1.7   30   18-47    191-221 (223)
 24 PF12550 GCR1_C:  Transcription  33.4      40 0.00086   20.5   2.0   32   29-60     27-62  (81)
 25 PF05964 FYRN:  F/Y-rich N-term  33.3      11 0.00023   21.8  -0.5   15   35-49     24-38  (54)
 26 cd06221 sulfite_reductase_like  32.5      30 0.00065   24.1   1.5   29   19-47    191-220 (253)
 27 cd06215 FNR_iron_sulfur_bindin  31.1      32  0.0007   22.8   1.5   28   20-47    199-227 (231)
 28 PRK14751 tetracycline resistan  30.4      13 0.00028   20.4  -0.5   11   48-58     14-24  (28)
 29 PF00493 MCM:  MCM2/3/5 family   29.9      33 0.00072   25.5   1.5   31    2-32     39-71  (331)
 30 cd06198 FNR_like_3 NAD(P) bind  29.3      52  0.0011   21.8   2.2   30   18-47    181-211 (216)
 31 cd06187 O2ase_reductase_like T  29.1      51  0.0011   21.8   2.1   29   19-47    191-220 (224)
 32 TIGR02160 PA_CoA_Oxy5 phenylac  28.1      34 0.00075   24.8   1.3   31   20-50    209-240 (352)
 33 cd06184 flavohem_like_fad_nad_  27.7      51  0.0011   22.3   2.0   31   18-48    209-240 (247)
 34 smart00426 TEA TEA domain.      27.4      23 0.00049   22.5   0.2   32   29-60     14-51  (68)
 35 COG1221 PspF Transcriptional r  25.9      68  0.0015   25.7   2.7   31   15-46     98-128 (403)
 36 cd06209 BenDO_FAD_NAD Benzoate  25.3      60  0.0013   21.7   2.0   29   19-47    194-223 (228)
 37 PHA02054 hypothetical protein   24.9      25 0.00054   23.8   0.0   20   28-47     61-80  (94)
 38 PRK05713 hypothetical protein;  23.7      55  0.0012   23.6   1.6   29   20-48    276-305 (312)
 39 PF07615 Ykof:  YKOF-related Fa  23.4      57  0.0012   20.1   1.5   24   43-66     40-63  (81)
 40 cd06210 MMO_FAD_NAD_binding Me  23.2      70  0.0015   21.4   2.0   27   20-46    203-230 (236)
 41 cd06188 NADH_quinone_reductase  23.1      55  0.0012   23.1   1.5   29   19-47    250-279 (283)
 42 PF10986 DUF2796:  Protein of u  22.4      10 0.00022   26.7  -2.2   21    1-21     29-49  (168)
 43 PF08076 TetM_leader:  Tetracyc  22.0      36 0.00078   18.6   0.3   10   49-58     15-24  (28)
 44 PF01506 HCV_NS5a:  Hepatitis C  21.8   1E+02  0.0023   15.8   2.0   14   53-66      7-20  (23)
 45 PRK08221 anaerobic sulfite red  21.7      60  0.0013   23.0   1.5   30   19-48    193-223 (263)
 46 PRK10684 HCP oxidoreductase, N  21.5      59  0.0013   23.6   1.5   31   20-50    205-236 (332)
 47 cd06190 T4MO_e_transfer_like T  20.8      88  0.0019   20.9   2.1   30   18-47    196-227 (232)
 48 cd06194 FNR_N-term_Iron_sulfur  20.6      92   0.002   20.7   2.1   30   18-47    187-217 (222)
 49 cd06185 PDR_like Phthalate dio  20.2      89  0.0019   20.5   2.0   30   18-47    176-206 (211)
 50 KOG3285|consensus               20.2   1E+02  0.0022   23.3   2.5   35   28-63     14-48  (203)
 51 cd06197 FNR_like_2 FAD/NAD(P)   20.1      75  0.0016   21.8   1.7   20   20-39    192-211 (220)
 52 PRK08345 cytochrome-c3 hydroge  20.1      65  0.0014   23.1   1.4   28   20-47    214-242 (289)
 53 PF08030 NAD_binding_6:  Ferric  20.0      85  0.0018   19.6   1.8   22   15-36    133-154 (156)

No 1  
>KOG2080|consensus
Probab=97.81  E-value=2.9e-06  Score=74.13  Aligned_cols=52  Identities=35%  Similarity=0.503  Sum_probs=44.7

Q ss_pred             CCccceeeeecCCchHHHHHHHHHHhhccccccc-cccchHHHHHHHHHHHhh
Q psy3259          15 PQHSLTVLLLGESGLVYCMEQIFLYGFKSSRLFS-RNLNIWDLFIKIYQEIFS   66 (69)
Q Consensus        15 ~r~sLT~LLCGE~GLV~~LeqvF~~GfkS~RlF~-rn~yiWDy~~kv~~~f~~   66 (69)
                      .++.|.+++||-+|||.+++|+|+.|.+++++|- +|-.+||+|+++|.||++
T Consensus      1161 ~k~~l~~~~~~~k~L~~~~~q~~~~~~~~sl~~~f~n~~~~~~i~~v~~~~~~ 1213 (1295)
T KOG2080|consen 1161 VKSELAHLLCGQKGLVLAIEQAFQLGRQESLLKYFRNTCPWDYIERVCSWFFE 1213 (1295)
T ss_pred             HHHHHHHHHhhhHHHHHHHHhHHhhccHHHHHHHHhccChHHHHHHHHHHHHH
Confidence            3445666778889999999999999999988753 678999999999999986


No 2  
>PF02759 RUN:  RUN domain;  InterPro: IPR004012 This domain is present in several proteins that are linked to the functions of GTPases in the Rap and Rab families. They could therefore play important roles in multiple Ras-like GTPase signalling pathways.; PDB: 3CWZ_B 2CXF_A 2DWK_A 2DWG_A 2CXL_A.
Probab=97.51  E-value=7.2e-05  Score=46.52  Aligned_cols=33  Identities=33%  Similarity=0.591  Sum_probs=23.2

Q ss_pred             hHHHHHHHHHHhhcc----ccccccccchHHHHHHHH
Q psy3259          29 LVYCMEQIFLYGFKS----SRLFSRNLNIWDLFIKIY   61 (69)
Q Consensus        29 LV~~LeqvF~~GfkS----~RlF~rn~yiWDy~~kv~   61 (69)
                      |+.+||++|.||+|+    .+.+.++..+||+++++.
T Consensus         2 Lc~~le~il~hGlk~~~~~~~~~~~~~~~w~~~~~~~   38 (133)
T PF02759_consen    2 LCSALEAILSHGLKPSRSRARGFQRRSDYWDFIEKVE   38 (133)
T ss_dssp             HHHHHHHHHHTTB---SS---TT----TTHHHHHTHH
T ss_pred             hHHHHHHHHHcCCchhhHHHhhccCCCchHHHHHHHh
Confidence            679999999999996    778899999999999984


No 3  
>KOG2080|consensus
Probab=94.58  E-value=0.0066  Score=53.87  Aligned_cols=43  Identities=14%  Similarity=0.040  Sum_probs=32.4

Q ss_pred             ccCCCCCCccceeeeecCCchHHHHHHHHHHhhccccccccccchHHHHHHHHHHH
Q psy3259           9 ESFPDSPQHSLTVLLLGESGLVYCMEQIFLYGFKSSRLFSRNLNIWDLFIKIYQEI   64 (69)
Q Consensus         9 ~~~pe~~r~sLT~LLCGE~GLV~~LeqvF~~GfkS~RlF~rn~yiWDy~~kv~~~f   64 (69)
                      +|+++++++.|+.|+||+.|           ||+|.|.| |+ |+||++-+.+.-+
T Consensus      1134 ~~k~~~~~~~lg~~~n~l~~-----------~fcs~R~~-k~-~l~~~~~~~k~L~ 1176 (1295)
T KOG2080|consen 1134 KTKVSEVEHLLGEAVNALVK-----------YFCSERKV-KS-ELAHLLCGQKGLV 1176 (1295)
T ss_pred             cccchhhhhhHHHHHHHHHh-----------hhcCHHHH-HH-HHHHHHhhhHHHH
Confidence            46677777777777776666           88888888 55 9999998776544


No 4  
>PF03474 DMA:  DMRTA motif;  InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO []. DM-domain proteins with this motif are known as DMRTA proteins. The function of this region is unknown.
Probab=69.15  E-value=1.6  Score=25.15  Aligned_cols=26  Identities=27%  Similarity=0.514  Sum_probs=22.4

Q ss_pred             CCCCCCccceeeeec-CCchHHHHHHH
Q psy3259          11 FPDSPQHSLTVLLLG-ESGLVYCMEQI   36 (69)
Q Consensus        11 ~pe~~r~sLT~LLCG-E~GLV~~Leqv   36 (69)
                      .|...|+.|-..|-| ..-+|.|||++
T Consensus        12 FP~~kr~~Le~iL~~C~GDvv~AIE~~   38 (39)
T PF03474_consen   12 FPHQKRSVLELILQRCNGDVVQAIEQF   38 (39)
T ss_pred             CCCCChHHHHHHHHHcCCcHHHHHHHh
Confidence            588899999999988 56699999986


No 5  
>PF08611 DUF1774:  Fungal protein of unknown function (DUF1774);  InterPro: IPR013920  This is a fungal protein of unknown function. 
Probab=59.59  E-value=4.6  Score=27.05  Aligned_cols=14  Identities=36%  Similarity=0.892  Sum_probs=11.5

Q ss_pred             cccccccchHHHHHH
Q psy3259          45 RLFSRNLNIWDLFIK   59 (69)
Q Consensus        45 RlF~rn~yiWDy~~k   59 (69)
                      |+| -|++|||++.-
T Consensus         1 RI~-aNVfIW~~l~~   14 (97)
T PF08611_consen    1 RIF-ANVFIWVILVY   14 (97)
T ss_pred             Cee-ehhHHHHHHHH
Confidence            677 89999998753


No 6  
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate while mono-oxygenases add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with  Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=59.16  E-value=6.2  Score=26.55  Aligned_cols=28  Identities=11%  Similarity=0.286  Sum_probs=23.4

Q ss_pred             eeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      ...+||..++|.++.+.+ ..|+...|+.
T Consensus       195 ~v~~CGp~~~~~~~~~~l~~~G~~~~~i~  223 (227)
T cd06213         195 EAYLCGPPAMIDAAIAVLRALGIAREHIH  223 (227)
T ss_pred             EEEEECCHHHHHHHHHHHHHcCCCHHHEe
Confidence            478999999999998887 6788877765


No 7  
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hy
Probab=54.24  E-value=10  Score=26.03  Aligned_cols=30  Identities=20%  Similarity=0.377  Sum_probs=25.2

Q ss_pred             ceeeeecCCchHHHHHHHHH--Hhhccccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIFL--YGFKSSRLFS   48 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF~--~GfkS~RlF~   48 (69)
                      =...+||+.++|.++.+.+.  .|....|+..
T Consensus       199 ~~vyicGp~~mv~~v~~~l~~~~g~~~~~i~~  230 (235)
T cd06193         199 GYVWIAGEAGAVRALRRHLREERGVPRAQVYA  230 (235)
T ss_pred             eEEEEEccHHHHHHHHHHHHHccCCCHHHEEE
Confidence            36899999999999999995  4998887763


No 8  
>PLN00019 photosystem I reaction center subunit III; Provisional
Probab=49.95  E-value=6  Score=30.08  Aligned_cols=18  Identities=28%  Similarity=0.285  Sum_probs=12.8

Q ss_pred             CccceeeeecCCchHHHH
Q psy3259          16 QHSLTVLLLGESGLVYCM   33 (69)
Q Consensus        16 r~sLT~LLCGE~GLV~~L   33 (69)
                      |=+=.-||||++||=+-|
T Consensus       119 ~Y~~agLLCG~DGLPHLI  136 (223)
T PLN00019        119 NYGKAGLLCGADGLPHLI  136 (223)
T ss_pred             HhhhhccccCCCCCceee
Confidence            334457899999996654


No 9  
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain. FNR was intially identified as a chloroplast reductase activity catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methnae assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in
Probab=49.81  E-value=11  Score=25.38  Aligned_cols=28  Identities=18%  Similarity=0.466  Sum_probs=23.9

Q ss_pred             eeeeecCCchHHHHHHHHH-Hhhcccccc
Q psy3259          20 TVLLLGESGLVYCMEQIFL-YGFKSSRLF   47 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF~-~GfkS~RlF   47 (69)
                      ...+||..++|.++.+.+. +|+...|++
T Consensus       199 ~vyicGp~~mv~~~~~~l~~~G~~~~~i~  227 (231)
T cd06191         199 EAFICGPAGMMDAVETALKELGMPPERIH  227 (231)
T ss_pred             eEEEECCHHHHHHHHHHHHHcCCCHHHee
Confidence            5799999999999988876 688877776


No 10 
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]
Probab=47.64  E-value=10  Score=32.01  Aligned_cols=17  Identities=35%  Similarity=0.434  Sum_probs=13.9

Q ss_pred             CCccceeeeecCCchHH
Q psy3259          15 PQHSLTVLLLGESGLVY   31 (69)
Q Consensus        15 ~r~sLT~LLCGE~GLV~   31 (69)
                      .++.+|+|||||.|-=+
T Consensus       243 A~Sd~tVLi~GETGtGK  259 (550)
T COG3604         243 AKSDSTVLIRGETGTGK  259 (550)
T ss_pred             hcCCCeEEEecCCCccH
Confidence            46889999999999543


No 11 
>PF02507 PSI_PsaF:  Photosystem I reaction centre subunit III;  InterPro: IPR003666 Photosystem I (PSI) is an integral membrane protein complex that uses light energy to mediate electron transfer from plastocyanin to ferredoxin. Subunit III (or PsaF) is one of at least 14 different subunits that compose the photosystem I reaction centre (PSI-RC) [].; GO: 0015979 photosynthesis, 0009522 photosystem I, 0009538 photosystem I reaction center; PDB: 3PCQ_F 1JB0_F 2WSC_F 2WSF_F 2O01_F 2WSE_F.
Probab=46.42  E-value=7  Score=28.73  Aligned_cols=19  Identities=32%  Similarity=0.328  Sum_probs=12.0

Q ss_pred             CCccceeeeecCCchHHHH
Q psy3259          15 PQHSLTVLLLGESGLVYCM   33 (69)
Q Consensus        15 ~r~sLT~LLCGE~GLV~~L   33 (69)
                      +|=+=.-||||++||=+-+
T Consensus        75 ~~Y~~aglLCG~DGLPHLI   93 (175)
T PF02507_consen   75 ERYSKAGLLCGKDGLPHLI   93 (175)
T ss_dssp             CHCTTS-TCEBTTTCB-B-
T ss_pred             HHHHHhhcccCCCCCceee
Confidence            4445567899999986543


No 12 
>TIGR02911 sulfite_red_B sulfite reductase, subunit B. Members of this protein family include the B subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum.
Probab=44.70  E-value=19  Score=25.45  Aligned_cols=30  Identities=17%  Similarity=0.349  Sum_probs=24.4

Q ss_pred             cceeeeecCCchHHHHHHHHH-Hhhcccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIFL-YGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF~-~GfkS~RlF   47 (69)
                      +-..++||-.++|.++.+.+. +|+...|++
T Consensus       190 ~~~v~lCGp~~mv~~~~~~L~~~Gv~~~~i~  220 (261)
T TIGR02911       190 EVQAIVVGPPIMMKFTVQELLKKGIKEENIW  220 (261)
T ss_pred             ceEEEEECCHHHHHHHHHHHHHcCCCHHHEE
Confidence            446899999999999888664 888877776


No 13 
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain. The N-terminal region may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=44.24  E-value=17  Score=24.17  Aligned_cols=29  Identities=7%  Similarity=0.145  Sum_probs=23.8

Q ss_pred             ceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      -...+||-.+++.++.+++ ..|+...|++
T Consensus       187 ~~vyiCGp~~m~~~~~~~l~~~G~~~~~i~  216 (218)
T cd06196         187 QHFYVCGPPPMEEAINGALKELGVPEDSIV  216 (218)
T ss_pred             CEEEEECCHHHHHHHHHHHHHcCCCHHHEe
Confidence            3579999999999988776 5788888775


No 14 
>CHL00132 psaF photosystem I subunit III; Validated
Probab=42.19  E-value=9.4  Score=28.34  Aligned_cols=18  Identities=28%  Similarity=0.312  Sum_probs=12.5

Q ss_pred             CccceeeeecCCchHHHH
Q psy3259          16 QHSLTVLLLGESGLVYCM   33 (69)
Q Consensus        16 r~sLT~LLCGE~GLV~~L   33 (69)
                      |=+=.-||||++||=+-+
T Consensus        79 ~Y~~~~lLCG~DGLPHLI   96 (185)
T CHL00132         79 KYGRSGLLCGTDGLPHLI   96 (185)
T ss_pred             HhcccccccCCCCCceee
Confidence            334445899999986544


No 15 
>KOG4381|consensus
Probab=41.78  E-value=33  Score=27.43  Aligned_cols=41  Identities=12%  Similarity=0.265  Sum_probs=28.5

Q ss_pred             CCccceeeeecCCchHHHHHHHHHHhhc-cccc----cccccchHHHHHHHH
Q psy3259          15 PQHSLTVLLLGESGLVYCMEQIFLYGFK-SSRL----FSRNLNIWDLFIKIY   61 (69)
Q Consensus        15 ~r~sLT~LLCGE~GLV~~LeqvF~~Gfk-S~Rl----F~rn~yiWDy~~kv~   61 (69)
                      ++..-++.||      ..||+++.||.| ..+-    =..+--.|+|+..|+
T Consensus        52 ~~~~~~q~lc------~~lE~iL~hgLk~~~~~~~~~~~~~~~FW~~v~~~~   97 (368)
T KOG4381|consen   52 DSSEPVQNFC------NSLEAILSHGLKFAGKATKSSLGNQKTFWGFVRLVL   97 (368)
T ss_pred             CccHHHHHHH------HHHHHHHHhhhHHhhhccccccCCCccHHHHHHHHh
Confidence            4444455556      789999999999 3333    234456799999886


No 16 
>PF08513 LisH:  LisH;  InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions. The recently solved structure of the LisH domain in the N-terminal region of LIS1 depicted it as a novel dimerization motif, and that other structural elements are likely to play an important role in dimerisation [, , ].  The LisH (lis homology) domain mediates protein dimerisation and tetramerisation. The LisH domain is found in Sif2, a component of the Set3 complex which is responsible for repressing meiotic genes. It has been shown that the LisH domain helps mediate interaction with components of the Set3 complex []. ; PDB: 2XTE_L 2XTC_B 2XTD_A 1UUJ_B.
Probab=40.70  E-value=13  Score=18.86  Aligned_cols=10  Identities=30%  Similarity=0.610  Sum_probs=7.7

Q ss_pred             ccchHHHHHH
Q psy3259          50 NLNIWDLFIK   59 (69)
Q Consensus        50 n~yiWDy~~k   59 (69)
                      |..||||+.+
T Consensus         4 n~lI~~YL~~   13 (27)
T PF08513_consen    4 NQLIYDYLVE   13 (27)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            5679999875


No 17 
>PRK08051 fre FMN reductase; Validated
Probab=40.68  E-value=19  Score=24.57  Aligned_cols=31  Identities=16%  Similarity=0.358  Sum_probs=26.5

Q ss_pred             eeeeecCCchHHHHHHHH--HHhhccccccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF--LYGFKSSRLFSRN   50 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF--~~GfkS~RlF~rn   50 (69)
                      -..+||-.++|.++.+.+  ..|+...|+..-+
T Consensus       196 ~vyicGp~~m~~~v~~~l~~~~G~~~~~i~~e~  228 (232)
T PRK08051        196 DIYIAGRFEMAKIARELFCRERGAREEHLFGDA  228 (232)
T ss_pred             EEEEECCHHHHHHHHHHHHHHcCCCHHHeeccc
Confidence            479999999999999998  6799999987543


No 18 
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH.
Probab=39.61  E-value=27  Score=23.08  Aligned_cols=30  Identities=20%  Similarity=0.482  Sum_probs=22.3

Q ss_pred             cceeeeecCCchHH-HHHHHHH-Hhhcccccc
Q psy3259          18 SLTVLLLGESGLVY-CMEQIFL-YGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~-~LeqvF~-~GfkS~RlF   47 (69)
                      .-...+||..+++. ++.+++. .|+...+++
T Consensus       201 ~~~~~icGp~~~~~~~~~~~l~~~G~~~~~i~  232 (234)
T cd06183         201 DTLVLVCGPPPMIEGAVKGLLKELGYKKDNVF  232 (234)
T ss_pred             CeEEEEECCHHHHHHHHHHHHHHcCCCHHHEE
Confidence            34689999999999 8877764 477665553


No 19 
>smart00541 FYRN "FY-rich" domain, N-terminal region. is sometimes closely juxtaposed with the C-terminal region (FYRC), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
Probab=39.39  E-value=8.2  Score=21.91  Aligned_cols=12  Identities=42%  Similarity=0.739  Sum_probs=9.6

Q ss_pred             HHHhhccccccc
Q psy3259          37 FLYGFKSSRLFS   48 (69)
Q Consensus        37 F~~GfkS~RlF~   48 (69)
                      |=-||+|.|+|-
T Consensus        16 yP~Gy~s~R~y~   27 (44)
T smart00541       16 FPVGYKSTRKYW   27 (44)
T ss_pred             ecCCEEEEEEEe
Confidence            446999999993


No 20 
>PF10307 DUF2410:  Hypothetical protein (DUF2410);  InterPro: IPR018812  This entry represents a family of proteins conserved in fungi whose function is not known. There are two characteristic sequence motifs, GGWW and TGR. 
Probab=38.30  E-value=31  Score=25.15  Aligned_cols=23  Identities=39%  Similarity=0.534  Sum_probs=18.5

Q ss_pred             CCCccceeeeec--CCchHHHHHHH
Q psy3259          14 SPQHSLTVLLLG--ESGLVYCMEQI   36 (69)
Q Consensus        14 ~~r~sLT~LLCG--E~GLV~~Leqv   36 (69)
                      ++...||+||+|  |.++-.-++.+
T Consensus        68 ~~~dtltVLLTGR~e~~F~~lI~~m   92 (197)
T PF10307_consen   68 QDPDTLTVLLTGRRESKFSSLIERM   92 (197)
T ss_pred             cCCCeeEEEEeCCCchhHHHHHHHH
Confidence            467799999999  56877777766


No 21 
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase. PA oxidoreductases of E. coli hydroxylate PA-CoA in the second step of PA degradation. Members of this group typically fuse a ferredoxin reductase-like domain with an iron-sulfur binding cluster domain. Ferredoxins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal portion may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and
Probab=37.52  E-value=29  Score=23.31  Aligned_cols=30  Identities=20%  Similarity=0.329  Sum_probs=23.9

Q ss_pred             cceeeeecCCchHHHHHHHHH-Hhhcccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIFL-YGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF~-~GfkS~RlF   47 (69)
                      .-...+||..++|.++.+++. .|+...+++
T Consensus       206 ~~~v~icGp~~mv~~v~~~l~~~G~~~~~i~  236 (241)
T cd06214         206 FDEAFLCGPEPMMDAVEAALLELGVPAERIH  236 (241)
T ss_pred             CcEEEEECCHHHHHHHHHHHHHcCCCHHHee
Confidence            356799999999999988875 677766665


No 22 
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a substrate, rather than a tightly bound prosthetic group as in flavoenzymes; weaker binding is due to the absence of a binding site for the AMP moeity of FAD.
Probab=34.41  E-value=28  Score=23.35  Aligned_cols=29  Identities=24%  Similarity=0.463  Sum_probs=24.3

Q ss_pred             ceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      -...+||-.+++.++.+.+ ..|+...|++
T Consensus       191 ~~v~vCGp~~m~~~~~~~l~~~G~~~~~i~  220 (224)
T cd06189         191 FDVYACGSPEMVYAARDDFVEKGLPEENFF  220 (224)
T ss_pred             cEEEEECCHHHHHHHHHHHHHcCCCHHHcc
Confidence            4589999999999998888 4688887776


No 23 
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in many organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in 
Probab=33.50  E-value=32  Score=22.33  Aligned_cols=30  Identities=13%  Similarity=0.308  Sum_probs=22.6

Q ss_pred             cceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      .-...+||..+++.++.+.+ ..|+...+++
T Consensus       191 ~~~~yvCGp~~m~~~~~~~L~~~gv~~~~i~  221 (223)
T cd00322         191 GALVYICGPPAMAKAVREALVSLGVPEERIH  221 (223)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCCHHHcc
Confidence            34689999999999998877 4566655553


No 24 
>PF12550 GCR1_C:  Transcriptional activator of glycolytic enzymes;  InterPro: IPR022210  This domain family is found in eukaryotes, and is approximately 80 amino acids in length. This family is activates the transcription of glycolytic enzymes. 
Probab=33.38  E-value=40  Score=20.51  Aligned_cols=32  Identities=19%  Similarity=0.347  Sum_probs=26.1

Q ss_pred             hHHHHHHHHHHhhc----cccccccccchHHHHHHH
Q psy3259          29 LVYCMEQIFLYGFK----SSRLFSRNLNIWDLFIKI   60 (69)
Q Consensus        29 LV~~LeqvF~~Gfk----S~RlF~rn~yiWDy~~kv   60 (69)
                      =|.+||+-+--..+    ..+.|+|.--|||+|++.
T Consensus        27 sI~~le~~yG~~WR~~~~~~~~y~rRK~Ii~~I~~l   62 (81)
T PF12550_consen   27 SIRSLEKKYGSKWRRDSKERRTYSRRKVIIDFIERL   62 (81)
T ss_pred             CHHHHHHHhChhhccCcccchhHHHHHHHHHHHHHH
Confidence            47888888776666    257999999999999984


No 25 
>PF05964 FYRN:  F/Y-rich N-terminus;  InterPro: IPR003888 The "FY-rich" domain N-terminal region is sometimes closely juxtaposed with the C-terminal region (IPR003889 from INTERPRO), but sometimes is far distant. It is of unknown function, but occurs frequently in chromatin-associated proteins like trithorax and its homologues.; GO: 0005634 nucleus; PDB: 2WZO_A.
Probab=33.26  E-value=11  Score=21.78  Aligned_cols=15  Identities=47%  Similarity=0.746  Sum_probs=9.4

Q ss_pred             HHHHHhhcccccccc
Q psy3259          35 QIFLYGFKSSRLFSR   49 (69)
Q Consensus        35 qvF~~GfkS~RlF~r   49 (69)
                      -+|=.||+|.|+|-.
T Consensus        24 ~IyP~Gy~s~R~y~S   38 (54)
T PF05964_consen   24 YIYPVGYKSSRLYWS   38 (54)
T ss_dssp             -B--EEEEEEEEEE-
T ss_pred             EEeeCCEEEEEEEcc
Confidence            346679999999943


No 26 
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases. Clostridium pasteurianum inducible dissimilatory type sulfite reductase is linked to ferredoxin and reduces NH2OH and SeO3 at a lesser rate than it's normal substate SO3(2-). Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+.
Probab=32.47  E-value=30  Score=24.13  Aligned_cols=29  Identities=7%  Similarity=0.236  Sum_probs=24.1

Q ss_pred             ceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      -..++||..++|.++++++ ..|++..|+.
T Consensus       191 ~~vyicGp~~mv~~~~~~L~~~Gv~~~~i~  220 (253)
T cd06221         191 TVAIVCGPPIMMRFVAKELLKLGVPEEQIW  220 (253)
T ss_pred             cEEEEECCHHHHHHHHHHHHHcCCCHHHEE
Confidence            3589999999999998888 6788877765


No 27 
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal portion of the FAD/NAD binding domain contains most of the NADP(H) binding residues and the N-terminal sub-domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. In this ferredoxin like sub-group, the FAD/NAD sub-domains is typically fused to a C-terminal iron-sulfur binding domain. Iron-sulfur pr
Probab=31.12  E-value=32  Score=22.81  Aligned_cols=28  Identities=29%  Similarity=0.588  Sum_probs=22.3

Q ss_pred             eeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      ...+||..+++.++.+++ ..|....+++
T Consensus       199 ~v~icGp~~m~~~~~~~l~~~gv~~~~i~  227 (231)
T cd06215         199 TVFVCGPAGFMKAVKSLLAELGFPMSRFH  227 (231)
T ss_pred             eEEEECCHHHHHHHHHHHHHcCCCHHHee
Confidence            589999999999988877 4577666665


No 28 
>PRK14751 tetracycline resistance determinant leader peptide; Provisional
Probab=30.38  E-value=13  Score=20.35  Aligned_cols=11  Identities=18%  Similarity=0.863  Sum_probs=8.6

Q ss_pred             ccccchHHHHH
Q psy3259          48 SRNLNIWDLFI   58 (69)
Q Consensus        48 ~rn~yiWDy~~   58 (69)
                      .|++|-|||..
T Consensus        14 dksi~hwdf~~   24 (28)
T PRK14751         14 DKSIYHWDFYA   24 (28)
T ss_pred             cCceeeeeehh
Confidence            37899999863


No 29 
>PF00493 MCM:  MCM2/3/5 family This family extends the MCM domain of Prosite.;  InterPro: IPR001208  MCM proteins are DNA-dependent ATPases required for the initiation of eukaryotic DNA replication [, , ]. In eukaryotes there is a family of six proteins, MCM2 to MCM7. They were first identified in yeast where most of them have a direct role in the initiation of chromosomal DNA replication by interacting directly with autonomously replicating sequences (ARS). They were thus called minichromosome maintenance proteins, MCM proteins []. This family is also present in the archebacteria in 1 to 4 copies. Methanocaldococcus jannaschii (Methanococcus jannaschii) has four members, MJ0363, MJ0961, MJ1489 and MJECL13. The "MCM motif" contains Walker-A and Walker-B type nucleotide binding motifs. The diagnostic sequence defining the MCMs is IDEFDKM. Only Mcm2 (aka Cdc19 or Nda1) has been subjected to mutational analysis in this region, and most mutations abolish its activity []. The presence of a putative ATP-binding domain implies that these proteins may be involved in an ATP-consuming step in the initiation of DNA replication in eukaryotes. The MCM proteins bind together in a large complex []. Within this complex, individual subunits associate with different affinities, and there is a tightly associated core of Mcm4 (Cdc21), Mcm6 (Mis5) and Mcm7 []. This core complex in human MCMs has been associated with helicase activity in vitro [], leading to the suggestion that the MCM proteins are the eukaryotic replicative helicase.  Schizosaccharomyces pombe (Fission yeast) MCMs, like those in metazoans, are found in the nucleus throughout the cell cycle. This is in contrast to the Saccharomyces cerevisiae (Baker's yeast) in which MCM proteins move in and out of the nucleus during each cell cycle. The assembly of the MCM complex in S. pombe is required for MCM localisation, ensuring that only intact MCM complexes remain in the nucleus [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0006260 DNA replication; PDB: 3F8T_A 3F9V_A.
Probab=29.93  E-value=33  Score=25.54  Aligned_cols=31  Identities=26%  Similarity=0.414  Sum_probs=18.4

Q ss_pred             CccCCCcccCCC--CCCccceeeeecCCchHHH
Q psy3259           2 SLLGFEPESFPD--SPQHSLTVLLLGESGLVYC   32 (69)
Q Consensus         2 ~~~~~~~~~~pe--~~r~sLT~LLCGE~GLV~~   32 (69)
                      +|+|=..+..++  ..|+.+-.||+|+.|+-++
T Consensus        39 ~L~~~~~~~~~~~~~~r~~ihiLlvGdpg~gKS   71 (331)
T PF00493_consen   39 QLFGGVEKNDPDGTRIRGNIHILLVGDPGTGKS   71 (331)
T ss_dssp             CCTT--SCCCCT-TEE--S--EEEECSCHHCHH
T ss_pred             HHHhccccccccccccccccceeeccchhhhHH
Confidence            556655555554  4799999999999999874


No 30 
>cd06198 FNR_like_3 NAD(P) binding domain of  ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=29.33  E-value=52  Score=21.81  Aligned_cols=30  Identities=20%  Similarity=0.379  Sum_probs=23.7

Q ss_pred             cceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      .-...+||..+++.++.+.+ ..|+.+.+++
T Consensus       181 ~~~vyicGp~~m~~~v~~~l~~~Gv~~~~I~  211 (216)
T cd06198         181 DADVWFCGPPGMADALEKGLRALGVPARRFH  211 (216)
T ss_pred             CCeEEEECcHHHHHHHHHHHHHcCCChHhcc
Confidence            34689999999999987665 5677777776


No 31 
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate, while mono-oxygenases (aka mixed oxygenases) add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type  [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=29.13  E-value=51  Score=21.77  Aligned_cols=29  Identities=17%  Similarity=0.311  Sum_probs=21.6

Q ss_pred             ceeeeecCCchHHHHHHHHH-Hhhcccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIFL-YGFKSSRLF   47 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF~-~GfkS~RlF   47 (69)
                      -...+||..+++..+.+++. .|++..++.
T Consensus       191 ~~v~vcGp~~~~~~v~~~l~~~G~~~~~i~  220 (224)
T cd06187         191 HDIYICGPPAMVDATVDALLARGAPPERIH  220 (224)
T ss_pred             CEEEEECCHHHHHHHHHHHHHcCCCHHHee
Confidence            35799999999998877764 566665543


No 32 
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=28.09  E-value=34  Score=24.81  Aligned_cols=31  Identities=23%  Similarity=0.222  Sum_probs=25.1

Q ss_pred             eeeeecCCchHHHHHHHH-HHhhccccccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF-LYGFKSSRLFSRN   50 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF-~~GfkS~RlF~rn   50 (69)
                      ..++||..+++.++.+.+ ..|+...|++.-.
T Consensus       209 ~vyiCGp~~m~~~v~~~L~~~Gv~~~~i~~E~  240 (352)
T TIGR02160       209 EWFLCGPQAMVDDAEQALTGLGVPAGRVHLEL  240 (352)
T ss_pred             EEEEECCHHHHHHHHHHHHHcCCCHHHEEEEe
Confidence            469999999999998887 4788888876443


No 33 
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin. Flavohemoglobins have a globin domain containing a B-type heme fused with a ferredoxin reductase-like FAD/NAD-binding domain. Flavohemoglobins detoxify nitric oxide (NO) via an NO dioxygenase reaction. The hemoglobin domain adopts a globin fold with an embedded heme molecule. Flavohemoglobins also have a C-terminal reductase domain with bindiing sites for FAD and NAD(P)H. This domain catalyzes the conversion of NO + O2 + NAD(P)H to NO3- + NAD(P)+.  Instead of the oxygen transport function of hemoglobins, flavohemoglobins seem to act in NO dioxygenation and NO signalling.
Probab=27.68  E-value=51  Score=22.33  Aligned_cols=31  Identities=13%  Similarity=0.224  Sum_probs=24.3

Q ss_pred             cceeeeecCCchHHHHHHHH-HHhhccccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIF-LYGFKSSRLFS   48 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF-~~GfkS~RlF~   48 (69)
                      .-..++||..++|.++.+++ ..|++..+++.
T Consensus       209 ~~~v~icGp~~m~~~v~~~l~~~G~~~~~i~~  240 (247)
T cd06184         209 DADFYLCGPVPFMQAVREGLKALGVPAERIHY  240 (247)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCCHHHeee
Confidence            45689999999999888766 46787777763


No 34 
>smart00426 TEA TEA domain.
Probab=27.40  E-value=23  Score=22.51  Aligned_cols=32  Identities=16%  Similarity=0.094  Sum_probs=20.0

Q ss_pred             hHHHHHHHHHHhhc----c--ccccccccchHHHHHHH
Q psy3259          29 LVYCMEQIFLYGFK----S--SRLFSRNLNIWDLFIKI   60 (69)
Q Consensus        29 LV~~LeqvF~~Gfk----S--~RlF~rn~yiWDy~~kv   60 (69)
                      ++.||+..-..|-+    +  .|.++||=+|=|||-..
T Consensus        14 f~~aL~~~~~~g~~kik~~~r~k~~gRNelIs~YI~~~   51 (68)
T smart00426       14 FQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLR   51 (68)
T ss_pred             HHHHHHHcCccCcccchhhhcCcccchhHHHHHHHHHH
Confidence            34444444444544    2  44599999999998753


No 35 
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=25.89  E-value=68  Score=25.74  Aligned_cols=31  Identities=26%  Similarity=0.284  Sum_probs=26.8

Q ss_pred             CCccceeeeecCCchHHHHHHHHHHhhccccc
Q psy3259          15 PQHSLTVLLLGESGLVYCMEQIFLYGFKSSRL   46 (69)
Q Consensus        15 ~r~sLT~LLCGE~GLV~~LeqvF~~GfkS~Rl   46 (69)
                      ..+.+.+|+-||.|..+.+----.| +.|+|.
T Consensus        98 ap~~~~vLi~GetGtGKel~A~~iH-~~s~r~  128 (403)
T COG1221          98 APSGLPVLIIGETGTGKELFARLIH-ALSARR  128 (403)
T ss_pred             CCCCCcEEEecCCCccHHHHHHHHH-Hhhhcc
Confidence            5678899999999999998877777 888885


No 36 
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. As a Class I bacterial dioxygenases, benzoate dioxygenase like proteins combine an [2Fe-2S] cluster containing N-terminal ferredoxin at the end fused to an FAD/NADP(P) domain.  In dioxygenase FAD/NAD(P) binding domain, the reductase transfers 2 electrons from NAD(P)H to the oxygenase which insert into an aromatic substrate, an initial step in microbial aerobic degradation of aromatic rings. Flavin oxidoreductases use flavins as substrates, unlike flavoenzymes which have a flavin prosthetic group.
Probab=25.28  E-value=60  Score=21.71  Aligned_cols=29  Identities=17%  Similarity=0.356  Sum_probs=22.6

Q ss_pred             ceeeeecCCchHHHHHHHHH-Hhhcccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIFL-YGFKSSRLF   47 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF~-~GfkS~RlF   47 (69)
                      -...+||..+.+.++.+.+. .|+...+++
T Consensus       194 ~~v~icGp~~m~~~~~~~l~~~G~~~~~i~  223 (228)
T cd06209         194 VDVYLCGPPPMVDAVRSWLDEQGIEPANFY  223 (228)
T ss_pred             cEEEEeCCHHHHHHHHHHHHHcCCCHHHEe
Confidence            45899999999999887764 666666665


No 37 
>PHA02054 hypothetical protein
Probab=24.87  E-value=25  Score=23.75  Aligned_cols=20  Identities=35%  Similarity=0.820  Sum_probs=17.8

Q ss_pred             chHHHHHHHHHHhhcccccc
Q psy3259          28 GLVYCMEQIFLYGFKSSRLF   47 (69)
Q Consensus        28 GLV~~LeqvF~~GfkS~RlF   47 (69)
                      +-|+|+.+-|+.|+..+..|
T Consensus        61 ~svkCsd~Cfq~Gy~eAk~F   80 (94)
T PHA02054         61 GSVGCSDTCFQLGYQEAKLF   80 (94)
T ss_pred             hhcchhHHHHHHhhHHHHHH
Confidence            56889999999999999888


No 38 
>PRK05713 hypothetical protein; Provisional
Probab=23.74  E-value=55  Score=23.65  Aligned_cols=29  Identities=24%  Similarity=0.368  Sum_probs=24.4

Q ss_pred             eeeeecCCchHHHHHHHH-HHhhccccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF-LYGFKSSRLFS   48 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF-~~GfkS~RlF~   48 (69)
                      ...+||-.++|.++.+.+ ..|+...|++.
T Consensus       276 ~vyiCGp~~mv~~~~~~L~~~Gv~~~~i~~  305 (312)
T PRK05713        276 MALLCGSPASVERFARRLYLAGLPRNQLLA  305 (312)
T ss_pred             EEEEeCCHHHHHHHHHHHHHcCCCHHHeee
Confidence            479999999999987776 48999888873


No 39 
>PF07615 Ykof:  YKOF-related Family;  InterPro: IPR011522 This entry represents YkoF-related proteins. YkoF is involved in the hydroxymethyl pyrimidine (HMP) salvage pathway []. The domain is found in pairs in these proteins.; PDB: 1S7H_A 1S99_A 1SBR_B.
Probab=23.44  E-value=57  Score=20.15  Aligned_cols=24  Identities=13%  Similarity=0.266  Sum_probs=18.1

Q ss_pred             cccccccccchHHHHHHHHHHHhh
Q psy3259          43 SSRLFSRNLNIWDLFIKIYQEIFS   66 (69)
Q Consensus        43 S~RlF~rn~yiWDy~~kv~~~f~~   66 (69)
                      |.||++.---+||+++.+..+..+
T Consensus        40 sT~l~G~~~~Vf~~l~~~~~~a~~   63 (81)
T PF07615_consen   40 STQLRGDEEDVFDALEAAFERAAE   63 (81)
T ss_dssp             EEEEECBHHHHHHHHHHHHHHHHC
T ss_pred             EEEEECCHHHHHHHHHHHHHHHhc
Confidence            678888888888888887776543


No 40 
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol. This multicomponent enzyme mediates electron transfer via a hydroxylase (MMOH), a coupling protein, and a reductase which is comprised of an N-terminal [2Fe-2S] ferredoxin domain, an FAD binding subdomain, and an NADH binding subdomain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. Dioxygenases add both atom of oxygen to the substrate, while mono-oxygenases add one atom to the substrate and one atom to water.
Probab=23.17  E-value=70  Score=21.42  Aligned_cols=27  Identities=19%  Similarity=0.253  Sum_probs=20.8

Q ss_pred             eeeeecCCchHHHHHHHHH-Hhhccccc
Q psy3259          20 TVLLLGESGLVYCMEQIFL-YGFKSSRL   46 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF~-~GfkS~Rl   46 (69)
                      ...+||..++|.++.+.+. .|+...|+
T Consensus       203 ~vyicGp~~m~~~~~~~l~~~G~~~~~i  230 (236)
T cd06210         203 DIYLCGPPGMVDAAFAAAREAGVPDEQV  230 (236)
T ss_pred             EEEEeCCHHHHHHHHHHHHHcCCCHHHe
Confidence            5799999999999988774 56654444


No 41 
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase, and has NADH and FAD binding sites. (Na+-NQR) is distinct from H+-translocating NADH:quinone oxidoreductases and noncoupled NADH:quinone oxidoreductases. The NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain of this group typically contains an iron-sulfur cluster binding domain.
Probab=23.05  E-value=55  Score=23.09  Aligned_cols=29  Identities=10%  Similarity=0.199  Sum_probs=23.8

Q ss_pred             ceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      -...+||-.+++.++.+++ ..|+...|++
T Consensus       250 ~~vyiCGP~~m~~~~~~~l~~~Gv~~~~i~  279 (283)
T cd06188         250 IEFYLCGPPPMNSAVIKMLDDLGVPRENIA  279 (283)
T ss_pred             eEEEEECCHHHHHHHHHHHHHcCCCHHHee
Confidence            4579999999999998876 6788877775


No 42 
>PF10986 DUF2796:  Protein of unknown function (DUF2796);  InterPro: IPR021253  This bacterial family of proteins has no known function. 
Probab=22.43  E-value=10  Score=26.66  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=16.6

Q ss_pred             CCccCCCcccCCCCCCcccee
Q psy3259           1 MSLLGFEPESFPDSPQHSLTV   21 (69)
Q Consensus         1 ~~~~~~~~~~~pe~~r~sLT~   21 (69)
                      |.++|||..++.+++|..|..
T Consensus        29 ~dlvGFEhap~t~~~~~~~~~   49 (168)
T PF10986_consen   29 ADLVGFEHAPRTDEQKAALAA   49 (168)
T ss_pred             ccccccccCCCCHHHHHHHHH
Confidence            578999999998888766543


No 43 
>PF08076 TetM_leader:  Tetracycline resistance determinant leader peptide;  InterPro: IPR012992 The antibiotic tetracycline has a broad spectrum of activity, acting to inhibit bacterial protein synthesis by binding to the 30S ribosomal subunit, which prevents the association of the aminoacyl-tRNA to the ribosomal acceptor A site. Tetracycline binding is reversible, therefore diluting out the antibiotic can reverse its effects. Tetracycline resistance genes are often located on mobile elements, such as plasmids, transposons and/or conjugative transposons, which can sometimes be transferred between bacterial species. In certain cases, tetracycline can enhance the transfer of these elements, thereby promoting resistance amongst a bacterial colony. There are three types of tetracycline resistance: tetracycline efflux, ribosomal protection, and tetracycline modification [, ]:    Tetracycline efflux proteins belong to the major facilitator superfamily. Efflux proteins are membrane-associated proteins that recognise and export tetracycline from the cell. They are found in both Gram-positive and Gram-negative bacteria []. There are at least 22 different tetracycline efflux proteins, grouped according to sequence similarity: Group 1 are Tet(A), Tet(B), Tet(C), Tet(D), Tet(E), Tet(G), Tet(H), Tet(J), Tet(Z) and Tet(30); Group 2 are Tet(K) and Tet(L); Group 3 are Otr(B) and Tcr(3); Group 4 is TetA(P); Group 5 is Tet(V). In addition, there are the efflux proteins Tet(31), Tet(33), Tet(V), Tet(Y), Tet(34), and Tet(35).     Ribosomal protection proteins are cytoplasmic proteins that display homology with the elongation factors EF-Tu and EF-G. Protection proteins bind the ribosome, causing an alteration in ribosomal conformation that prevents tetracycline from binding. There are at least ten ribosomal protection proteins: Tet(M), Tet(O), Tet(S), Tet(W), Tet(32), Tet(36), Tet(Q), Tet(T), Otr(A), and TetB(P). Both Tet(M) and Tet(O) have ribosome-dependent GTPase activity, the hydrolysis of GTP providing the energy for the ribosomal conformational changes.      Tetracycline modification proteins include the enzymes Tet(37) and Tet(X), both of which inactivate tetracycline. In addition, there are the tetracycline resistance proteins Tet(U) and Otr(C).   The expression of several of these tet genes is controlled by a family of tetracycline transcriptional regulators known as TetR. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity []. The TetR proteins identified in over 115 genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response.   This entry represents the tetracycline resistance leader peptide, which can be found in Tet(M) ribosomal protection proteins. A short open reading frame corresponding to a 28 amino acid peptide, which contains a number of inverted repeat sequences was found immediately upstream of tet(M). Transcriptional analyses has found that expression of tet(M) resulted from an extension of a small transcript representing the upstream leader region into the resistance determinant. Therefore, this leader sequence is responsible for transcriptional attenuation and thus regulation of the transcription of tet(M) [].
Probab=21.95  E-value=36  Score=18.63  Aligned_cols=10  Identities=20%  Similarity=0.704  Sum_probs=8.1

Q ss_pred             cccchHHHHH
Q psy3259          49 RNLNIWDLFI   58 (69)
Q Consensus        49 rn~yiWDy~~   58 (69)
                      +++|-|||..
T Consensus        15 ~S~y~WDF~~   24 (28)
T PF08076_consen   15 KSIYHWDFCS   24 (28)
T ss_pred             cceeehhhhh
Confidence            6889999864


No 44 
>PF01506 HCV_NS5a:  Hepatitis C virus non-structural 5a protein membrane anchor;  InterPro: IPR002868 The molecular function of the non-structural 5a viral protein is uncertain. The NS5a protein is phosphorylated when expressed in mammalian cells. It is thought to interact with the dsRNA-dependent (interferon inducible) kinase PKR, P19525 from SWISSPROT [, ].; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0017111 nucleoside-triphosphatase activity; PDB: 1R7F_A 1R7E_A 1R7C_A 1R7G_A 1R7D_A.
Probab=21.83  E-value=1e+02  Score=15.75  Aligned_cols=14  Identities=21%  Similarity=0.724  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHHhh
Q psy3259          53 IWDLFIKIYQEIFS   66 (69)
Q Consensus        53 iWDy~~kv~~~f~~   66 (69)
                      +||.+-++-..|.+
T Consensus         7 iWdWvc~~l~~~~~   20 (23)
T PF01506_consen    7 IWDWVCRVLRDFKT   20 (23)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            68888887777654


No 45 
>PRK08221 anaerobic sulfite reductase subunit B; Provisional
Probab=21.71  E-value=60  Score=22.99  Aligned_cols=30  Identities=17%  Similarity=0.327  Sum_probs=24.2

Q ss_pred             ceeeeecCCchHHHHHHHH-HHhhccccccc
Q psy3259          19 LTVLLLGESGLVYCMEQIF-LYGFKSSRLFS   48 (69)
Q Consensus        19 LT~LLCGE~GLV~~LeqvF-~~GfkS~RlF~   48 (69)
                      -..++||..+.|.++.+.+ ..|+...|++.
T Consensus       193 ~~vylCGp~~mv~~~~~~L~~~Gv~~~~i~~  223 (263)
T PRK08221        193 MQVIVVGPPIMMKFTVLEFLKRGIKEENIWV  223 (263)
T ss_pred             eEEEEECCHHHHHHHHHHHHHcCCCHHHEEE
Confidence            4579999999999877766 58998888774


No 46 
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional
Probab=21.50  E-value=59  Score=23.60  Aligned_cols=31  Identities=26%  Similarity=0.397  Sum_probs=25.6

Q ss_pred             eeeeecCCchHHHHHHHH-HHhhccccccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF-LYGFKSSRLFSRN   50 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF-~~GfkS~RlF~rn   50 (69)
                      ...+||-.+++.++.+.+ ..|+...|++.-.
T Consensus       205 ~vyiCGP~~m~~~v~~~l~~~Gv~~~~i~~E~  236 (332)
T PRK10684        205 TVMTCGPAPYMDWVEQEVKALGVTADRFFKEK  236 (332)
T ss_pred             EEEEECCHHHHHHHHHHHHHcCCCHHHeEeec
Confidence            579999999999998887 5688888887433


No 47 
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system. Electron transfer is from NADH to an NADH:ferredoxin oxidoreductase (TmoF in P. mendocina) to ferredoxin to an iron-containing oxygenase. TmoF is homologous to other mono- and dioxygenase systems within the ferredoxin reductase family.
Probab=20.75  E-value=88  Score=20.89  Aligned_cols=30  Identities=10%  Similarity=0.314  Sum_probs=23.0

Q ss_pred             cceeeeecCCchHHHHHHHHH-Hhhc-ccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIFL-YGFK-SSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF~-~Gfk-S~RlF   47 (69)
                      .-...+||-.+++.++.+.+. .|-. +.|+.
T Consensus       196 ~~~vyiCGp~~m~~~v~~~l~~~g~~~~~~i~  227 (232)
T cd06190         196 EFEFYFAGPPPMVDAVQRMLMIEGVVPFDQIH  227 (232)
T ss_pred             ccEEEEECCHHHHHHHHHHHHHhCCCChHhee
Confidence            357899999999999988874 5544 66664


No 48 
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second e
Probab=20.57  E-value=92  Score=20.66  Aligned_cols=30  Identities=23%  Similarity=0.342  Sum_probs=22.7

Q ss_pred             cceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      .-...+||..+++.++.+.+ ..|+...|+.
T Consensus       187 ~~~vyicGp~~m~~~~~~~L~~~Gv~~~~i~  217 (222)
T cd06194         187 DDVVYLCGAPSMVNAVRRRAFLAGAPMKRIY  217 (222)
T ss_pred             CCEEEEeCCHHHHHHHHHHHHHcCCCHHHee
Confidence            34689999999999877665 4577766665


No 49 
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal  ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.
Probab=20.24  E-value=89  Score=20.48  Aligned_cols=30  Identities=20%  Similarity=0.384  Sum_probs=23.8

Q ss_pred             cceeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          18 SLTVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        18 sLT~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      .-...+||..++|.++.+.+ .+|..+.++.
T Consensus       176 ~~~vyicGp~~m~~~~~~~l~~~gv~~~~i~  206 (211)
T cd06185         176 GTHVYVCGPEGMMDAVRAAAAALGWPEARLH  206 (211)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCChhheE
Confidence            35789999999999988776 3677777765


No 50 
>KOG3285|consensus
Probab=20.16  E-value=1e+02  Score=23.31  Aligned_cols=35  Identities=23%  Similarity=0.452  Sum_probs=28.2

Q ss_pred             chHHHHHHHHHHhhccccccccccchHHHHHHHHHH
Q psy3259          28 GLVYCMEQIFLYGFKSSRLFSRNLNIWDLFIKIYQE   63 (69)
Q Consensus        28 GLV~~LeqvF~~GfkS~RlF~rn~yiWDy~~kv~~~   63 (69)
                      |=-.-.-..|.||..| =||||-+|+=+=|.+|+.|
T Consensus        14 GSa~iV~EFf~y~iNS-ILyQRgiYPaEdF~~vkKY   48 (203)
T KOG3285|consen   14 GSAQIVSEFFEYGINS-ILYQRGIYPAEDFVRVKKY   48 (203)
T ss_pred             chHHHHHHHHHhhhhH-HHHhccCCcHHHhhHHHhc
Confidence            3344456789999876 6999999999999998876


No 51 
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of  ferredoxin reductase-like proteins. Ferredoxin reductase (FNR) was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and have a variety of physiological  functions in a variety of organisms including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which varies in orientation with respect  to the NAD(P) binding domain. The N-terminal moeity 
Probab=20.12  E-value=75  Score=21.76  Aligned_cols=20  Identities=20%  Similarity=0.122  Sum_probs=17.5

Q ss_pred             eeeeecCCchHHHHHHHHHH
Q psy3259          20 TVLLLGESGLVYCMEQIFLY   39 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF~~   39 (69)
                      ..++||-.+++.++.+.+.-
T Consensus       192 ~v~~CGP~~m~~~~~~~~~~  211 (220)
T cd06197         192 EVYLCGPPALEKAVLEWLEG  211 (220)
T ss_pred             cEEEECcHHHHHHHHHHhhh
Confidence            57999999999999998763


No 52 
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional
Probab=20.07  E-value=65  Score=23.14  Aligned_cols=28  Identities=11%  Similarity=0.259  Sum_probs=23.4

Q ss_pred             eeeeecCCchHHHHHHHH-HHhhcccccc
Q psy3259          20 TVLLLGESGLVYCMEQIF-LYGFKSSRLF   47 (69)
Q Consensus        20 T~LLCGE~GLV~~LeqvF-~~GfkS~RlF   47 (69)
                      ..++||-.+++.++.+.+ ..|....+++
T Consensus       214 ~vyiCGP~~m~~~v~~~L~~~Gv~~~~i~  242 (289)
T PRK08345        214 YAAICGPPVMYKFVFKELINRGYRPERIY  242 (289)
T ss_pred             EEEEECCHHHHHHHHHHHHHcCCCHHHEE
Confidence            479999999999999877 4788777766


No 53 
>PF08030 NAD_binding_6:  Ferric reductase NAD binding domain;  InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3A1F_A.
Probab=20.01  E-value=85  Score=19.56  Aligned_cols=22  Identities=14%  Similarity=0.246  Sum_probs=16.7

Q ss_pred             CCccceeeeecCCchHHHHHHH
Q psy3259          15 PQHSLTVLLLGESGLVYCMEQI   36 (69)
Q Consensus        15 ~r~sLT~LLCGE~GLV~~Leqv   36 (69)
                      +.+++.++.||-.+|+..+.++
T Consensus       133 ~~~~~~V~~CGP~~m~~~vr~~  154 (156)
T PF08030_consen  133 SSGRVAVFVCGPPSMVDDVRNA  154 (156)
T ss_dssp             TT-EEEEEEES-HHHHHHHHHH
T ss_pred             CCCcEEEEEcCcHHHHHHHHHH
Confidence            4568889999999999988764


Done!