BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3260
         (100 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LWT|X Chain X, Crystal Structure Of The Yeast Sac1: Implications For Its
           Phosphoinositide Phosphatase Function
          Length = 505

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 44/63 (69%), Gaps = 6/63 (9%)

Query: 41  IISRLSCERAGTRFNVRGVNDDGHVANFVETEQVLFLDD------EVTSYVQTRGSVPLF 94
           +I+R S  RAGTR+  RGV+ DG+V NF ETEQ+L  ++       V S++QTRGSVP++
Sbjct: 204 LITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEKIHVFSFLQTRGSVPIY 263

Query: 95  WEQ 97
           W +
Sbjct: 264 WAE 266


>pdb|1T2A|A Chain A, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase
 pdb|1T2A|B Chain B, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase
 pdb|1T2A|C Chain C, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase
 pdb|1T2A|D Chain D, Crystal Structure Of Human Gdp-D-Mannose 4,6-Dehydratase
          Length = 375

 Score = 26.6 bits (57), Expect = 3.5,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 35  RQARAVIISRLSCERAGTRFNVRGVNDDGHVANFVETEQVLFLDDEVTSYVQTRGSV 91
           R    + + +L C   G   N+    D GH  ++VE   ++  +DE   +V   G V
Sbjct: 226 RSVAKIYLGQLECFSLG---NLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEV 279


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.439 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,895,589
Number of Sequences: 62578
Number of extensions: 93037
Number of successful extensions: 245
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 243
Number of HSP's gapped (non-prelim): 2
length of query: 100
length of database: 14,973,337
effective HSP length: 66
effective length of query: 34
effective length of database: 10,843,189
effective search space: 368668426
effective search space used: 368668426
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)