RPS-BLAST 2.2.26 [Sep-21-2011]

Database: pdb70 
           27,921 sequences; 6,701,793 total letters

Searching..................................................done

Query= psy3259
         (69 letters)



>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two
          component system, AAA domain, NTRC family, DNA-binding;
          HET: ATP; 3.0A {Salmonella typhimurium}
          Length = 304

 Score = 25.5 bits (57), Expect = 1.3
 Identities = 6/9 (66%), Positives = 8/9 (88%)

Query: 20 TVLLLGESG 28
          TVL+ G+SG
Sbjct: 27 TVLIHGDSG 35


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
          photosynthetic reaction center, peripheral antenna;
          HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 25.3 bits (54), Expect = 1.4
 Identities = 5/20 (25%), Positives = 9/20 (45%), Gaps = 5/20 (25%)

Query: 2  SLLGFEPESFPDSPQHSLTV 21
          SL  +  +S P     +L +
Sbjct: 28 SLKLYADDSAP-----ALAI 42


>2bjv_A PSP operon transcriptional activator; AAA, transcription
          activation, gene regulation, sigma54 activator,
          enhancer binding protein, PSPF; 1.7A {Escherichia coli}
          PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*
          Length = 265

 Score = 24.8 bits (55), Expect = 2.0
 Identities = 5/9 (55%), Positives = 7/9 (77%)

Query: 20 TVLLLGESG 28
           VL++GE G
Sbjct: 31 PVLIIGERG 39


>1nsx_A Galactose mutarotase; epimerase, galactose metabolism, isomerase;
           HET: GAL; 1.75A {Lactococcus lactis} SCOP: b.30.5.4 PDB:
           1nsz_A* 1mmu_A* 1l7k_A* 1l7j_A* 1mmx_A* 1mmy_A* 1mmz_A*
           1mn0_A* 1ns0_A* 1ns4_A* 1ns8_A* 1nsr_A* 1nsu_A* 1nsv_A*
           1ns7_A* 1ns2_A* 1nsm_A* 1nss_A*
          Length = 347

 Score = 24.8 bits (55), Expect = 2.1
 Identities = 5/12 (41%), Positives = 6/12 (50%)

Query: 6   FEPESFPDSPQH 17
           FE +  P S Q 
Sbjct: 303 FECQVSPGSEQI 314


>2dwk_A Protein RUFY3; RUN domain, effector, RAP2, bundle, protein
          binding, structural genomics, NPPSFA; 2.00A {Mus
          musculus} PDB: 2dwg_A 2cxf_A 2cxl_A
          Length = 180

 Score = 24.6 bits (53), Expect = 2.5
 Identities = 6/33 (18%), Positives = 12/33 (36%), Gaps = 1/33 (3%)

Query: 29 LVYCMEQIFLYGFKSSR-LFSRNLNIWDLFIKI 60
              ME    +G K+ +    +N + W     +
Sbjct: 47 FFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELV 79


>1lur_A Aldose 1-epimerase; vitamin B12, methyltransferase, structural
           genomics, structure-based function assignment,
           decarboxylase, PSI; 1.85A {Caenorhabditis elegans} SCOP:
           b.30.5.4
          Length = 339

 Score = 24.4 bits (54), Expect = 3.0
 Identities = 3/12 (25%), Positives = 5/12 (41%)

Query: 6   FEPESFPDSPQH 17
            EP+    +P  
Sbjct: 302 IEPQFHSAAPNF 313


>1snz_A Aldose 1-epimerase; mutarotase, galactosemia, isomerase; 2.20A
           {Homo sapiens} SCOP: b.30.5.4 PDB: 1so0_A*
          Length = 344

 Score = 24.4 bits (54), Expect = 3.2
 Identities = 3/12 (25%), Positives = 7/12 (58%)

Query: 6   FEPESFPDSPQH 17
            E +++PD+   
Sbjct: 308 LETQNWPDAVNQ 319


>3imh_A Galactose-1-epimerase; structural genomics, PSI-2, protein ST
           initiative, NEW YORK SGX research center for structural
           GEN nysgxrc; 1.76A {Lactobacillus acidophilus}
          Length = 338

 Score = 24.4 bits (54), Expect = 3.6
 Identities = 3/12 (25%), Positives = 4/12 (33%)

Query: 6   FEPESFPDSPQH 17
           FE +  P     
Sbjct: 298 FEAQCPPAEGND 309


>1yga_A Hypothetical 37.9 kDa protein in BIO3-HXT17 intergenic region;
           aldose_1_epimerase, sugar metabolism, predicted,
           structural genomics; 2.00A {Saccharomyces cerevisiae}
          Length = 342

 Score = 24.1 bits (53), Expect = 4.9
 Identities = 1/12 (8%), Positives = 4/12 (33%)

Query: 6   FEPESFPDSPQH 17
            +   + D+   
Sbjct: 306 VQQGRYVDAINR 317


>3co5_A Putative two-component system transcriptional RES regulator;
          structural genomics, APC89341.1; 2.40A {Neisseria
          gonorrhoeae}
          Length = 143

 Score = 23.7 bits (52), Expect = 4.9
 Identities = 5/13 (38%), Positives = 8/13 (61%)

Query: 16 QHSLTVLLLGESG 28
          + +  V L GE+G
Sbjct: 25 KRTSPVFLTGEAG 37


>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54
           activator, bacterial transcription, DIM transcription;
           HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1
           c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A*
          Length = 387

 Score = 24.0 bits (53), Expect = 5.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)

Query: 20  TVLLLGESG 28
            VL+ GESG
Sbjct: 162 PVLITGESG 170


>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural
          genomics, center for structural genomics; 2.80A
          {Escherichia coli}
          Length = 145

 Score = 23.6 bits (52), Expect = 6.0
 Identities = 4/13 (30%), Positives = 6/13 (46%)

Query: 16 QHSLTVLLLGESG 28
          +  + V L G  G
Sbjct: 22 ETDIAVWLYGAPG 34


>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+
           ATPase, response regulator, transcriptional activator,
           ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB:
           1zit_A 2jrl_A
          Length = 368

 Score = 23.6 bits (52), Expect = 6.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)

Query: 20  TVLLLGESG 28
            VL+ GESG
Sbjct: 154 PVLITGESG 162


  Database: pdb70
    Posted date:  Sep 4, 2012  3:40 AM
  Number of letters in database: 6,701,793
  Number of sequences in database:  27,921
  
Lambda     K      H
   0.328    0.144    0.442 

Gapped
Lambda     K      H
   0.267   0.0828    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27921
Number of Hits to DB: 1,004,938
Number of extensions: 42562
Number of successful extensions: 147
Number of sequences better than 10.0: 1
Number of HSP's gapped: 147
Number of HSP's successfully gapped: 16
Length of query: 69
Length of database: 6,701,793
Length adjustment: 39
Effective length of query: 30
Effective length of database: 5,612,874
Effective search space: 168386220
Effective search space used: 168386220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (23.2 bits)